Protein Family IF09094
Metagenome
Isolate
127
Members
39
Samples
126
Scaffolds
206.86
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_028393|Ga0466703_028393_563_1279
- Length
- 220 aa
- Sequence
- MILNKQMSGFQNLVLFTAGFGKNGLKIDSLRPSFVLIKILFLFTLGCFLSFSAIADTFTFKADHMSGGRASGKEVTVLSGNAENNQYIECYGNVQGRDEEKDILFVTERLRYDRNLKIARLEGDSTLEDRKNEIVAKGRFIEYDDQAELTIFQISVRLFKDTMVCRSEYAIYRREEKLLDLSGFPVVYKDSDEFRADKIRVDLETDDVTMEGSVSGSIKG
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.7%
Kalotermitidae
36.8%
Termopsidae
7.9%
Rhinotermitidae
5.3%
Unclassified
2.6%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_180954 | 3300042656 | Unclassified | 1320 |
| 2 | Ga0466719_379466 | 3300042606 | Bacteria | 1982 |
| 3 | Ga0466720_140496 | 3300042607 | Bacteria | 17361 |
| 4 | Ga0466722_153640 | 3300042609 | Bacteria | 24564 |
| 5 | Ga0466705_481017 | 3300042612 | Bacteria | 1946 |
| 6 | Ga0466723_133301 | 3300042618 | Bacteria | 11077 |
| 7 | Ga0466728_132582 | 3300042620 | Bacteria | 2431 |
| 8 | JGI24695J34938_10027516 | 3300002450 | Bacteria | 2687 |
| 9 | JGI24705J35276_12052505 | 3300002504 | Bacteria | 921 |
| 10 | Ga0466735_190260 | 3300042624 | Bacteria | 7012 |
| 11 | Ga0466703_006326 | 3300042636 | Bacteria | 52440 |
| 12 | Ga0466703_339781 | 3300042636 | Bacteria | 1994 |
| 13 | Ga0466708_063315 | 3300042652 | Bacteria | 8124 |
| 14 | Ga0466690_084144 | 3300042590 | Bacteria | 2974 |
| 15 | Ga0466692_031579 | 3300042591 | Bacteria | 1112 |
| 16 | Ga0466696_327363 | 3300042596 | Bacteria | 1380 |
| 17 | Ga0466732_049629 | 3300042656 | Bacteria | 22386 |
| 18 | Ga0466717_069633 | 3300042604 | Unclassified | 1062 |
| 19 | Ga0466717_120153 | 3300042604 | Bacteria | 1628 |
| 20 | Ga0466705_457060 | 3300042612 | Bacteria | 5944 |
| 21 | Ga0466715_048251 | 3300042616 | Bacteria | 81213 |
| 22 | Ga0466718_030894 | 3300042617 | Bacteria | 17974 |
| 23 | Ga0466718_169569 | 3300042617 | Bacteria | 21165 |
| 24 | Ga0072940_1057886 | 3300005200 | Bacteria | 1850 |
| 25 | Ga0466703_028393 | 3300042636 | Bacteria | 4033 |
| 26 | Ga0466708_321737 | 3300042652 | Bacteria | 61371 |
| 27 | Ga0466691_032753 | 3300042593 | Bacteria | 2145 |
| 28 | Ga0466699_013441 | 3300042597 | Bacteria | 17996 |
| 29 | Ga0466699_040827 | 3300042597 | Bacteria | 4071 |
| 30 | Ga0466716_017079 | 3300042605 | Bacteria | 2622 |
| 31 | Ga0466720_039512 | 3300042607 | Bacteria | 7703 |
| 32 | Ga0466721_014843 | 3300042608 | Bacteria | 1194 |
| 33 | Ga0466711_317824 | 3300042615 | Bacteria | 4752 |
| 34 | Ga0466726_188307 | 3300042619 | Bacteria | 1728 |
| 35 | Ga0466726_435129 | 3300042619 | Bacteria | 1895 |
| 36 | Ga0466704_074758 | 3300042643 | Bacteria | 18855 |
| 37 | Ga0466727_214684 | 3300042655 | Bacteria | 6376 |
| 38 | Ga0466694_227745 | 3300042594 | Bacteria | 1736 |
| 39 | Ga0466696_450427 | 3300042596 | Bacteria | 17307 |
| 40 | Ga0466699_039424 | 3300042597 | Bacteria | 11527 |
| 41 | Ga0466705_164032 | 3300042612 | Bacteria | 5381 |
| 42 | Ga0466733_025515 | 3300042659 | Bacteria | 4212 |
| 43 | Ga0466706_204533 | 3300042599 | Bacteria | 4607 |
| 44 | Ga0466716_255704 | 3300042605 | Bacteria | 10126 |
| 45 | Ga0466719_334870 | 3300042606 | Bacteria | 1445 |
| 46 | Ga0466722_060233 | 3300042609 | Bacteria | 17242 |
| 47 | Ga0466715_040990 | 3300042616 | Bacteria | 1339 |
| 48 | Ga0466726_281513 | 3300042619 | Bacteria | 2226 |
