Protein Family IF09100

Metagenome Isolate
148 Members
43 Samples
147 Scaffolds
283.43 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_033077|Ga0466703_033077_3694_4695
Length
303 aa
Sequence
VSAAAGGAGKRNFGPLYSVPMAVWFTVFFIVPLLIIILYSFLKKELYGGVAPEFSLTAYRSLGNPSLIIIIIRTTIFIALPCGYFMAKSKHQTFLLLIIIIPFWTNFLIRVFAWMNILGNNGFLNELLIRLGLLVKDIYLQKVVILILVYMYLPYAILPLYATIDKFDFSLLEAARDLGATKPQSMLKVLLPNIRSGMYTAVLFTFIPIFGAYAVPLLVGGKDSYMLGNVIADQLTKSRNWPLASAISLVLTLVTTAGVLLIMGLQKRDAVRFQGVRGREAGLSAEAGVPTEGPPAAAGGDAP

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.5%
Kalotermitidae 32.6%
Rhinotermitidae 9.3%
Unclassified 7.0%
Termopsidae 7.0%
Blaberidae 2.3%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
2 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
3 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
4 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
5 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
6 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
7 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
8 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
9 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
10 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2772190975 Treponema sp. RmG30 Isolate Blaberidae
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_194744 3300042656 Bacteria 3870
2 Ga0466712_116775 3300042614 Bacteria 1379
3 Ga0466711_077159 3300042615 Bacteria 12050
4 Ga0466715_356099 3300042616 Bacteria 5314
5 Ga0466723_171803 3300042618 Bacteria 59143
6 Ga0466729_028346 3300042621 Bacteria 2348
7 JGI24698J34947_10006792 3300002449 Bacteria 6287
8 JGI24698J34947_10051047 3300002449 Bacteria 2082
9 JGI24695J34938_10007312 3300002450 Bacteria 6494
10 Ga0466735_106933 3300042624 Bacteria 10772
11 Ga0466708_068609 3300042652 Bacteria 43792
12 Ga0466708_115320 3300042652 Unclassified 6335
13 Ga0466727_275352 3300042655 Bacteria 1210
14 Ga0466716_121392 3300042605 Bacteria 28760
15 Ga0466716_243278 3300042605 Bacteria 3305
16 Ga0466720_024816 3300042607 Bacteria 3005
17 Ga0466720_072771 3300042607 Bacteria 5958
18 Ga0466690_012365 3300042590 Bacteria 4825
19 Ga0466690_231509 3300042590 Bacteria 1034
20 Ga0466690_243966 3300042590 Bacteria 7676
21 Ga0466692_022165 3300042591 Bacteria 15406
22 Ga0466696_162358 3300042596 Bacteria 7687
23 Ga0466712_049935 3300042614 Bacteria 22184
24 Ga0466712_293740 3300042614 Bacteria 9154
25 Ga0466718_029713 3300042617 Bacteria 7485
26 Ga0466718_119621 3300042617 Bacteria 6644
27 Ga0466726_178903 3300042619 Bacteria 4671
28 Ga0466726_264727 3300042619 Bacteria 1574
29 Ga0466728_204649 3300042620 Bacteria 6076
30 Ga0466729_143311 3300042621 Bacteria 1926
31 JGI24698J34947_10021997 3300002449 Bacteria 3424
32 JGI24697J35500_11266914 3300002507 Bacteria 3579
33 Ga0466704_143077 3300042643 Bacteria 3839
34 Ga0466709_223647 3300042648 Unclassified 2176
35 Ga0466709_279548 3300042648 Bacteria 7052
