Protein Family IF09101

Metagenome Isolate
197 Members
72 Samples
173 Scaffolds
322.4 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_035538|Ga0466703_035538_755_1804
Length
349 aa
Sequence
MTFIKWLPFAPIRRLVNKEKSKKNNMSETIKEPIEPFGLFSKDKKKSLFSKIGVVGAGKDGRNIIRLTSSAGLEVIFIEVNQERIDFAFERLSAGLDSRIENWGLTPNEKRAILGRIKGSTDYADLQDCDFVIECIRYDKETGERNTYLRQQAFKEIESIVLPEAIIATNSTTVIISELASVLKYKERCVSLHFPVAHPDAKILEVVKGAYTTQEVYDKVLLFAKLINYEIIEANESNGLVSMRLIVVLLNEACQMLMEKTAKMETIDRLTVVSYGMRIGIFQMADIIGIEKLVSLMEDMFNEYGDKKYKPNPILWRLYRTQQLGIPTGKGFFIYNKDGILTGPNPFFN

📊 Sample Types

Isolate 12.2%
Metagenome 87.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.0%
Kalotermitidae 18.3%
Blattidae 16.9%
Unclassified 15.5%
Rhinotermitidae 7.0%
Termopsidae 4.2%
Passalidae 2.8%
Hydrophilidae 2.8%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 187
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
4 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
5 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
6 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
16 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
17 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
18 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
19 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
22 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
28 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
29 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
30 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
33 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
34 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
40 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
50 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
56 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
57 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
58 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
59 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
60 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
61 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
62 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
63 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
64 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
66 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
67 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
68 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
69 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
70 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
71 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10010444 3300009784 Bacteria 11814
2 Ga0123353_10220107 3300010167 Bacteria 2969
3 Ga0466734_077536 3300042623 Bacteria 1027
4 Ga0466730_078089 3300042625 Bacteria 2976
5 Ga0466703_046039 3300042636 Bacteria 8932
6 Ga0466704_556113 3300042643 Bacteria 5947
7 Ga0466709_106408 3300042648 Bacteria 13749
8 Ga0466690_318861 3300042590 Bacteria 7814
9 Ga0466692_189168 3300042591 Bacteria 10793
10 Ga0466694_313292 3300042594 Bacteria 2662
11 Ga0466696_244582 3300042596 Bacteria 16816
12 Ga0466701_023932 3300042598 Bacteria 3824
13 Ga0466707_157817 3300042601 Bacteria 16055
14 Ga0466707_165588 3300042601 Bacteria 25190
15 Ga0466713_055139 3300042602 Bacteria 14361
