Protein Family IF09097

Metagenome Isolate
203 Members
74 Samples
179 Scaffolds
119.61 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_032512|Ga0466703_032512_1815_2195
Length
126 aa
Sequence
MQKGKIMEQLTPQEEQLMLYVWETGKGFIKDFRNKYPGDSKPPYTTVATIMKKLEAKGYVLATLYGNTYEYRPKIKRDKYKSHYVSDLVSNYFQNSYKEMVSFFAREEKLSEQDLEDIIQLIKKRK

📊 Sample Types

Isolate 11.8%
Metagenome 88.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.9%
Kalotermitidae 19.2%
Blattidae 17.8%
Unclassified 12.3%
Rhinotermitidae 6.8%
Termopsidae 4.1%
Hydrophilidae 2.7%
Passalidae 2.7%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 169
Eukaryota 0
Viruses 0
Unclassified 34

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
14 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
15 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
18 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
19 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
20 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
21 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
22 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
23 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
24 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
30 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
31 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
32 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
41 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
46 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
47 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
48 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
49 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
51 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
53 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
54 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
55 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
56 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
57 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
58 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
59 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
60 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
61 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
62 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
63 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
64 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
65 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
66 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
67 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
68 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
69 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
70 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
71 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
72 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
73 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
74 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_175709 3300042611 Unclassified 1165
2 Ga0466707_070027 3300042601 Bacteria 6996
3 Ga0466713_039592 3300042602 Bacteria 11904
4 Ga0466719_034015 3300042606 Bacteria 3284
5 Ga0466711_104691 3300042615 Bacteria 11723
6 Ga0466726_412765 3300042619 Unclassified 1262
7 Ga0466729_126291 3300042621 Bacteria 3881
8 Ga0466657_164332 3300042582 Bacteria 1258
9 Ga0466692_196455 3300042591 Bacteria 23185