36 Ga0466708_072666 3300042652 Bacteria 3019
37 Ga0466706_184489 3300042599 Bacteria 2243
38 Ga0466707_015438 3300042601 Bacteria 8129
39 Ga0466713_121338 3300042602 Bacteria 3624
40 Ga0466722_071213 3300042609 Bacteria 5778
41 Ga0456237_0017137 3300041968 Bacteria 1018
42 Ga0466694_058135 3300042594 Bacteria 8662
43 Ga0466696_321893 3300042596 Bacteria 2848
44 Ga0466712_231195 3300042614 Bacteria 9467
45 Ga0466711_455697 3300042615 Bacteria 1897
46 Ga0466715_106859 3300042616 Unclassified 2103
47 Ga0466718_025688 3300042617 Bacteria 8125
48 Ga0466726_113339 3300042619 Bacteria 3400
49 Ga0466726_330522 3300042619 Bacteria 1048
50 Ga0466728_450843 3300042620 Bacteria 2773
51 Ga0466735_067058 3300042624 Bacteria 1276
52 Ga0466703_053792 3300042636 Bacteria 16450
53 Ga0466704_193218 3300042643 Bacteria 13736
54 Ga0466704_267900 3300042643 Bacteria 17460
55 Ga0466722_009738 3300042609 Bacteria 1911
56 Ga0466722_019174 3300042609 Bacteria 4253
57 Ga0123356_10001100 3300010049 Bacteria 29997
58 Ga0466690_047737 3300042590 Bacteria 13983
59 Ga0466691_086166 3300042593 Bacteria 11074
60 Ga0466712_039575 3300042614 Bacteria 16606
61 Ga0466712_134996 3300042614 Bacteria 9831
62 Ga0466711_196196 3300042615 Bacteria 12597
63 Ga0466718_039024 3300042617 Bacteria 2173
64 Ga0466723_266624 3300042618 Bacteria 6530
65 Ga0466729_162098 3300042621 Bacteria 1599
66 JGI24698J34947_10025429 3300002449 Bacteria 3151
67 JGI24695J34938_10004976 3300002450 Bacteria 8480
68 Ga0466716_391534 3300042605 Unclassified 5433
69 Ga0466720_093334 3300042607 Bacteria 20053
70 Ga0123357_10322828 3300009784 Bacteria 1522
71 Ga0123353_10276947 3300010167 Bacteria 2580
72 Ga0466690_004411 3300042590 Bacteria 3233
73 Ga0466692_122700 3300042591 Bacteria 4634
74 Ga0466691_136918 3300042593 Bacteria 5850
75 Ga0466696_160723 3300042596 Bacteria 2029
76 Ga0466705_210210 3300042612 Bacteria 14341
77 Ga0466705_216646 3300042612 Bacteria 5124
78 Ga0466705_514040 3300042612 Bacteria 10928
79 Ga0466712_003620 3300042614 Bacteria 7469
80 Ga0466711_410348 3300042615 Bacteria 14838
81 Ga0466715_416724 3300042616 Bacteria 6552
82 Ga0466718_057307 3300042617 Bacteria 2872
83 Ga0466723_026644 3300042618 Bacteria 4981
84 Ga0466728_054193 3300042620 Bacteria 11218
85 JGI24698J34947_10001518 3300002449 Bacteria 12273
86 Ga0466709_025162 3300042648 Bacteria 5757
87 Ga0466708_044868 3300042652 Bacteria 5271
88 Ga0466719_063526 3300042606 Bacteria 8651
89 Ga0466719_124282 3300042606 Bacteria 55942
90 Ga0466720_057115 3300042607 Bacteria 2547
91 Ga0466690_097572 3300042590 Bacteria 5423
92 Ga0466691_162775 3300042593 Bacteria 4338
93 Ga0466696_083391 3300042596 Bacteria 3652
94 Ga0466711_167327 3300042615 Bacteria 4991
95 Ga0072940_1107923 3300005200 Bacteria 2397
96 Ga0466702_376116 3300042635 Bacteria 12364
97 Ga0466703_033077 3300042636 Bacteria 6958
98 Ga0466703_046826 3300042636 Bacteria 17052
99 Ga0466703_248567 3300042636 Bacteria 8923