16 Ga0466713_122827 3300042602 Bacteria 174567
17 Ga0466716_225095 3300042605 Bacteria 6604
18 Ga0466716_495992 3300042605 Bacteria 7025
19 JGI24699J35502_11134213 3300002509 Bacteria 63023
20 Ga0123357_10002521 3300009784 Bacteria 20500
21 Ga0466705_422592 3300042612 Bacteria 6487
22 Ga0466711_185820 3300042615 Bacteria 5199
23 Ga0466723_141970 3300042618 Bacteria 8148
24 Ga0466726_105741 3300042619 Bacteria 4244
25 Ga0466726_287830 3300042619 Bacteria 1527
26 Ga0466697_130443 3300042611 Bacteria 1553
27 Ga0466697_274917 3300042611 Bacteria 203310
28 Ga0466705_170456 3300042612 Bacteria 31533
29 Ga0466733_088004 3300042659 Bacteria 203974
30 Ga0123357_10195927 3300009784 Unclassified 2314
31 Ga0123354_10064008 3300010882 Bacteria 5398
32 Ga0466735_088535 3300042624 Bacteria 11616
33 Ga0466703_262774 3300042636 Bacteria 2577
34 Ga0466703_342328 3300042636 Archaea 1513
35 Ga0466704_433787 3300042643 Bacteria 28916
36 Ga0466704_488602 3300042643 Bacteria 43344
37 Ga0466727_008762 3300042655 Bacteria 5046
38 Ga0466727_081347 3300042655 Bacteria 65648
39 Ga0466690_314971 3300042590 Bacteria 5469
40 Ga0466696_139714 3300042596 Bacteria 7938
41 Ga0466696_155407 3300042596 Bacteria 18897
42 Ga0466696_424899 3300042596 Bacteria 3038
43 Ga0466719_558082 3300042606 Bacteria 5471
44 IMNBL1DRAFT_c0002295 3300000062 Bacteria 13432
45 JGI24702J35022_10028586 3300002462 Bacteria 2994
46 JGI24702J35022_10218607 3300002462 Unclassified 1097
47 Ga0466711_031273 3300042615 Bacteria 15909
48 Ga0466711_320200 3300042615 Bacteria 3971
49 Ga0466715_017060 3300042616 Bacteria 15472
50 Ga0466723_360804 3300042618 Bacteria 8062
51 Ga0466726_238359 3300042619 Bacteria 5831
52 Ga0123353_10784183 3300010167 Unclassified 1319
53 Ga0123354_10001124 3300010882 Bacteria 31160
54 Ga0123354_10032063 3300010882 Bacteria 8240
55 Ga0466725_130397 3300042654 Bacteria 14031
56 Ga0466656_090463 3300042550 Bacteria 2220
57 Ga0466692_003792 3300042591 Bacteria 13439
58 Ga0466692_016441 3300042591 Bacteria 1093
59 Ga0466691_106009 3300042593 Bacteria 1931
60 Ga0466700_293568 3300042600 Bacteria 5024
61 Ga0466713_124975 3300042602 Bacteria 10443
62 Ga0466713_140678 3300042602 Bacteria 25597
63 Ga0466713_147122 3300042602 Bacteria 45505
64 Ga0466722_170906 3300042609 Bacteria 6305
65 IMNBL1DRAFT_c0035898 3300000062 Bacteria 1740
66 IMNBL1DRAFT_c0045654 3300000062 Bacteria 1428
67 Ga0068305_10180290 3300005083 Unclassified 2944
68 Ga0466711_321414 3300042615 Bacteria 11390
69 Ga0466733_021167 3300042659 Bacteria 5191
70 Ga0466733_146938 3300042659 Bacteria 39655
71 Ga0123357_10009271 3300009784 Bacteria 12406
72 Ga0123357_10087305 3300009784 Bacteria 4080
73 Ga0123357_10190841 3300009784 Bacteria 2361
74 Ga0123354_10004244 3300010882 Bacteria 20226
75 Ga0466703_035538 3300042636 Bacteria 2867
76 Ga0466724_35649 3300042649 Bacteria 1381
77 Ga0466727_180334 3300042655 Unclassified 2418
78 Ga0466696_336751 3300042596 Bacteria 8396
79 Ga0466707_230234 3300042601 Bacteria 4323
80 Ga0466719_445879 3300042606 Bacteria 3449
81 Ga0466722_051611 3300042609 Bacteria 8465
82 Ga0466722_143739 3300042609 Bacteria 19742
83 2227414132 2225789004 Bacteria 26384
84 IMNBL1DRAFT_c0000548 3300000062 Bacteria 30522