10 Ga0466693_161735 3300042592 Unclassified 1000
11 Ga0466696_001458 3300042596 Bacteria 20710
12 Ga0123357_10004693 3300009784 Unclassified 16140
13 Ga0123357_10169758 3300009784 Unclassified 2585
14 Ga0123356_10382174 3300010049 Bacteria 1541
15 Ga0123354_10001279 3300010882 Bacteria 29888
16 Ga0123354_10157199 3300010882 Bacteria 2721
17 Ga0466734_042091 3300042623 Bacteria 1916
18 Ga0466735_207584 3300042624 Bacteria 2662
19 Ga0466703_079158 3300042636 Unclassified 6088
20 Ga0466704_542283 3300042643 Bacteria 38270
21 Ga0466709_161236 3300042648 Bacteria 2826
22 Ga0466727_150038 3300042655 Bacteria 31765
23 IMNBL1DRAFT_c0012226 3300000062 Bacteria 3943
24 JGI24695J34938_10141665 3300002450 Bacteria 982
25 JGI24702J35022_10238003 3300002462 Bacteria 1055
26 JGI24699J35502_11134217 3300002509 Bacteria 65443
27 JGI24696J40584_12533832 3300002834 Unclassified 616
28 Ga0466697_278910 3300042611 Bacteria 1881
29 Ga0466705_225484 3300042612 Bacteria 1401
30 Ga0466705_237773 3300042612 Bacteria 1889
31 Ga0466705_383225 3300042612 Unclassified 2255
32 Ga0466732_326244 3300042656 Bacteria 1493
33 Ga0466701_084460 3300042598 Bacteria 6172
34 Ga0466700_460532 3300042600 Bacteria 2660
35 Ga0466707_095237 3300042601 Bacteria 13588
36 Ga0466713_017127 3300042602 Bacteria 94881
37 Ga0466719_536370 3300042606 Bacteria 1581
38 Ga0466729_026668 3300042621 Bacteria 1145
39 Ga0466691_039043 3300042593 Bacteria 7947
40 Ga0123357_10176755 3300009784 Bacteria 2507
41 Ga0123356_11158353 3300010049 Unclassified 940
42 Ga0123353_11615124 3300010167 Bacteria 818
43 Ga0466704_160374 3300042643 Bacteria 25736
44 Ga0466704_261304 3300042643 Bacteria 8340
45 2227652406 2225789004 Bacteria 10729
46 Ga0123357_10000458 3300009784 Bacteria 39494
47 Ga0466705_052705 3300042612 Bacteria 20164
48 Ga0466705_133981 3300042612 Bacteria 5258
49 Ga0466705_263821 3300042612 Bacteria 21616
50 Ga0466732_248561 3300042656 Unclassified 1785
51 Ga0466733_110450 3300042659 Bacteria 40709
52 Ga0466713_067215 3300042602 Bacteria 23216
53 Ga0466713_151474 3300042602 Bacteria 1643
54 Ga0466723_005954 3300042618 Bacteria 4147
55 Ga0466726_288887 3300042619 Bacteria 17570
56 Ga0466728_169887 3300042620 Bacteria 3816
57 Ga0466657_348316 3300042582 Unclassified 1243
58 Ga0466694_194721 3300042594 Bacteria 3074
59 Ga0123356_10083626 3300010049 Bacteria 3024
60 Ga0123356_11342504 3300010049 Unclassified 877
61 Ga0123354_10814852 3300010882 Unclassified 626
62 Ga0466703_132722 3300042636 Bacteria 1786
63 Ga0466727_196033 3300042655 Bacteria 6068
64 IMNBL1DRAFT_c0001092 3300000062 Bacteria 20800
65 JGI24702J35022_10139950 3300002462 Bacteria 1350
66 Ga0466733_073404 3300042659 Bacteria 15391
67 Ga0466707_075198 3300042601 Bacteria 13033
68 Ga0466707_324992 3300042601 Bacteria 1339
69 Ga0466719_437134 3300042606 Bacteria 3747
70 Ga0466697_056567 3300042611 Bacteria 485126
71 Ga0466705_511066 3300042612 Bacteria 20427
72 Ga0466710_353571 3300042613 Bacteria 1345
73 Ga0466710_396579 3300042613 Bacteria 9148
74 Ga0466692_107303 3300042591 Bacteria 3729
75 Ga0466692_148899 3300042591 Bacteria 16099
76 Ga0466696_175454 3300042596 Bacteria 1744
77 Ga0466701_000462 3300042598 Bacteria 39838
78 Ga0123357_10614462 3300009784 Bacteria 826
79 Ga0123356_10978059 3300010049 Bacteria 1017
80 Ga0123353_10883878 3300010167 Bacteria 1219
81 Ga0123354_10541656 3300010882 Bacteria 883
