Protein Family IF09098

Metagenome Isolate
137 Members
37 Samples
136 Scaffolds
189.09 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_032543|Ga0466703_032543_2725_3357
Length
210 aa
Sequence
MITAANGESVGESPGDDRLIIDQIVSGRKELFRILVQRYEQAVYGMGLSFFRNPEDAADFAQEVFLKSFRSLGGFQGRSRFSTWLYRIAYNTAVNSIRRQKDYRSLAGEGEPNCTGTGSDRPCSAGEGPDGETPERLLLRAVVTEAVREAMKDLPDRYRICVDLFFFYDRSYQEIEVITGYPVNTIKSHVFRAKKLLREKLEGIVEGGIE

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 38.9%
Termitidae 33.3%
Rhinotermitidae 11.1%
Unclassified 11.1%
Termopsidae 5.6%

🌳 Taxonomy

Archaea 3
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10445273 3300010882 Bacteria 1054
2 Ga0466733_140235 3300042659 Bacteria 3198
3 JGI24702J35022_10048495 3300002462 Bacteria 2261
4 Ga0466723_165141 3300042618 Bacteria 11652
5 Ga0466728_220948 3300042620 Bacteria 1128
6 Ga0466690_038007 3300042590 Bacteria 8234
7 Ga0466691_004939 3300042593 Bacteria 14753
8 Ga0466691_107178 3300042593 Archaea 3537
9 Ga0466716_071678 3300042605 Bacteria 3399
10 Ga0466722_013559 3300042609 Bacteria 8177
11 Ga0466704_594303 3300042643 Bacteria 1825
12 Ga0466708_222084 3300042652 Bacteria 10624
13 Ga0466705_001314 3300042612 Bacteria 2745
14 Ga0466711_290877 3300042615 Bacteria 3263
15 Ga0466715_084854 3300042616 Bacteria 9684
16 Ga0466723_066824 3300042618 Bacteria 21336
17 Ga0466723_077553 3300042618 Bacteria 2174
18 Ga0466726_339261 3300042619 Bacteria 1277
19 Ga0466696_078034 3300042596 Bacteria 6320
20 Ga0466713_014911 3300042602 Bacteria 1745
21 Ga0466716_466340 3300042605 Bacteria 5165
22 Ga0466716_520083 3300042605 Bacteria 2048
23 Ga0466719_264055 3300042606 Bacteria 3344
24 Ga0466720_160936 3300042607 Bacteria 1165
25 Ga0466722_036236 3300042609 Bacteria 1765
26 Ga0466722_097367 3300042609 Bacteria 7864
27 Ga0466703_258399 3300042636 Bacteria 6164
28 Ga0466704_258537 3300042643 Unclassified 3196
29 Ga0466708_171620 3300042652 Bacteria 4411
30 Ga0123357_10003698 3300009784 Bacteria 17661
31 Ga0466705_280586 3300042612 Bacteria 2465
32 Ga0466712_085121 3300042614 Bacteria 27516
33 Ga0466715_051723 3300042616 Bacteria 23274
34 Ga0466723_102548 3300042618 Bacteria 7793
35 Ga0466690_065689 3300042590 Bacteria 1875
36 Ga0466691_174194 3300042593 Bacteria 17912
37 Ga0466707_022255 3300042601 Bacteria 1180
38 Ga0466713_116845 3300042602 Bacteria 2055
39 Ga0466719_042673 3300042606 Bacteria 1138
40 Ga0466719_338449 3300042606 Bacteria 1671
41 Ga0466704_087352 3300042643 Bacteria 10850
42 Ga0466708_109507 3300042652 Bacteria 14545
43 Ga0123353_10652944 3300010167 Bacteria 1489
44 Ga0466705_234875 3300042612 Bacteria 2412
45 Ga0466715_503963 3300042616 Bacteria 1027
46 Ga0466723_030088 3300042618 Bacteria 17138
47 Ga0466726_023985 3300042619 Bacteria 3841
48 Ga0466728_381486 3300042620 Bacteria 3418
49 Ga0264413_131816 3300024493 Unclassified 4053