100 Ga0466703_282424 3300042636 Bacteria 1603
101 Ga0466704_214375 3300042643 Bacteria 11779
102 Ga0466708_045381 3300042652 Bacteria 24821
103 Ga0466708_205489 3300042652 Bacteria 10696
104 Ga0466727_177471 3300042655 Bacteria 1748
105 Ga0466706_147172 3300042599 Bacteria 1576
106 Ga0123353_10338387 3300010167 Bacteria 2274
107 Ga0415639_105757 3300038395 Bacteria 5178
108 Ga0415639_208665 3300038395 Bacteria 1703
109 Ga0466690_206407 3300042590 Bacteria 1003
110 Ga0466696_204726 3300042596 Bacteria 35245
111 Ga0466699_024350 3300042597 Bacteria 3435
112 Ga0466712_001544 3300042614 Bacteria 23939
113 Ga0466715_012720 3300042616 Bacteria 11389
114 Ga0466715_530626 3300042616 Bacteria 2061
115 Ga0466718_100564 3300042617 Bacteria 4057
116 Ga0466726_156561 3300042619 Bacteria 1839
117 AustNasuHG_c1001315 3300000089 Bacteria 8913
118 JGI24698J34947_10035908 3300002449 Bacteria 2583
119 Ga0466735_146974 3300042624 Bacteria 11565
120 Ga0466703_259866 3300042636 Bacteria 18284
121 Ga0466716_366491 3300042605 Bacteria 2296
122 Ga0466719_036412 3300042606 Bacteria 2607
123 Ga0466720_000159 3300042607 Bacteria 3656
124 Ga0466720_031498 3300042607 Bacteria 3259
125 Ga0466720_061132 3300042607 Bacteria 4410
126 Ga0123356_10712873 3300010049 Bacteria 1173
127 Ga0466691_117863 3300042593 Bacteria 11001
128 Ga0466705_052827 3300042612 Bacteria 1993
129 Ga0466705_090032 3300042612 Bacteria 6876
130 Ga0466712_053304 3300042614 Bacteria 13915
131 Ga0466712_279165 3300042614 Unclassified 2795
132 Ga0466715_045566 3300042616 Bacteria 2932
133 Ga0466715_250144 3300042616 Bacteria 8670
134 Ga0466723_046140 3300042618 Bacteria 5976
135 Ga0466729_125549 3300042621 Bacteria 1696
136 JGI24698J34947_10001186 3300002449 Bacteria 13605
137 JGI24698J34947_10008794 3300002449 Bacteria 5538
138 JGI24698J34947_10025390 3300002449 Bacteria 3154
139 JGI24698J34947_10034826 3300002449 Bacteria 2632
140 Ga0068305_10033882 3300005083 Bacteria 2719
141 Ga0466703_144259 3300042636 Bacteria 4333
142 Ga0466703_209417 3300042636 Bacteria 3738
143 Ga0466704_361047 3300042643 Bacteria 54186
144 Ga0123355_10332043 3300009826 Bacteria 2036
145 Ga0466690_070367 3300042590 Bacteria 3493
146 Ga0466692_190792 3300042591 Bacteria 17695
147 Ga0466691_104861 3300042593 Bacteria 10770

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10276947 Ga0123353_102769472 267
2 3300042590 Ga0466690_012365 Ga0466690_012365_2546_3367 267
3 3300042593 Ga0466691_104861 Ga0466691_104861_1949_2770 267
4 3300042607 Ga0466720_072771 Ga0466720_072771_3929_4771 267
5 3300042621 Ga0466729_143311 Ga0466729_143311_334_1242 267
6 3300042590 Ga0466690_206407 Ga0466690_206407_116_940 268
7 3300042593 Ga0466691_162775 Ga0466691_162775_912_1736 268
8 3300042596 Ga0466696_162358 Ga0466696_162358_5658_6482 268
9 3300042607 Ga0466720_057115 Ga0466720_057115_129_971 268
10 3300042615 Ga0466711_455697 Ga0466711_455697_283_1134 268