82 Ga0466703_028163 3300042636 Bacteria 5109
83 Ga0466703_084851 3300042636 Bacteria 16965
84 Ga0466704_186547 3300042643 Bacteria 9429
85 Ga0466704_470276 3300042643 Bacteria 10510
86 Ga0466708_270810 3300042652 Bacteria 3487
87 2227375261 2225789004 Bacteria 5968
88 IMNBL1DRAFT_c0004089 3300000062 Bacteria 8920
89 JGI24702J35022_10015686 3300002462 Bacteria 4162
90 JGI24702J35022_10058789 3300002462 Bacteria 2053
91 JGI24702J35022_10199042 3300002462 Unclassified 1145
92 JGI24696J40584_12451564 3300002834 Bacteria 576
93 Ga0466700_465810 3300042600 Unclassified 8510
94 Ga0466716_034468 3300042605 Unclassified 5214
95 Ga0466711_022845 3300042615 Bacteria 2082
96 Ga0466711_206391 3300042615 Bacteria 7473
97 Ga0466726_082467 3300042619 Bacteria 2903
98 Ga0466729_194629 3300042621 Unclassified 1052
99 Ga0466657_098958 3300042582 Bacteria 1008
100 Ga0466693_311047 3300042592 Bacteria 1190
101 Ga0466695_120949 3300042595 Bacteria 2766
102 Ga0123357_10048629 3300009784 Unclassified 5746
103 Ga0123357_10079202 3300009784 Unclassified 4327
104 Ga0123356_13388983 3300010049 Bacteria 553
105 Ga0123353_12932419 3300010167 Unclassified 555
106 Ga0123354_10073719 3300010882 Unclassified 4898
107 Ga0123354_10161558 3300010882 Bacteria 2657
108 Ga0466731_348241 3300042622 Unclassified 2348
109 Ga0466735_137142 3300042624 Bacteria 1436
110 Ga0466730_086184 3300042625 Unclassified 6468
111 Ga0466703_321983 3300042636 Bacteria 6631
112 Ga0466703_414764 3300042636 Unclassified 3659
113 Ga0466704_164916 3300042643 Bacteria 14920
114 Ga0466709_164171 3300042648 Bacteria 70343
115 Ga0466708_432797 3300042652 Bacteria 1777
116 IMNBL1DRAFT_c0064429 3300000062 Bacteria 1085
117 JGI24705J35276_11785396 3300002504 Unclassified 676
118 JGI24699J35502_11134134 3300002509 Bacteria 35214
119 Ga0068305_10281614 3300005083 Unclassified 3982
120 Ga0466707_386769 3300042601 Bacteria 1074
121 Ga0466713_017181 3300042602 Bacteria 54753
122 Ga0466713_020857 3300042602 Bacteria 6155
123 Ga0466719_110688 3300042606 Bacteria 18844
124 Ga0466722_153270 3300042609 Bacteria 1719
125 Ga0466705_415721 3300042612 Unclassified 2227
126 Ga0466715_364671 3300042616 Bacteria 20378
127 Ga0123357_10035183 3300009784 Bacteria 6809
128 Ga0123357_10575928 3300009784 Bacteria 880
129 Ga0123353_12363204 3300010167 Bacteria 637
130 Ga0123354_10001525 3300010882 Bacteria 28373
131 Ga0466735_164016 3300042624 Bacteria 2807
132 Ga0466704_299516 3300042643 Bacteria 6618
133 Ga0466725_000988 3300042654 Bacteria 1466
134 Ga0466727_231918 3300042655 Bacteria 5807
135 IMNBL1DRAFT_c0004191 3300000062 Bacteria 8766
136 Ga0466733_030455 3300042659 Bacteria 39544
137 Ga0466733_032300 3300042659 Unclassified 5543
138 Ga0466733_093605 3300042659 Bacteria 59912
139 Ga0466706_073522 3300042599 Bacteria 4327
140 Ga0466713_104757 3300042602 Bacteria 74823
141 Ga0466716_083754 3300042605 Bacteria 2026
142 Ga0466722_118767 3300042609 Bacteria 13208
143 Ga0466715_542362 3300042616 Bacteria 1222
144 Ga0466726_070488 3300042619 Unclassified 1478
145 Ga0466729_181930 3300042621 Bacteria 1139
146 Ga0265387_1008290 3300024582 Bacteria 1396
147 Ga0123353_10136356 3300010167 Bacteria 3936
148 Ga0123354_10010911 3300010882 Bacteria 14018
149 Ga0123354_10027171 3300010882 Bacteria 9016
150 Ga0123354_10210133 3300010882 Unclassified 2106
151 Ga0123354_10259209 3300010882 Unclassified 1741
152 Ga0123354_10833085 3300010882 Bacteria 616