50 Ga0466707_149534 3300042601 Bacteria 10899
51 Ga0466707_194458 3300042601 Bacteria 3490
52 Ga0466713_057438 3300042602 Bacteria 3695
53 Ga0466703_321449 3300042636 Bacteria 8517
54 Ga0466704_101955 3300042643 Bacteria 19185
55 Ga0466708_054774 3300042652 Bacteria 1460
56 Ga0466708_061104 3300042652 Bacteria 4085
57 Ga0466727_317334 3300042655 Bacteria 1111
58 Ga0466727_340976 3300042655 Bacteria 3672
59 AustNasuHG_c1021888 3300000089 Bacteria 2062
60 JGI24702J35022_10032219 3300002462 Bacteria 2807
61 JGI24702J35022_10148264 3300002462 Bacteria 1314
62 Ga0068305_10103761 3300005083 Bacteria 2321
63 Ga0466705_151234 3300042612 Bacteria 11067
64 Ga0466711_239123 3300042615 Bacteria 43474
65 Ga0466726_412698 3300042619 Bacteria 1494
66 Ga0466728_021526 3300042620 Bacteria 1994
67 Ga0466728_086606 3300042620 Bacteria 5310
68 Ga0466690_335828 3300042590 Bacteria 1711
69 Ga0466696_112558 3300042596 Bacteria 9851
70 Ga0466696_217530 3300042596 Bacteria 3174
71 Ga0466698_298763 3300042610 Bacteria 1092
72 Ga0466703_421496 3300042636 Bacteria 1698
73 Ga0466704_333543 3300042643 Unclassified 5169
74 Ga0466704_407088 3300042643 Bacteria 4385
75 Ga0466705_294788 3300042612 Bacteria 2700
76 Ga0466715_065034 3300042616 Bacteria 3956
77 Ga0466723_082414 3300042618 Bacteria 1317
78 Ga0466723_099185 3300042618 Bacteria 2393
79 Ga0466723_131066 3300042618 Bacteria 51139
80 Ga0466723_312728 3300042618 Bacteria 7559
81 Ga0466723_372204 3300042618 Bacteria 4177
82 Ga0466728_019113 3300042620 Bacteria 8245
83 Ga0466728_146813 3300042620 Bacteria 2527
84 Ga0466728_382716 3300042620 Bacteria 10504
85 Ga0456237_0005053 3300041968 Bacteria 2102
86 Ga0466691_023884 3300042593 Bacteria 1260
87 Ga0466696_068328 3300042596 Bacteria 1465
88 Ga0466696_392883 3300042596 Bacteria 1201
89 Ga0466696_427787 3300042596 Bacteria 2878
90 Ga0466707_120455 3300042601 Bacteria 2036
91 Ga0466716_043338 3300042605 Bacteria 4509
92 Ga0466716_050077 3300042605 Bacteria 2257
93 Ga0466719_010450 3300042606 Bacteria 11674
94 Ga0466719_196642 3300042606 Unclassified 3269
95 Ga0466703_031949 3300042636 Bacteria 1211
96 Ga0466703_090561 3300042636 Bacteria 6070
97 Ga0466703_131097 3300042636 Unclassified 4839
98 Ga0466709_230975 3300042648 Bacteria 9399
99 Ga0466708_406848 3300042652 Bacteria 1745
100 Ga0466705_122133 3300042612 Archaea 2254
101 Ga0466705_129228 3300042612 Bacteria 3623
102 Ga0466705_342239 3300042612 Bacteria 5235
103 Ga0466705_444462 3300042612 Bacteria 11898
104 Ga0466726_165920 3300042619 Bacteria 4443
105 Ga0466728_156707 3300042620 Archaea 2784
106 Ga0264413_104924 3300024493 Bacteria 11606
107 Ga0466690_077273 3300042590 Bacteria 1341
108 Ga0466690_081547 3300042590 Unclassified 2441
109 Ga0466692_074656 3300042591 Bacteria 32125
110 Ga0466691_078332 3300042593 Bacteria 2955
111 Ga0466691_190091 3300042593 Bacteria 2318