85 IMNBL1DRAFT_c0002134 3300000062 Bacteria 14054
86 JGI24699J35502_11134132 3300002509 Bacteria 35055
87 Ga0072941_1154754 3300005201 Bacteria 2602
88 Ga0123357_10000677 3300009784 Bacteria 34044
89 Ga0466712_075774 3300042614 Bacteria 1975
90 Ga0466715_284356 3300042616 Bacteria 41147
91 Ga0466723_289044 3300042618 Bacteria 1277
92 Ga0123357_10013162 3300009784 Bacteria 10714
93 Ga0123357_10045827 3300009784 Bacteria 5930
94 Ga0123356_10191491 3300010049 Bacteria 2077
95 Ga0123354_10065656 3300010882 Bacteria 5309
96 Ga0466729_224585 3300042621 Bacteria 10662
97 Ga0466735_118413 3300042624 Bacteria 3915
98 Ga0466703_213712 3300042636 Bacteria 10909
99 Ga0466704_119350 3300042643 Bacteria 2203
100 Ga0466725_023513 3300042654 Bacteria 2707
101 Ga0466725_249119 3300042654 Bacteria 1644
102 Ga0466657_218051 3300042582 Unclassified 2090
103 Ga0466691_155369 3300042593 Bacteria 1713
104 Ga0466695_311053 3300042595 Bacteria 3625
105 Ga0466696_503091 3300042596 Bacteria 10551
106 Ga0466701_009359 3300042598 Bacteria 1152
107 Ga0466707_049770 3300042601 Bacteria 2757
108 Ga0466713_017181 3300042602 Bacteria 54753
109 Ga0466713_134391 3300042602 Bacteria 8283
110 Ga0466716_038510 3300042605 Bacteria 24976
111 Ga0466722_199911 3300042609 Bacteria 40153
112 Ga0466722_203823 3300042609 Bacteria 26562
113 2227605212 2225789004 Bacteria 2303
114 IMNBL1DRAFT_c0051696 3300000062 Bacteria 1292
115 Ga0466715_080854 3300042616 Bacteria 9552
116 Ga0466715_101945 3300042616 Bacteria 16309
117 Ga0466728_341739 3300042620 Bacteria 2399
118 Ga0466729_112451 3300042621 Bacteria 6720
119 Ga0466705_006217 3300042612 Bacteria 5367
120 Ga0466705_027776 3300042612 Bacteria 9671
121 Ga0562377_0004 3300056842 Bacteria 3525959
122 Ga0123357_10091241 3300009784 Bacteria 3969
123 Ga0123356_10002348 3300010049 Bacteria 20318
124 Ga0123354_10016515 3300010882 Unclassified 11572
125 Ga0123354_10099781 3300010882 Unclassified 3936
126 Ga0466729_230839 3300042621 Bacteria 12304
127 Ga0466735_099615 3300042624 Bacteria 2925
128 Ga0466735_184597 3300042624 Bacteria 3648
129 Ga0466727_245135 3300042655 Bacteria 3239
130 Ga0466727_348275 3300042655 Bacteria 1340
131 Ga0466690_206073 3300042590 Bacteria 23524
132 Ga0466692_012266 3300042591 Unclassified 2644
133 Ga0466707_047816 3300042601 Bacteria 12184
134 Ga0466707_074626 3300042601 Bacteria 11995
135 Ga0466707_109571 3300042601 Bacteria 2523
136 IMNBL1DRAFT_c0004858 3300000062 Bacteria 7907
137 JGI24699J35502_11133751 3300002509 Bacteria 14779
138 Ga0466715_279259 3300042616 Bacteria 15035
139 Ga0466728_311604 3300042620 Bacteria 10551
140 Ga0466729_166078 3300042621 Bacteria 3877
141 Ga0466733_022961 3300042659 Bacteria 5611
142 Ga0466733_217896 3300042659 Bacteria 5113
143 Ga0123357_10185727 3300009784 Bacteria 2412
144 Ga0123355_10035574 3300009826 Bacteria 8094
145 Ga0123354_10000857 3300010882 Bacteria 33765
146 Ga0123354_10103359 3300010882 Bacteria 3832
147 Ga0466735_016944 3300042624 Bacteria 4319
148 Ga0466735_205470 3300042624 Bacteria 2091
149 Ga0466725_404404 3300042654 Bacteria 15334
150 Ga0466657_298688 3300042582 Bacteria 2036
151 Ga0466693_011818 3300042592 Bacteria 3507
152 Ga0466691_159723 3300042593 Bacteria 21684
153 Ga0466701_098080 3300042598 Bacteria 65896