153 Ga0466703_032512 3300042636 Bacteria 2281
154 Ga0466703_033062 3300042636 Bacteria 4323
155 Ga0466703_411849 3300042636 Bacteria 1181
156 Ga0466704_591639 3300042643 Unclassified 1607
157 Ga0466727_112062 3300042655 Bacteria 11250
158 2227239117 2225789004 Bacteria 7263
159 Ga0123357_10000085 3300009784 Bacteria 75372
160 Ga0466707_104078 3300042601 Bacteria 25332
161 Ga0466707_166229 3300042601 Bacteria 2781
162 Ga0466707_187619 3300042601 Bacteria 4106
163 Ga0466716_442881 3300042605 Bacteria 4209
164 Ga0466715_575991 3300042616 Bacteria 10831
165 Ga0466690_023688 3300042590 Bacteria 3421
166 Ga0466692_175785 3300042591 Bacteria 2210
167 Ga0466696_177837 3300042596 Bacteria 4787
168 Ga0466696_470029 3300042596 Bacteria 3443
169 Ga0123357_10065228 3300009784 Bacteria 4862
170 Ga0123357_10564196 3300009784 Unclassified 898
171 Ga0123355_11397979 3300009826 Unclassified 692
172 Ga0123356_13954292 3300010049 Bacteria 511
173 Ga0466729_211367 3300042621 Bacteria 16775
174 Ga0466735_113850 3300042624 Bacteria 1023
175 Ga0466703_129408 3300042636 Bacteria 2749
176 Ga0466704_479629 3300042643 Bacteria 9360
177 Ga0466727_105531 3300042655 Bacteria 3760
178 2227490470 2225789004 Bacteria 4107
179 IMNBL1DRAFT_c0076186 3300000062 Bacteria 952

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_383225 Ga0466705_383225_203_562 102
2 3300042643 Ga0466704_164916 Ga0466704_164916_14529_14891 102
3 3300042643 Ga0466704_261304 Ga0466704_261304_7949_8311 102
4 3300042612 Ga0466705_415721 Ga0466705_415721_1572_1934 104
5 3300042582 Ga0466657_348316 Ga0466657_348316_14_337 107
6 3300042621 Ga0466729_194629 Ga0466729_194629_622_948 108
7 3300002462 JGI24702J35022_10199042 JGI24702J35022_101990422 109
8 3300042643 Ga0466704_470276 Ga0466704_470276_6492_6851 110
9 3300042655 Ga0466727_231918 Ga0466727_231918_61_402 113
10 3300042601 Ga0466707_324992 Ga0466707_324992_246_599 117
11 3300042605 Ga0466716_083754 Ga0466716_083754_1110_1463 117
12 3300042636 Ga0466703_129408 Ga0466703_129408_2130_2483 117
13 3300042654 Ga0466725_000988 Ga0466725_000988_1038_1391 117
14 3300042656 Ga0466732_326244 Ga0466732_326244_746_1099 117
15 iso_pr_bacteria 2820776227 2820777942 117
16 3300010049 Ga0123356_11342504 Ga0123356_113425042 118
17 3300010882 Ga0123354_10157199 Ga0123354_101571992 118
18 3300010882 Ga0123354_10259209 Ga0123354_102592092 118
19 3300042582 Ga0466657_164332 Ga0466657_164332_87_443 118
20 3300042591 Ga0466692_175785 Ga0466692_175785_174_530 118
21 3300042592 Ga0466693_161735 Ga0466693_161735_588_944 118
22 3300042594 Ga0466694_194721 Ga0466694_194721_43_399 118
23 3300042596 Ga0466696_001458 Ga0466696_001458_1321_1677 118
24 3300042600 Ga0466700_465810 Ga0466700_465810_6757_7113 118
25 3300042601 Ga0466707_104078 Ga0466707_104078_16551_16907 118
26 3300042611 Ga0466697_056567 Ga0466697_056567_117307_117663 118
27 3300042611 Ga0466697_175709 Ga0466697_175709_610_966 118
28 3300042613 Ga0466710_396579 Ga0466710_396579_1695_2051 118
29 3300042621 Ga0466729_126291 Ga0466729_126291_551_907 118
30 3300042623 Ga0466734_042091 Ga0466734_042091_1161_1517 118
31 3300042624 Ga0466735_113850 Ga0466735_113850_283_639 118
32 3300042624 Ga0466735_207584 Ga0466735_207584_1710_2066 118
33 iso_pr_bacteria 2820759988 2820762416 118
34 iso_pr_bacteria 2820762746 2820764170 118
35 2225789004 2227239117 2227677773 119