| 49 | AustNasuHG_c1032959 | 3300000089 | Bacteria | 1422 |
| 50 | Ga0072941_1020576 | 3300005201 | Bacteria | 7466 |
| 51 | Ga0123356_10152076 | 3300010049 | Bacteria | 2299 |
| 52 | Ga0466704_516670 | 3300042643 | Bacteria | 15577 |
| 53 | Ga0466709_215991 | 3300042648 | Bacteria | 21139 |
| 54 | Ga0466691_206892 | 3300042593 | Bacteria | 1461 |
| 55 | Ga0466699_016455 | 3300042597 | Bacteria | 1931 |
| 56 | Ga0466699_063437 | 3300042597 | Bacteria | 2002 |
| 57 | Ga0466699_206105 | 3300042597 | Bacteria | 17521 |
| 58 | Ga0466699_279854 | 3300042597 | Bacteria | 1277 |
| 59 | Ga0466699_377404 | 3300042597 | Bacteria | 4655 |
| 60 | Ga0466705_043169 | 3300042612 | Unclassified | 4255 |
| 61 | Ga0466717_298795 | 3300042604 | Bacteria | 2320 |
| 62 | Ga0466716_049147 | 3300042605 | Bacteria | 5649 |
| 63 | Ga0466719_558416 | 3300042606 | Bacteria | 5412 |
| 64 | Ga0466720_163762 | 3300042607 | Bacteria | 4527 |
| 65 | Ga0466722_057675 | 3300042609 | Bacteria | 6711 |
| 66 | Ga0466705_451984 | 3300042612 | Bacteria | 4514 |
| 67 | Ga0466715_544995 | 3300042616 | Unclassified | 2300 |
| 68 | Ga0466718_096800 | 3300042617 | Bacteria | 1114 |
| 69 | Ga0466728_378198 | 3300042620 | Bacteria | 5573 |
| 70 | Ga0123353_10069035 | 3300010167 | Bacteria | 5677 |
| 71 | Ga0466703_169222 | 3300042636 | Bacteria | 13947 |
| 72 | Ga0466704_224994 | 3300042643 | Bacteria | 18385 |
| 73 | Ga0466692_029602 | 3300042591 | Bacteria | 2698 |
| 74 | Ga0466692_053124 | 3300042591 | Bacteria | 1594 |
| 75 | Ga0466691_060750 | 3300042593 | Bacteria | 1063 |
| 76 | Ga0466691_092542 | 3300042593 | Unclassified | 1586 |
| 77 | Ga0466691_119848 | 3300042593 | Bacteria | 7578 |
| 78 | Ga0466699_121031 | 3300042597 | Bacteria | 18413 |
| 79 | Ga0466705_265325 | 3300042612 | Bacteria | 8671 |
| 80 | Ga0466720_138466 | 3300042607 | Bacteria | 6709 |
| 81 | Ga0466715_272912 | 3300042616 | Bacteria | 11530 |
| 82 | Ga0466718_015461 | 3300042617 | Bacteria | 17587 |
| 83 | Ga0466723_033228 | 3300042618 | Bacteria | 6127 |
| 84 | Ga0466723_116749 | 3300042618 | Bacteria | 7744 |
| 85 | Ga0466723_146614 | 3300042618 | Bacteria | 2019 |
| 86 | JGI24698J34947_10019192 | 3300002449 | Bacteria | 3691 |
| 87 | Ga0466704_018295 | 3300042643 | Unclassified | 2498 |
| 88 | Ga0466704_200948 | 3300042643 | Bacteria | 3518 |
| 89 | Ga0466727_053072 | 3300042655 | Bacteria | 2590 |
| 90 | Ga0466727_099351 | 3300042655 | Bacteria | 2834 |
| 91 | Ga0466727_298080 | 3300042655 | Bacteria | 2749 |
| 92 | Ga0466690_160933 | 3300042590 | Bacteria | 1872 |
| 93 | Ga0466690_268588 | 3300042590 | Bacteria | 1288 |
| 94 | Ga0466695_369580 | 3300042595 | Bacteria | 2647 |
| 95 | Ga0466699_026683 | 3300042597 | Bacteria | 3541 |
| 96 | Ga0466699_087979 | 3300042597 | Bacteria | 27209 |
| 97 | Ga0466719_334812 | 3300042606 | Bacteria | 5879 |
| 98 | Ga0466719_344297 | 3300042606 | Bacteria | 16203 |
| 99 | Ga0466720_109967 | 3300042607 | Bacteria | 6594 |
| 100 | Ga0466720_133652 | 3300042607 | Bacteria | 5139 |
| 101 | Ga0466722_137320 | 3300042609 | Bacteria | 12289 |
| 102 | Ga0466718_160482 | 3300042617 | Bacteria | 3155 |
| 103 | Ga0466723_313858 | 3300042618 | Bacteria | 3619 |
| 104 | Ga0072940_1057887 | 3300005200 | Bacteria | 1491 |
| 105 | Ga0466703_036217 | 3300042636 | Bacteria | 4391 |