112 Ga0466696_128349 3300042596 Bacteria 2157
113 Ga0466696_307108 3300042596 Bacteria 6354
114 Ga0466707_202449 3300042601 Bacteria 1543
115 Ga0466719_547594 3300042606 Bacteria 1682
116 Ga0466729_264251 3300042621 Bacteria 2319
117 Ga0466703_019072 3300042636 Bacteria 12598
118 Ga0466703_032543 3300042636 Bacteria 6037
119 Ga0466703_182193 3300042636 Bacteria 10010
120 Ga0466704_101595 3300042643 Bacteria 7586
121 Ga0466704_149466 3300042643 Bacteria 1111
122 Ga0466709_378468 3300042648 Bacteria 1316
123 Ga0466708_362708 3300042652 Bacteria 8584
124 JGI24698J34947_10024804 3300002449 Bacteria 3197
125 JGI24702J35022_10222396 3300002462 Bacteria 1088
126 Ga0466705_196160 3300042612 Unclassified 1850
127 Ga0466718_160637 3300042617 Bacteria 1238
128 Ga0466723_069359 3300042618 Bacteria 6092
129 Ga0466723_202879 3300042618 Bacteria 6014
130 Ga0415639_013250 3300038395 Bacteria 6660
131 Ga0466691_104767 3300042593 Bacteria 6773
132 Ga0466707_279383 3300042601 Bacteria 1010
133 Ga0466720_020914 3300042607 Bacteria 6167
134 Ga0466703_225893 3300042636 Bacteria 1360
135 Ga0466703_307082 3300042636 Bacteria 1314
136 Ga0466704_054634 3300042643 Bacteria 3515

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_503963 Ga0466715_503963_64_498 144
2 3300042590 Ga0466690_335828 Ga0466690_335828_458_1024 170
3 3300042618 Ga0466723_069359 Ga0466723_069359_1369_1935 170
4 3300042618 Ga0466723_202879 Ga0466723_202879_1744_2310 170
5 3300042648 Ga0466709_378468 Ga0466709_378468_634_1200 170
6 3300042593 Ga0466691_104767 Ga0466691_104767_2936_3502 171
7 3300042596 Ga0466696_112558 Ga0466696_112558_472_1038 173
8 3300042652 Ga0466708_362708 Ga0466708_362708_5055_5621 173
9 3300042620 Ga0466728_146813 Ga0466728_146813_426_992 175
10 3300042606 Ga0466719_547594 Ga0466719_547594_340_906 176
11 3300042618 Ga0466723_165141 Ga0466723_165141_6553_7119 178
12 3300042596 Ga0466696_217530 Ga0466696_217530_1315_1881 179
13 3300042601 Ga0466707_120455 Ga0466707_120455_1110_1649 179
14 3300042602 Ga0466713_014911 Ga0466713_014911_286_828 180
15 3300042609 Ga0466722_097367 Ga0466722_097367_705_1298 180
16 3300002449 JGI24698J34947_10024804 JGI24698J34947_100248044 182
17 3300042593 Ga0466691_078332 Ga0466691_078332_1417_1965 182
18 3300042596 Ga0466696_128349 Ga0466696_128349_445_993 182
19 3300042596 Ga0466696_307108 Ga0466696_307108_2369_2917 182
20 3300042605 Ga0466716_050077 Ga0466716_050077_758_1306 182
21 3300042618 Ga0466723_066824 Ga0466723_066824_19506_20054 182
22 3300042618 Ga0466723_082414 Ga0466723_082414_406_954 182
23 3300042618 Ga0466723_102548 Ga0466723_102548_694_1242 182
24 3300042619 Ga0466726_023985 Ga0466726_023985_2086_2679 182
25 3300042620 Ga0466728_381486 Ga0466728_381486_1562_2110 182
26 3300042643 Ga0466704_407088 Ga0466704_407088_3053_3601 182
27 3300042652 Ga0466708_222084 Ga0466708_222084_2514_3062 182