11 3300042616 Ga0466715_012720 Ga0466715_012720_8957_9781 268
12 3300042636 Ga0466703_144259 Ga0466703_144259_2919_3767 268
13 3300042652 Ga0466708_072666 Ga0466708_072666_905_1729 268
14 3300042618 Ga0466723_046140 Ga0466723_046140_3290_4132 269
15 3300042636 Ga0466703_259866 Ga0466703_259866_15976_16845 269
16 3300042643 Ga0466704_143077 Ga0466704_143077_1458_2291 269
17 3300042648 Ga0466709_279548 Ga0466709_279548_2059_2883 269
18 3300009784 Ga0123357_10322828 Ga0123357_103228282 270
19 3300042620 Ga0466728_054193 Ga0466728_054193_8137_8985 270
20 3300042599 Ga0466706_184489 Ga0466706_184489_151_966 271
21 3300042609 Ga0466722_071213 Ga0466722_071213_2363_3211 271
22 3300042636 Ga0466703_209417 Ga0466703_209417_2558_3400 271
23 3300002507 JGI24697J35500_11266914 JGI24697J35500_112669142 272
24 3300005083 Ga0068305_10033882 Ga0068305_100338823 272
25 3300042609 Ga0466722_019174 Ga0466722_019174_2371_3273 272
26 3300042618 Ga0466723_171803 Ga0466723_171803_40293_41162 272
27 3300042636 Ga0466703_053792 Ga0466703_053792_2186_3019 272
28 3300042643 Ga0466704_361047 Ga0466704_361047_51820_52689 272
29 3300042656 Ga0466732_194744 Ga0466732_194744_2531_3373 272
30 3300009826 Ga0123355_10332043 Ga0123355_103320432 273
31 3300042615 Ga0466711_167327 Ga0466711_167327_1521_2417 273
32 3300042617 Ga0466718_039024 Ga0466718_039024_174_1025 273
33 3300042618 Ga0466723_266624 Ga0466723_266624_3318_4139 273
34 3300042590 Ga0466690_097572 Ga0466690_097572_1603_2427 274
35 3300042596 Ga0466696_160723 Ga0466696_160723_1089_1913 274
36 3300042606 Ga0466719_036412 Ga0466719_036412_290_1114 274
37 3300042619 Ga0466726_330522 Ga0466726_330522_117_941 274
38 3300042652 Ga0466708_115320 Ga0466708_115320_2842_3666 274
39 3300042596 Ga0466696_083391 Ga0466696_083391_1516_2385 275
40 3300042597 Ga0466699_024350 Ga0466699_024350_1372_2286 275
41 3300042605 Ga0466716_391534 Ga0466716_391534_782_1609 275
42 3300042606 Ga0466719_063526 Ga0466719_063526_5269_6096 275
43 3300042606 Ga0466719_124282 Ga0466719_124282_45425_46363 275
44 3300042607 Ga0466720_024816 Ga0466720_024816_815_1657 275
45 3300042612 Ga0466705_210210 Ga0466705_210210_3458_4345 275
46 3300042612 Ga0466705_514040 Ga0466705_514040_9470_10339 275
47 3300042615 Ga0466711_077159 Ga0466711_077159_2540_3400 275
48 3300042616 Ga0466715_106859 Ga0466715_106859_19_846 275
49 3300042616 Ga0466715_416724 Ga0466715_416724_2899_3759 275
50 3300042636 Ga0466703_046826 Ga0466703_046826_11572_12417 275
51 3300042648 Ga0466709_223647 Ga0466709_223647_949_1776 275
52 3300042652 Ga0466708_044868 Ga0466708_044868_1070_1897 275
53 3300042652 Ga0466708_045381 Ga0466708_045381_22650_23477 275
54 3300042652 Ga0466708_205489 Ga0466708_205489_5377_6204 275
55 3300042596 Ga0466696_204726 Ga0466696_204726_11097_11927 276
56 3300042612 Ga0466705_090032 Ga0466705_090032_3764_4639 276
57 3300042619 Ga0466726_156561 Ga0466726_156561_337_1185 276