154 Ga0466700_051947 3300042600 Bacteria 66586
155 Ga0466700_395690 3300042600 Bacteria 2378
156 Ga0466700_481489 3300042600 Bacteria 3375
157 Ga0466713_077233 3300042602 Bacteria 28426
158 Ga0466713_087028 3300042602 Bacteria 4505
159 Ga0466713_097614 3300042602 Bacteria 86999
160 Ga0466713_131785 3300042602 Bacteria 7984
161 Ga0466713_135457 3300042602 Bacteria 3798
162 Ga0466719_476930 3300042606 Bacteria 5334
163 JGI24699J35502_11134214 3300002509 Bacteria 63548
164 Ga0123357_10087841 3300009784 Bacteria 4066
165 Ga0466703_066143 3300042636 Bacteria 23963
166 Ga0466724_38956 3300042649 Bacteria 4894
167 Ga0415639_172785 3300038395 Bacteria 1035
168 Ga0466707_418877 3300042601 Bacteria 8249
169 Ga0466719_025142 3300042606 Bacteria 7130
170 Ga0466722_031760 3300042609 Bacteria 2467
171 Ga0068305_10205189 3300005083 Bacteria 5331
172 Ga0123357_10000375 3300009784 Bacteria 42298
173 Ga0466723_147188 3300042618 Bacteria 2342

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042623 Ga0466734_077536 Ga0466734_077536_83_934 283
2 3300042600 Ga0466700_395690 Ga0466700_395690_33_917 294
3 3300042643 Ga0466704_556113 Ga0466704_556113_1172_2059 295
4 3300010049 Ga0123356_10002348 Ga0123356_1000234811 309
5 3300038395 Ga0415639_172785 Ga0415639_172785_30_983 317
6 3300042602 Ga0466713_124975 Ga0466713_124975_8027_8980 317
7 3300010167 Ga0123353_10784183 Ga0123353_107841831 318
8 3300042596 Ga0466696_155407 Ga0466696_155407_1465_2427 320
9 3300042601 Ga0466707_230234 Ga0466707_230234_1692_2654 320
10 3300042605 Ga0466716_495992 Ga0466716_495992_4361_5323 320
11 3300042615 Ga0466711_320200 Ga0466711_320200_2806_3768 320
12 3300042618 Ga0466723_360804 Ga0466723_360804_4977_5939 320
13 3300042624 Ga0466735_016944 Ga0466735_016944_2652_3614 320
14 3300009826 Ga0123355_10035574 Ga0123355_100355746 321
15 3300042582 Ga0466657_298688 Ga0466657_298688_813_1778 321
16 3300042591 Ga0466692_016441 Ga0466692_016441_101_1066 321
17 3300042595 Ga0466695_311053 Ga0466695_311053_57_1022 321
18 3300042596 Ga0466696_503091 Ga0466696_503091_1562_2527 321
19 3300042601 Ga0466707_049770 Ga0466707_049770_15_980 321
20 3300042601 Ga0466707_418877 Ga0466707_418877_5135_6100 321
21 3300042602 Ga0466713_017181 Ga0466713_017181_40770_41735 321
22 3300042602 Ga0466713_055139 Ga0466713_055139_11322_12287 321
23 3300042602 Ga0466713_077233 Ga0466713_077233_18882_19847 321
24 3300042602 Ga0466713_087028 Ga0466713_087028_2037_3002 321
25 3300042602 Ga0466713_097614 Ga0466713_097614_29969_30934 321
26 3300042602 Ga0466713_122827 Ga0466713_122827_86885_87850 321
27 3300042602 Ga0466713_131785 Ga0466713_131785_5749_6714 321
28 3300042602 Ga0466713_134391 Ga0466713_134391_810_1775 321
29 3300042609 Ga0466722_199911 Ga0466722_199911_15461_16426 321
30 3300042612 Ga0466705_006217 Ga0466705_006217_163_1128 321
31 3300042612 Ga0466705_422592 Ga0466705_422592_5089_6054 321
32 3300042615 Ga0466711_185820 Ga0466711_185820_87_1052 321
33 3300042615 Ga0466711_321414 Ga0466711_321414_5390_6355 321
34 3300042616 Ga0466715_080854 Ga0466715_080854_1526_2491 321
35 3300042621 Ga0466729_224585 Ga0466729_224585_3778_4743 321
36 3300042624 Ga0466735_205470 Ga0466735_205470_887_1852 321
37 3300042625 Ga0466730_078089 Ga0466730_078089_1495_2460 321