28 3300042612 Ga0466705_342239 Ga0466705_342239_3984_4535 183
29 3300042636 Ga0466703_031949 Ga0466703_031949_57_608 183
30 3300042643 Ga0466704_333543 Ga0466704_333543_386_937 183
31 iso_pr_bacteria 2781125666 2781345424 183
32 3300009784 Ga0123357_10003698 Ga0123357_100036983 184
33 3300042590 Ga0466690_081547 Ga0466690_081547_939_1493 184
34 3300042593 Ga0466691_174194 Ga0466691_174194_13087_13641 184
35 3300042605 Ga0466716_043338 Ga0466716_043338_729_1283 184
36 3300042606 Ga0466719_338449 Ga0466719_338449_92_646 184
37 3300042612 Ga0466705_294788 Ga0466705_294788_1321_1875 184
38 3300042618 Ga0466723_077553 Ga0466723_077553_619_1173 184
39 3300042636 Ga0466703_090561 Ga0466703_090561_3286_3861 184
40 3300042643 Ga0466704_101955 Ga0466704_101955_16577_17131 184
41 3300042596 Ga0466696_392883 Ga0466696_392883_12_569 185
42 3300042659 Ga0466733_140235 Ga0466733_140235_25_582 185
43 3300041968 Ga0456237_0005053 Ga0456237_0005053_579_1139 186
44 3300042591 Ga0466692_074656 Ga0466692_074656_1146_1706 186
45 3300042596 Ga0466696_078034 Ga0466696_078034_4576_5136 186
46 3300042601 Ga0466707_022255 Ga0466707_022255_282_842 186
47 3300042606 Ga0466719_042673 Ga0466719_042673_553_1113 186
48 3300042609 Ga0466722_013559 Ga0466722_013559_996_1556 186
49 3300042612 Ga0466705_129228 Ga0466705_129228_1600_2160 186
50 3300042615 Ga0466711_239123 Ga0466711_239123_26337_26897 186
51 3300042620 Ga0466728_019113 Ga0466728_019113_3732_4292 186
52 3300042620 Ga0466728_086606 Ga0466728_086606_1440_2000 186
53 3300042620 Ga0466728_220948 Ga0466728_220948_335_895 186
54 3300042636 Ga0466703_421496 Ga0466703_421496_235_795 186
55 3300042643 Ga0466704_258537 Ga0466704_258537_1440_2000 186
56 3300042605 Ga0466716_466340 Ga0466716_466340_997_1560 187
57 3300042619 Ga0466726_339261 Ga0466726_339261_343_906 187
58 3300042648 Ga0466709_230975 Ga0466709_230975_806_1369 187
59 3300042590 Ga0466690_065689 Ga0466690_065689_595_1161 188
60 3300042590 Ga0466690_077273 Ga0466690_077273_99_665 188
61 3300042593 Ga0466691_004939 Ga0466691_004939_3892_4458 188
62 3300042593 Ga0466691_023884 Ga0466691_023884_221_787 188
63 3300042593 Ga0466691_107178 Ga0466691_107178_311_877 188
64 3300042605 Ga0466716_520083 Ga0466716_520083_482_1048 188
65 3300042612 Ga0466705_151234 Ga0466705_151234_3445_4011 188
66 3300042612 Ga0466705_196160 Ga0466705_196160_1147_1713 188
67 3300042612 Ga0466705_444462 Ga0466705_444462_1178_1744 188
68 3300042615 Ga0466711_290877 Ga0466711_290877_491_1057 188
69 3300042616 Ga0466715_051723 Ga0466715_051723_19587_20153 188
70 3300042616 Ga0466715_065034 Ga0466715_065034_1766_2332 188
71 3300042619 Ga0466726_165920 Ga0466726_165920_1850_2416 188
72 3300042621 Ga0466729_264251 Ga0466729_264251_1581_2147 188
73 3300042636 Ga0466703_019072 Ga0466703_019072_8832_9398 188