58 3300000089 AustNasuHG_c1001315 AustNasuHG_10013158 277
59 3300042593 Ga0466691_136918 Ga0466691_136918_4101_4970 277
60 3300042605 Ga0466716_121392 Ga0466716_121392_14539_15372 277
61 3300042621 Ga0466729_028346 Ga0466729_028346_226_1122 277
62 3300042624 Ga0466735_067058 Ga0466735_067058_220_1122 277
63 3300042624 Ga0466735_146974 Ga0466735_146974_10230_11063 277
64 3300038395 Ga0415639_208665 Ga0415639_208665_330_1166 278
65 3300042616 Ga0466715_250144 Ga0466715_250144_3385_4221 278
66 3300042655 Ga0466727_177471 Ga0466727_177471_590_1459 278
67 3300042619 Ga0466726_178903 Ga0466726_178903_2454_3347 279
68 3300042624 Ga0466735_106933 Ga0466735_106933_7538_8377 279
69 3300002449 JGI24698J34947_10008794 JGI24698J34947_100087944 280
70 3300042614 Ga0466712_001544 Ga0466712_001544_8260_9102 280
71 3300010049 Ga0123356_10001100 Ga0123356_1000110017 281
72 3300042614 Ga0466712_053304 Ga0466712_053304_9243_10088 281
73 3300002449 JGI24698J34947_10025429 JGI24698J34947_100254293 282
74 3300042590 Ga0466690_243966 Ga0466690_243966_4007_4855 282
75 3300042593 Ga0466691_086166 Ga0466691_086166_2511_3374 282
76 3300042607 Ga0466720_000159 Ga0466720_000159_1122_2012 282
77 3300042616 Ga0466715_045566 Ga0466715_045566_477_1409 282
78 3300042618 Ga0466723_026644 Ga0466723_026644_2361_3209 282
79 3300038395 Ga0415639_105757 Ga0415639_105757_684_1559 283
80 3300042614 Ga0466712_003620 Ga0466712_003620_5316_6221 283
81 3300042619 Ga0466726_264727 Ga0466726_264727_488_1369 283
82 3300042620 Ga0466728_450843 Ga0466728_450843_757_1626 283
83 3300042648 Ga0466709_025162 Ga0466709_025162_2308_3192 283
84 3300042591 Ga0466692_122700 Ga0466692_122700_734_1588 284
85 3300042591 Ga0466692_190792 Ga0466692_190792_5255_6109 284
86 3300042612 Ga0466705_052827 Ga0466705_052827_373_1248 284
87 3300042614 Ga0466712_231195 Ga0466712_231195_1506_2402 284
88 3300042621 Ga0466729_125549 Ga0466729_125549_283_1170 284
89 3300042590 Ga0466690_004411 Ga0466690_004411_166_1041 285
90 3300042607 Ga0466720_093334 Ga0466720_093334_557_1435 285
91 3300042609 Ga0466722_009738 Ga0466722_009738_669_1544 285
92 3300042615 Ga0466711_410348 Ga0466711_410348_5325_6182 285
93 3300042635 Ga0466702_376116 Ga0466702_376116_1294_2178 285
94 3300042590 Ga0466690_231509 Ga0466690_231509_129_989 286
95 3300042605 Ga0466716_366491 Ga0466716_366491_81_941 286
96 3300042607 Ga0466720_061132 Ga0466720_061132_3428_4324 286
97 3300042614 Ga0466712_293740 Ga0466712_293740_3418_4302 286
98 3300042643 Ga0466704_214375 Ga0466704_214375_692_1588 286
99 3300042643 Ga0466704_267900 Ga0466704_267900_6555_7460 287
100 3300042614 Ga0466712_116775 Ga0466712_116775_314_1180 288
101 3300042614 Ga0466712_279165 Ga0466712_279165_1813_2739 288
102 3300042620 Ga0466728_204649 Ga0466728_204649_1170_2036 288
103 3300042643 Ga0466704_193218 Ga0466704_193218_10908_11816 288
104 3300042591 Ga0466692_022165 Ga0466692_022165_8970_9839 289
105 3300042614 Ga0466712_134996 Ga0466712_134996_3635_4540 289