36 2225789004 2227375261 2227821420 119
37 2225789004 2227490470 2227961675 119
38 2225789004 2227652406 2228248753 119
39 3300000062 IMNBL1DRAFT_c0012226 IMNBL1DRAFT_00122264 119
40 3300000062 IMNBL1DRAFT_c0076186 IMNBL1DRAFT_00761862 119
41 3300002450 JGI24695J34938_10141665 JGI24695J34938_101416652 119
42 3300002462 JGI24702J35022_10058789 JGI24702J35022_100587892 119
43 3300002462 JGI24702J35022_10238003 JGI24702J35022_102380031 119
44 3300002509 JGI24699J35502_11134134 JGI24699J35502_111341342 119
45 3300002509 JGI24699J35502_11134217 JGI24699J35502_1113421727 119
46 3300002834 JGI24696J40584_12451564 JGI24696J40584_124515642 119
47 3300002834 JGI24696J40584_12533832 JGI24696J40584_125338321 119
48 3300009784 Ga0123357_10000458 Ga0123357_1000045820 119
49 3300009784 Ga0123357_10004693 Ga0123357_100046938 119
50 3300009784 Ga0123357_10048629 Ga0123357_100486292 119
51 3300009784 Ga0123357_10065228 Ga0123357_100652283 119
52 3300009784 Ga0123357_10169758 Ga0123357_101697583 119
53 3300009784 Ga0123357_10176755 Ga0123357_101767552 119
54 3300009784 Ga0123357_10564196 Ga0123357_105641962 119
55 3300010049 Ga0123356_10382174 Ga0123356_103821742 119
56 3300010049 Ga0123356_11158353 Ga0123356_111583531 119
57 3300010167 Ga0123353_12932419 Ga0123353_129324191 119
58 3300010882 Ga0123354_10001279 Ga0123354_1000127917 119
59 3300010882 Ga0123354_10541656 Ga0123354_105416562 119
60 3300024582 Ga0265387_1008290 Ga0265387_10082902 119
61 3300042590 Ga0466690_023688 Ga0466690_023688_1769_2128 119
62 3300042591 Ga0466692_107303 Ga0466692_107303_1665_2024 119
63 3300042591 Ga0466692_196455 Ga0466692_196455_6346_6705 119
64 3300042598 Ga0466701_000462 Ga0466701_000462_37995_38354 119
65 3300042599 Ga0466706_073522 Ga0466706_073522_732_1091 119
66 3300042601 Ga0466707_070027 Ga0466707_070027_885_1244 119
67 3300042601 Ga0466707_075198 Ga0466707_075198_8675_9034 119
68 3300042601 Ga0466707_095237 Ga0466707_095237_8221_8580 119
69 3300042601 Ga0466707_187619 Ga0466707_187619_1277_1636 119
70 3300042601 Ga0466707_386769 Ga0466707_386769_65_424 119
71 3300042602 Ga0466713_067215 Ga0466713_067215_5156_5515 119
72 3300042605 Ga0466716_034468 Ga0466716_034468_1912_2271 119
73 3300042606 Ga0466719_110688 Ga0466719_110688_2475_2834 119
74 3300042606 Ga0466719_536370 Ga0466719_536370_1189_1548 119
75 3300042609 Ga0466722_153270 Ga0466722_153270_204_563 119
76 3300042611 Ga0466697_278910 Ga0466697_278910_247_606 119
77 3300042612 Ga0466705_052705 Ga0466705_052705_1423_1782 119
78 3300042612 Ga0466705_225484 Ga0466705_225484_138_497 119
79 3300042612 Ga0466705_511066 Ga0466705_511066_6026_6385 119
80 3300042613 Ga0466710_353571 Ga0466710_353571_145_504 119
81 3300042615 Ga0466711_206391 Ga0466711_206391_7041_7400 119
82 3300042619 Ga0466726_070488 Ga0466726_070488_662_1021 119
83 3300042619 Ga0466726_082467 Ga0466726_082467_1102_1461 119
84 3300042619 Ga0466726_412765 Ga0466726_412765_840_1199 119
85 3300042621 Ga0466729_026668 Ga0466729_026668_37_396 119
86 3300042636 Ga0466703_028163 Ga0466703_028163_1890_2249 119
87 3300042636 Ga0466703_132722 Ga0466703_132722_774_1133 119
88 3300042636 Ga0466703_414764 Ga0466703_414764_2525_2884 119
89 3300042643 Ga0466704_186547 Ga0466704_186547_7353_7712 119
90 3300042643 Ga0466704_479629 Ga0466704_479629_4250_4609 119
91 3300042643 Ga0466704_591639 Ga0466704_591639_144_503 119
92 3300042655 Ga0466727_105531 Ga0466727_105531_1532_1891 119