74 3300042636 Ga0466703_131097 Ga0466703_131097_4198_4764 188
75 3300042636 Ga0466703_225893 Ga0466703_225893_76_642 188
76 3300042636 Ga0466703_307082 Ga0466703_307082_616_1182 188
77 3300042636 Ga0466703_321449 Ga0466703_321449_4370_4936 188
78 3300042643 Ga0466704_054634 Ga0466704_054634_827_1393 188
79 3300042652 Ga0466708_054774 Ga0466708_054774_223_789 188
80 3300042652 Ga0466708_171620 Ga0466708_171620_3678_4244 188
81 3300010882 Ga0123354_10445273 Ga0123354_104452732 189
82 3300042593 Ga0466691_190091 Ga0466691_190091_411_980 189
83 3300042610 Ga0466698_298763 Ga0466698_298763_95_664 189
84 3300042612 Ga0466705_234875 Ga0466705_234875_495_1067 190
85 3300042618 Ga0466723_099185 Ga0466723_099185_777_1349 190
86 3300042643 Ga0466704_087352 Ga0466704_087352_1433_2005 190
87 3300042652 Ga0466708_406848 Ga0466708_406848_748_1320 190
88 3300038395 Ga0415639_013250 Ga0415639_013250_5027_5602 191
89 3300042602 Ga0466713_057438 Ga0466713_057438_1224_1799 191
90 3300042605 Ga0466716_071678 Ga0466716_071678_863_1438 191
91 3300042618 Ga0466723_131066 Ga0466723_131066_29819_30394 191
92 3300005083 Ga0068305_10103761 Ga0068305_101037612 192
93 3300042601 Ga0466707_279383 Ga0466707_279383_299_877 192
94 3300042618 Ga0466723_030088 Ga0466723_030088_13155_13733 192
95 3300042619 Ga0466726_412698 Ga0466726_412698_548_1126 192
96 3300042620 Ga0466728_156707 Ga0466728_156707_936_1514 192
97 3300042596 Ga0466696_427787 Ga0466696_427787_758_1339 193
98 3300042590 Ga0466690_038007 Ga0466690_038007_4598_5224 194
99 3300042601 Ga0466707_202449 Ga0466707_202449_47_631 194
100 3300042607 Ga0466720_160936 Ga0466720_160936_213_797 194
101 3300042614 Ga0466712_085121 Ga0466712_085121_26048_26632 194
102 3300042617 Ga0466718_160637 Ga0466718_160637_135_719 194
103 3300000089 AustNasuHG_c1021888 AustNasuHG_10218884 195
104 3300002462 JGI24702J35022_10222396 JGI24702J35022_102223962 195
105 3300042596 Ga0466696_068328 Ga0466696_068328_501_1088 195
106 3300042601 Ga0466707_149534 Ga0466707_149534_2908_3495 195
107 3300042606 Ga0466719_264055 Ga0466719_264055_2669_3256 195
108 3300010167 Ga0123353_10652944 Ga0123353_106529443 196
109 3300042620 Ga0466728_021526 Ga0466728_021526_489_1115 196
110 3300042636 Ga0466703_182193 Ga0466703_182193_3894_4484 196
111 3300042652 Ga0466708_109507 Ga0466708_109507_13357_13977 196
112 3300042636 Ga0466703_258399 Ga0466703_258399_2509_3102 197
113 3300024493 Ga0264413_104924 Ga0264413_10492410 198
114 3300024493 Ga0264413_131816 Ga0264413_1318163 198
115 3300042607 Ga0466720_020914 Ga0466720_020914_1687_2283 198
116 3300042601 Ga0466707_194458 Ga0466707_194458_635_1234 199
117 3300042643 Ga0466704_149466 Ga0466704_149466_315_914 199
118 3300002462 JGI24702J35022_10032219 JGI24702J35022_100322194 200
119 3300002462 JGI24702J35022_10048495 JGI24702J35022_100484952 200