106 3300042615 Ga0466711_196196 Ga0466711_196196_2642_3529 289
107 3300042617 Ga0466718_025688 Ga0466718_025688_3220_4122 289
108 3300042636 Ga0466703_248567 Ga0466703_248567_7191_8060 289
109 3300002449 JGI24698J34947_10006792 JGI24698J34947_1000679210 290
110 3300002450 JGI24695J34938_10004976 JGI24695J34938_100049762 290
111 3300002450 JGI24695J34938_10007312 JGI24695J34938_100073123 290
112 3300042590 Ga0466690_070367 Ga0466690_070367_1810_2715 290
113 3300042616 Ga0466715_530626 Ga0466715_530626_143_1015 290
114 3300042617 Ga0466718_029713 Ga0466718_029713_2527_3429 290
115 3300042655 Ga0466727_275352 Ga0466727_275352_221_1093 290
116 3300042607 Ga0466720_031498 Ga0466720_031498_702_1619 291
117 3300042619 Ga0466726_113339 Ga0466726_113339_294_1169 291
118 3300042596 Ga0466696_321893 Ga0466696_321893_1518_2396 292
119 3300042605 Ga0466716_243278 Ga0466716_243278_2070_2984 292
120 3300010167 Ga0123353_10338387 Ga0123353_103383872 295
121 3300042590 Ga0466690_047737 Ga0466690_047737_2685_3587 295
122 3300002449 JGI24698J34947_10034826 JGI24698J34947_100348262 296
123 3300005200 Ga0072940_1107923 Ga0072940_11079232 297
124 3300042612 Ga0466705_216646 Ga0466705_216646_2200_3093 297
125 3300042617 Ga0466718_057307 Ga0466718_057307_1933_2826 297
126 3300042636 Ga0466703_282424 Ga0466703_282424_222_1133 297
127 3300002449 JGI24698J34947_10001518 JGI24698J34947_100015182 299
128 3300042594 Ga0466694_058135 Ga0466694_058135_6945_7844 299
129 3300042617 Ga0466718_100564 Ga0466718_100564_2098_3015 299
130 3300042617 Ga0466718_119621 Ga0466718_119621_2241_3203 300
131 3300002449 JGI24698J34947_10021997 JGI24698J34947_100219972 301
132 3300002449 JGI24698J34947_10051047 JGI24698J34947_100510472 301
133 3300042601 Ga0466707_015438 Ga0466707_015438_3769_4713 301
134 3300002449 JGI24698J34947_10001186 JGI24698J34947_100011866 302
135 3300042593 Ga0466691_117863 Ga0466691_117863_3999_4907 302
136 3300042602 Ga0466713_121338 Ga0466713_121338_1616_2548 302
137 3300042614 Ga0466712_049935 Ga0466712_049935_631_1542 303
138 3300042636 Ga0466703_033077 Ga0466703_033077_3694_4695 303
139 3300042652 Ga0466708_068609 Ga0466708_068609_37090_38025 305
140 3300042621 Ga0466729_162098 Ga0466729_162098_503_1423 306
141 3300010049 Ga0123356_10712873 Ga0123356_107128731 307
142 3300042599 Ga0466706_147172 Ga0466706_147172_43_1008 307
143 3300002449 JGI24698J34947_10025390 JGI24698J34947_100253903 308
144 3300042614 Ga0466712_039575 Ga0466712_039575_6006_6935 309
145 3300002449 JGI24698J34947_10035908 JGI24698J34947_100359082 310
146 3300041968 Ga0456237_0017137 Ga0456237_0017137_48_989 313
147 iso_pr_bacteria 2772190975 2773721717 323
148 3300042616 Ga0466715_356099 Ga0466715_356099_2709_3746 333

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 80 267 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.57 0.67 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.