38 3300042636 Ga0466703_066143 Ga0466703_066143_21286_22251 321
39 3300042654 Ga0466725_249119 Ga0466725_249119_121_1086 321
40 3300042659 Ga0466733_022961 Ga0466733_022961_3500_4465 321
41 3300042659 Ga0466733_088004 Ga0466733_088004_16381_17346 321
42 3300042659 Ga0466733_146938 Ga0466733_146938_32159_33124 321
43 3300056842 Ga0562377_0004 Ga0562377_0004_2929529_2930494 321
44 iso_pr_bacteria 2695420314 2695473636 321
45 iso_pr_bacteria 2695420317 2695484328 321
46 iso_pr_bacteria 2695420931 2698110817 321
47 iso_pr_bacteria 2873600114 2873601468 321
48 iso_pr_bacteria 2873610414 2873611827 321
49 iso_pr_bacteria 2910926975 2910930122 321
50 iso_pr_bacteria 2910930387 2910932656 321
51 iso_pr_bacteria 2910942425 2910943477 321
52 iso_pr_bacteria 2910949487 2910952171 321
53 iso_pr_bacteria 2910959314 2910960487 321
54 iso_pr_bacteria 2940244548 2940248326 321
55 iso_pr_bacteria 2940248789 2940252501 321
56 iso_pr_bacteria 2940253009 2940256723 321
57 iso_pr_bacteria 2940257232 2940260816 321
58 iso_pr_bacteria 8100157865 8100159470 321
59 iso_pr_bacteria 8100166142 8100170745 321
60 3300000062 IMNBL1DRAFT_c0002295 IMNBL1DRAFT_000229510 322
61 3300000062 IMNBL1DRAFT_c0035898 IMNBL1DRAFT_00358982 322
62 3300000062 IMNBL1DRAFT_c0045654 IMNBL1DRAFT_00456542 322
63 3300002509 JGI24699J35502_11134132 JGI24699J35502_1113413210 322
64 3300005083 Ga0068305_10180290 Ga0068305_101802904 322
65 3300005083 Ga0068305_10205189 Ga0068305_102051892 322
66 3300042550 Ga0466656_090463 Ga0466656_090463_842_1810 322
67 3300042593 Ga0466691_155369 Ga0466691_155369_521_1489 322
68 3300042598 Ga0466701_098080 Ga0466701_098080_21077_22045 322
69 3300042602 Ga0466713_140678 Ga0466713_140678_11351_12334 322
70 3300042609 Ga0466722_170906 Ga0466722_170906_4739_5707 322
71 3300042611 Ga0466697_130443 Ga0466697_130443_29_997 322
72 3300042612 Ga0466705_027776 Ga0466705_027776_3340_4308 322
73 3300042614 Ga0466712_075774 Ga0466712_075774_716_1684 322
74 3300042618 Ga0466723_147188 Ga0466723_147188_1344_2312 322
75 3300042619 Ga0466726_105741 Ga0466726_105741_1073_2041 322
76 3300042619 Ga0466726_287830 Ga0466726_287830_498_1466 322
77 3300042636 Ga0466703_213712 Ga0466703_213712_2120_3088 322
78 3300042636 Ga0466703_262774 Ga0466703_262774_305_1273 322
79 3300042643 Ga0466704_119350 Ga0466704_119350_566_1534 322
80 3300042648 Ga0466709_106408 Ga0466709_106408_8858_9826 322
81 3300042655 Ga0466727_348275 Ga0466727_348275_43_1011 322
82 3300042659 Ga0466733_021167 Ga0466733_021167_1826_2794 322
83 3300042659 Ga0466733_217896 Ga0466733_217896_1544_2512 322
84 iso_pr_bacteria 2820757377 2820759451 322
85 iso_pr_bacteria 2820759988 2820760842 322
86 iso_pr_bacteria 2820778767 2820780597 322
87 iso_pr_bacteria 2940193328 2940194757 322
88 iso_pr_bacteria 2940336608 2940338034 322
89 3300002509 JGI24699J35502_11133751 JGI24699J35502_1113375111 323
90 3300002509 JGI24699J35502_11134214 JGI24699J35502_1113421459 323
91 3300009784 Ga0123357_10009271 Ga0123357_100092714 323
92 3300010882 Ga0123354_10103359 Ga0123354_101033593 323
93 3300042590 Ga0466690_314971 Ga0466690_314971_1741_2712 323
94 3300042591 Ga0466692_003792 Ga0466692_003792_4755_5726 323
95 3300042592 Ga0466693_011818 Ga0466693_011818_1246_2217 323