93 3300042655 Ga0466727_112062 Ga0466727_112062_2161_2520 119
94 3300042655 Ga0466727_150038 Ga0466727_150038_15562_15921 119
95 3300042656 Ga0466732_248561 Ga0466732_248561_1010_1369 119
96 3300042659 Ga0466733_030455 Ga0466733_030455_37856_38215 119
97 iso_pr_bacteria 2820778767 2820778911 119
98 iso_pr_bacteria 2820778767 2820781097 119
99 iso_pr_bacteria 2910930387 2910932412 119
100 iso_pr_bacteria 2910942425 2910946836 119
101 iso_pr_bacteria 2940195863 2940196804 119
102 iso_pr_bacteria 2940209341 2940209877 119
103 3300000062 IMNBL1DRAFT_c0001092 IMNBL1DRAFT_00010925 120
104 3300000062 IMNBL1DRAFT_c0004089 IMNBL1DRAFT_00040895 120
105 3300002462 JGI24702J35022_10015686 JGI24702J35022_100156865 120
106 3300002504 JGI24705J35276_11785396 JGI24705J35276_117853962 120
107 3300009784 Ga0123357_10000085 Ga0123357_1000008550 120
108 3300009784 Ga0123357_10035183 Ga0123357_100351834 120
109 3300009784 Ga0123357_10575928 Ga0123357_105759282 120
110 3300009784 Ga0123357_10614462 Ga0123357_106144621 120
111 3300009826 Ga0123355_11397979 Ga0123355_113979792 120
112 3300010049 Ga0123356_13954292 Ga0123356_139542921 120
113 3300010167 Ga0123353_11615124 Ga0123353_116151241 120
114 3300010167 Ga0123353_12363204 Ga0123353_123632042 120
115 3300010882 Ga0123354_10210133 Ga0123354_102101332 120
116 3300010882 Ga0123354_10833085 Ga0123354_108330852 120
117 3300042593 Ga0466691_039043 Ga0466691_039043_5211_5573 120
118 3300042595 Ga0466695_120949 Ga0466695_120949_1070_1432 120
119 3300042596 Ga0466696_177837 Ga0466696_177837_2201_2563 120
120 3300042596 Ga0466696_470029 Ga0466696_470029_2864_3226 120
121 3300042600 Ga0466700_460532 Ga0466700_460532_227_589 120
122 3300042602 Ga0466713_017127 Ga0466713_017127_41160_41522 120
123 3300042602 Ga0466713_017181 Ga0466713_017181_24890_25252 120
124 3300042602 Ga0466713_039592 Ga0466713_039592_3837_4199 120
125 3300042605 Ga0466716_442881 Ga0466716_442881_2548_2910 120
126 3300042606 Ga0466719_034015 Ga0466719_034015_2792_3154 120
127 3300042606 Ga0466719_437134 Ga0466719_437134_401_763 120
128 3300042609 Ga0466722_118767 Ga0466722_118767_664_1026 120
129 3300042612 Ga0466705_133981 Ga0466705_133981_689_1051 120
130 3300042612 Ga0466705_237773 Ga0466705_237773_1403_1765 120
131 3300042612 Ga0466705_263821 Ga0466705_263821_6389_6751 120
132 3300042615 Ga0466711_022845 Ga0466711_022845_1459_1821 120
133 3300042615 Ga0466711_104691 Ga0466711_104691_7276_7638 120
134 3300042616 Ga0466715_364671 Ga0466715_364671_3816_4178 120
135 3300042616 Ga0466715_542362 Ga0466715_542362_195_557 120
136 3300042616 Ga0466715_575991 Ga0466715_575991_2953_3315 120
137 3300042618 Ga0466723_005954 Ga0466723_005954_1134_1496 120
138 3300042620 Ga0466728_169887 Ga0466728_169887_1670_2032 120
139 3300042621 Ga0466729_181930 Ga0466729_181930_452_814 120
140 3300042621 Ga0466729_211367 Ga0466729_211367_1268_1630 120
141 3300042622 Ga0466731_348241 Ga0466731_348241_1630_1992 120
142 3300042624 Ga0466735_164016 Ga0466735_164016_2289_2651 120
143 3300042625 Ga0466730_086184 Ga0466730_086184_4978_5340 120
144 3300042636 Ga0466703_084851 Ga0466703_084851_9243_9605 120
145 3300042636 Ga0466703_321983 Ga0466703_321983_102_464 120
146 3300042636 Ga0466703_411849 Ga0466703_411849_175_537 120
147 3300042643 Ga0466704_299516 Ga0466704_299516_4308_4670 120
148 3300042643 Ga0466704_542283 Ga0466704_542283_28936_29298 120