120 3300002462 JGI24702J35022_10148264 JGI24702J35022_101482642 200
121 3300042606 Ga0466719_196642 Ga0466719_196642_1573_2175 200
122 3300042612 Ga0466705_001314 Ga0466705_001314_1802_2404 200
123 3300042616 Ga0466715_084854 Ga0466715_084854_53_655 200
124 3300042618 Ga0466723_372204 Ga0466723_372204_2925_3527 200
125 3300042606 Ga0466719_010450 Ga0466719_010450_2170_2775 201
126 3300042652 Ga0466708_061104 Ga0466708_061104_3244_3849 201
127 3300042609 Ga0466722_036236 Ga0466722_036236_824_1432 202
128 3300042643 Ga0466704_101595 Ga0466704_101595_4768_5376 202
129 3300042620 Ga0466728_382716 Ga0466728_382716_3676_4290 204
130 3300042612 Ga0466705_122133 Ga0466705_122133_428_1045 205
131 3300042602 Ga0466713_116845 Ga0466713_116845_862_1482 206
132 3300042612 Ga0466705_280586 Ga0466705_280586_1455_2078 207
133 3300042643 Ga0466704_594303 Ga0466704_594303_386_1009 207
134 3300042618 Ga0466723_312728 Ga0466723_312728_3972_4598 208
135 3300042636 Ga0466703_032543 Ga0466703_032543_2725_3357 210
136 3300042655 Ga0466727_317334 Ga0466727_317334_341_1006 221
137 3300042655 Ga0466727_340976 Ga0466727_340976_1125_1856 224

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04542 Sigma70_r2 Sigma-70 region 2 35 101 0.98
PF08281 Sigma70_r4_2 Sigma-70, region 4 145 197 0.97

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4lup-assembly2.cif.gz_C Crystal structure of the complex formed by region of E. coli sigmaE bound to its -10 element non template strand 0.956 17 106
2mao-assembly1.cif.gz_A NMR structure of region 2 of E. coli sigmaE 0.865 8 110
1h3l-assembly1.cif.gz_A N-terminal fragment of SigR from Streptomyces coelicolor 0.864 26 96
7bcb-assembly1.cif.gz_A Crystal structure of the HTH DNA binding protein ArdK from R388 plasmid bound to IR3 DNA 0.863 154 199
5or5-assembly1.cif.gz_A NMR structure of the complex formed by an engineered region 2 of sigmaE in complex with GTAAAA 0.855 8 106
IDDescriptionScoreStartEndSuperfamily
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9557 17 106 1.10.1740.10
4lupA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9483 17 106 1.10.1740.10
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9293 9 100 1.10.1740.10
af_P9WGH7_10_94_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9069 19 98 1.10.1740.10
4cxfA01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9018 17 95 1.10.1740.10
IDDescriptionScoreStartEndGO Terms
AF-A0A381ICB4-F1-model_v4 Uncharacterized/unreviewed 0.8657 17 113 GO:0003677
GO:0016987
GO:0006352
AF-A0A3D9QXY4-F1-model_v4 Uncharacterized/unreviewed 0.863 14 116 GO:0003677
GO:0016987
GO:0006352
AF-A0A7W1SQY8-F1-model_v4 Uncharacterized/unreviewed 0.8437 8 106
AF-A0A7W1RZ57-F1-model_v4 Uncharacterized/unreviewed 0.8284 1 100

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.56 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.