96 3300042593 Ga0466691_106009 Ga0466691_106009_539_1510 323
97 3300042594 Ga0466694_313292 Ga0466694_313292_196_1167 323
98 3300042596 Ga0466696_424899 Ga0466696_424899_569_1540 323
99 3300042598 Ga0466701_023932 Ga0466701_023932_1530_2501 323
100 3300042600 Ga0466700_293568 Ga0466700_293568_1997_2968 323
101 3300042600 Ga0466700_481489 Ga0466700_481489_998_1969 323
102 3300042601 Ga0466707_047816 Ga0466707_047816_4821_5792 323
103 3300042601 Ga0466707_109571 Ga0466707_109571_1149_2120 323
104 3300042601 Ga0466707_157817 Ga0466707_157817_2042_3013 323
105 3300042601 Ga0466707_165588 Ga0466707_165588_12292_13263 323
106 3300042602 Ga0466713_135457 Ga0466713_135457_1624_2595 323
107 3300042605 Ga0466716_038510 Ga0466716_038510_20005_20976 323
108 3300042606 Ga0466719_445879 Ga0466719_445879_1331_2302 323
109 3300042606 Ga0466719_558082 Ga0466719_558082_2295_3266 323
110 3300042609 Ga0466722_031760 Ga0466722_031760_204_1175 323
111 3300042609 Ga0466722_051611 Ga0466722_051611_3735_4706 323
112 3300042609 Ga0466722_203823 Ga0466722_203823_1472_2443 323
113 3300042612 Ga0466705_170456 Ga0466705_170456_29226_30197 323
114 3300042615 Ga0466711_031273 Ga0466711_031273_13254_14225 323
115 3300042616 Ga0466715_101945 Ga0466715_101945_12923_13894 323
116 3300042618 Ga0466723_141970 Ga0466723_141970_2333_3304 323
117 3300042618 Ga0466723_289044 Ga0466723_289044_66_1037 323
118 3300042620 Ga0466728_311604 Ga0466728_311604_6647_7618 323
119 3300042620 Ga0466728_341739 Ga0466728_341739_234_1205 323
120 3300042621 Ga0466729_166078 Ga0466729_166078_869_1840 323
121 3300042621 Ga0466729_230839 Ga0466729_230839_9831_10802 323
122 3300042624 Ga0466735_088535 Ga0466735_088535_1395_2366 323
123 3300042624 Ga0466735_118413 Ga0466735_118413_1298_2269 323
124 3300042636 Ga0466703_342328 Ga0466703_342328_97_1068 323
125 3300042643 Ga0466704_433787 Ga0466704_433787_2449_3420 323
126 3300042643 Ga0466704_488602 Ga0466704_488602_14192_15163 323
127 3300042654 Ga0466725_130397 Ga0466725_130397_5602_6573 323
128 3300042655 Ga0466727_008762 Ga0466727_008762_1944_2915 323
129 3300042655 Ga0466727_180334 Ga0466727_180334_275_1246 323
130 3300042655 Ga0466727_245135 Ga0466727_245135_806_1777 323
131 iso_pr_bacteria 2820762746 2820765035 323
132 2225789004 2227414132 2227856014 324
133 2225789004 2227605212 2228173788 324
134 3300000062 IMNBL1DRAFT_c0051696 IMNBL1DRAFT_00516962 324
135 3300002462 JGI24702J35022_10218607 JGI24702J35022_102186071 324
136 3300002509 JGI24699J35502_11134213 JGI24699J35502_1113421346 324
137 3300005201 Ga0072941_1154754 Ga0072941_11547543 324
138 3300009784 Ga0123357_10000375 Ga0123357_1000037524 324
139 3300009784 Ga0123357_10010444 Ga0123357_100104446 324
140 3300009784 Ga0123357_10013162 Ga0123357_100131627 324
141 3300009784 Ga0123357_10045827 Ga0123357_100458273 324
142 3300009784 Ga0123357_10087841 Ga0123357_100878412 324
143 3300009784 Ga0123357_10091241 Ga0123357_100912412 324
144 3300009784 Ga0123357_10185727 Ga0123357_101857272 324
145 3300009784 Ga0123357_10195927 Ga0123357_101959272 324
146 3300010167 Ga0123353_10220107 Ga0123353_102201072 324
147 3300010882 Ga0123354_10001124 Ga0123354_1000112414 324
148 3300010882 Ga0123354_10004244 Ga0123354_100042448 324