149 3300042648 Ga0466709_164171 Ga0466709_164171_21440_21802 120
150 3300042652 Ga0466708_270810 Ga0466708_270810_334_696 120
151 3300042652 Ga0466708_432797 Ga0466708_432797_836_1198 120
152 3300042655 Ga0466727_196033 Ga0466727_196033_1273_1635 120
153 3300042659 Ga0466733_032300 Ga0466733_032300_3426_3788 120
154 3300042659 Ga0466733_073404 Ga0466733_073404_12555_12917 120
155 3300042659 Ga0466733_093605 Ga0466733_093605_38919_39281 120
156 iso_pr_bacteria 2940244548 2940248254 120
157 iso_pr_bacteria 2940248789 2940252429 120
158 iso_pr_bacteria 2940253009 2940256585 120
159 iso_pr_bacteria 2940257232 2940260737 120
160 iso_pr_bacteria 8100166142 8100170729 120
161 3300000062 IMNBL1DRAFT_c0004191 IMNBL1DRAFT_00041913 121
162 3300000062 IMNBL1DRAFT_c0064429 IMNBL1DRAFT_00644292 121
163 3300005083 Ga0068305_10281614 Ga0068305_102816143 121
164 3300009784 Ga0123357_10079202 Ga0123357_100792023 121
165 3300010049 Ga0123356_13388983 Ga0123356_133889831 121
166 3300010167 Ga0123353_10136356 Ga0123353_101363562 121
167 3300010882 Ga0123354_10001525 Ga0123354_100015259 121
168 3300010882 Ga0123354_10010911 Ga0123354_100109113 121
169 3300010882 Ga0123354_10073719 Ga0123354_100737193 121
170 3300010882 Ga0123354_10814852 Ga0123354_108148522 121
171 3300042591 Ga0466692_148899 Ga0466692_148899_14341_14706 121
172 3300042592 Ga0466693_311047 Ga0466693_311047_298_663 121
173 3300042596 Ga0466696_175454 Ga0466696_175454_942_1307 121
174 3300042602 Ga0466713_020857 Ga0466713_020857_4412_4777 121
175 3300042624 Ga0466735_137142 Ga0466735_137142_32_397 121
176 3300042636 Ga0466703_033062 Ga0466703_033062_2393_2758 121
177 3300042648 Ga0466709_161236 Ga0466709_161236_1760_2125 121
178 3300042659 Ga0466733_110450 Ga0466733_110450_6432_6797 121
179 iso_pr_bacteria 2695420931 2698110495 121
180 iso_pr_bacteria 2873600114 2873603204 121
181 iso_pr_bacteria 2873610414 2873613587 121
182 iso_pr_bacteria 2910926975 2910927780 121
183 iso_pr_bacteria 2940199050 2940201633 121
184 iso_pr_bacteria 2940346213 2940348539 121
185 3300042582 Ga0466657_098958 Ga0466657_098958_552_920 122
186 3300042601 Ga0466707_166229 Ga0466707_166229_902_1270 122
187 iso_pr_bacteria 2695420317 2695486467 122
188 iso_pr_bacteria 8100157865 8100160991 122
189 3300010167 Ga0123353_10883878 Ga0123353_108838782 123
190 3300010882 Ga0123354_10027171 Ga0123354_100271717 123
191 3300042598 Ga0466701_084460 Ga0466701_084460_4460_4831 123
192 3300042602 Ga0466713_151474 Ga0466713_151474_862_1239 125
193 3300042636 Ga0466703_032512 Ga0466703_032512_1815_2195 126
194 3300042636 Ga0466703_079158 Ga0466703_079158_5019_5399 126
195 3300042643 Ga0466704_160374 Ga0466704_160374_6573_6953 126
196 iso_pr_bacteria 2940193328 2940194990 126
197 iso_pr_bacteria 2940336608 2940338265 126
198 3300010882 Ga0123354_10161558 Ga0123354_101615582 129
199 3300010049 Ga0123356_10083626 Ga0123356_100836262 134
200 3300010049 Ga0123356_10978059 Ga0123356_109780591 134
201 3300042619 Ga0466726_288887 Ga0466726_288887_2335_2739 134
202 3300042602 Ga0466713_104757 Ga0466713_104757_37142_37564 140
203 3300002462 JGI24702J35022_10139950 JGI24702J35022_101399502 141

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03965 Penicillinase_R Penicillinase repressor 10 123 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.68 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.