149 3300010882 Ga0123354_10016515 Ga0123354_100165157 324
150 3300010882 Ga0123354_10032063 Ga0123354_100320636 324
151 3300010882 Ga0123354_10064008 Ga0123354_100640082 324
152 3300010882 Ga0123354_10065656 Ga0123354_100656562 324
153 3300010882 Ga0123354_10099781 Ga0123354_100997811 324
154 3300042590 Ga0466690_318861 Ga0466690_318861_1679_2653 324
155 3300042591 Ga0466692_012266 Ga0466692_012266_633_1607 324
156 3300042593 Ga0466691_159723 Ga0466691_159723_6719_7693 324
157 3300042601 Ga0466707_074626 Ga0466707_074626_4542_5516 324
158 3300042606 Ga0466719_025142 Ga0466719_025142_894_1868 324
159 3300042606 Ga0466719_476930 Ga0466719_476930_4094_5068 324
160 3300042616 Ga0466715_017060 Ga0466715_017060_5178_6152 324
161 3300042616 Ga0466715_284356 Ga0466715_284356_11606_12580 324
162 3300042619 Ga0466726_238359 Ga0466726_238359_1916_2890 324
163 3300042621 Ga0466729_112451 Ga0466729_112451_4038_5012 324
164 3300042624 Ga0466735_184597 Ga0466735_184597_2658_3632 324
165 3300042655 Ga0466727_081347 Ga0466727_081347_55931_56905 324
166 3300000062 IMNBL1DRAFT_c0002134 IMNBL1DRAFT_000213410 325
167 3300002462 JGI24702J35022_10028586 JGI24702J35022_100285864 325
168 3300009784 Ga0123357_10190841 Ga0123357_101908412 325
169 3300042590 Ga0466690_206073 Ga0466690_206073_12061_13038 325
170 3300042591 Ga0466692_189168 Ga0466692_189168_8064_9041 325
171 3300042596 Ga0466696_139714 Ga0466696_139714_3742_4719 325
172 3300042596 Ga0466696_244582 Ga0466696_244582_9696_10673 325
173 3300042600 Ga0466700_051947 Ga0466700_051947_54658_55635 325
174 3300042605 Ga0466716_225095 Ga0466716_225095_4146_5123 325
175 3300042624 Ga0466735_099615 Ga0466735_099615_833_1810 325
176 iso_pr_bacteria 2940216256 2940217882 325
177 iso_pr_bacteria 2967483437 2967486873 325
178 3300000062 IMNBL1DRAFT_c0000548 IMNBL1DRAFT_000054826 326
179 3300000062 IMNBL1DRAFT_c0004858 IMNBL1DRAFT_00048586 326
180 3300009784 Ga0123357_10000677 Ga0123357_1000067718 326
181 3300042582 Ga0466657_218051 Ga0466657_218051_909_1889 326
182 3300042596 Ga0466696_336751 Ga0466696_336751_5477_6457 326
183 3300042598 Ga0466701_009359 Ga0466701_009359_57_1037 326
184 3300042602 Ga0466713_147122 Ga0466713_147122_19436_20416 326
185 3300042611 Ga0466697_274917 Ga0466697_274917_130265_131245 326
186 3300042636 Ga0466703_046039 Ga0466703_046039_2269_3249 326
187 3300042649 Ga0466724_35649 Ga0466724_35649_362_1342 326
188 3300042649 Ga0466724_38956 Ga0466724_38956_718_1698 326
189 3300042654 Ga0466725_023513 Ga0466725_023513_229_1209 326
190 3300042654 Ga0466725_404404 Ga0466725_404404_609_1589 326
191 3300009784 Ga0123357_10002521 Ga0123357_100025214 327
192 3300009784 Ga0123357_10087305 Ga0123357_100873053 327
193 3300010049 Ga0123356_10191491 Ga0123356_101914912 327
194 3300010882 Ga0123354_10000857 Ga0123354_100008575 327
195 3300042616 Ga0466715_279259 Ga0466715_279259_3033_4016 327
196 3300042609 Ga0466722_143739 Ga0466722_143739_18023_19012 329
197 3300042636 Ga0466703_035538 Ga0466703_035538_755_1804 349

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 239 335 0.97
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 51 236 0.94
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 51 179 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.