| 106 | Ga0466727_233297 | 3300042655 | Bacteria | 1592 |
| 107 | Ga0466691_034439 | 3300042593 | Bacteria | 6097 |
| 108 | Ga0466694_179796 | 3300042594 | Bacteria | 1481 |
| 109 | Ga0466699_075353 | 3300042597 | Bacteria | 2393 |
| 110 | Ga0466699_256628 | 3300042597 | Bacteria | 11588 |
| 111 | Ga0466716_070813 | 3300042605 | Bacteria | 4095 |
| 112 | Ga0466716_294836 | 3300042605 | Bacteria | 1128 |
| 113 | Ga0466719_196170 | 3300042606 | Bacteria | 2841 |
| 114 | Ga0466698_328976 | 3300042610 | Bacteria | 3764 |
| 115 | Ga0466715_322516 | 3300042616 | Bacteria | 3209 |
| 116 | Ga0466715_554656 | 3300042616 | Bacteria | 1910 |
| 117 | AustNasuHG_c1000014 | 3300000089 | Bacteria | 40235 |
| 118 | Ga0466735_035964 | 3300042624 | Bacteria | 2929 |
| 119 | Ga0466735_051936 | 3300042624 | Bacteria | 4537 |
| 120 | Ga0466704_200207 | 3300042643 | Bacteria | 1410 |
| 121 | Ga0466692_112283 | 3300042591 | Bacteria | 17018 |
| 122 | Ga0466691_003750 | 3300042593 | Bacteria | 6261 |
| 123 | Ga0466696_311655 | 3300042596 | Bacteria | 9121 |
| 124 | Ga0466699_080027 | 3300042597 | Bacteria | 1349 |
| 125 | Ga0466699_243430 | 3300042597 | Bacteria | 7001 |
| 126 | Ga0466699_260724 | 3300042597 | Bacteria | 8699 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042597 | Ga0466699_063437 | Ga0466699_063437_861_1466 | 201 |
| 2 | 3300042597 | Ga0466699_243430 | Ga0466699_243430_1504_2109 | 201 |
| 3 | 3300042636 | Ga0466703_036217 | Ga0466703_036217_1506_2111 | 201 |
| 4 | 3300042656 | Ga0466732_049629 | Ga0466732_049629_11163_11768 | 201 |
| 5 | 3300042597 | Ga0466699_026683 | Ga0466699_026683_2218_2826 | 202 |
| 6 | 3300042597 | Ga0466699_039424 | Ga0466699_039424_3077_3685 | 202 |
| 7 | 3300042597 | Ga0466699_040827 | Ga0466699_040827_1202_1810 | 202 |
| 8 | 3300042597 | Ga0466699_087979 | Ga0466699_087979_25008_25616 | 202 |
| 9 | 3300042597 | Ga0466699_121031 | Ga0466699_121031_8602_9210 | 202 |
| 10 | 3300042597 | Ga0466699_206105 | Ga0466699_206105_2552_3160 | 202 |
| 11 | 3300042597 | Ga0466699_256628 | Ga0466699_256628_1575_2183 | 202 |
| 12 | 3300042597 | Ga0466699_260724 | Ga0466699_260724_6967_7575 | 202 |
| 13 | 3300042597 | Ga0466699_279854 | Ga0466699_279854_630_1238 | 202 |
| 14 | 3300042597 | Ga0466699_377404 | Ga0466699_377404_2472_3080 | 202 |
| 15 | 3300042607 | Ga0466720_039512 | Ga0466720_039512_5249_5857 | 202 |
| 16 | 3300042607 | Ga0466720_109967 | Ga0466720_109967_1975_2583 | 202 |
| 17 | 3300042607 | Ga0466720_133652 | Ga0466720_133652_4063_4671 | 202 |
| 18 | 3300042607 | Ga0466720_138466 | Ga0466720_138466_4260_4868 | 202 |
| 19 | 3300042607 | Ga0466720_140496 | Ga0466720_140496_1872_2480 | 202 |
| 20 | 3300042607 | Ga0466720_163762 | Ga0466720_163762_2769_3377 | 202 |
| 21 | 3300042608 | Ga0466721_014843 | Ga0466721_014843_406_1014 | 202 |
| 22 | 3300042612 | Ga0466705_481017 | Ga0466705_481017_160_768 | 202 |
| 23 | 3300042618 | Ga0466723_313858 | Ga0466723_313858_1303_1911 | 202 |
| 24 | 3300042619 | Ga0466726_281513 | Ga0466726_281513_271_879 | 202 |
| 25 | 3300042620 | Ga0466728_378198 | Ga0466728_378198_2113_2721 | 202 |
| 26 | 3300042636 | Ga0466703_339781 | Ga0466703_339781_725_1333 | 202 |
| 27 | 3300042643 | Ga0466704_224994 | Ga0466704_224994_2904_3512 | 202 |
| 28 | 3300042655 | Ga0466727_099351 | Ga0466727_099351_735_1343 | 202 |
| 29 | 3300005200 | Ga0072940_1057886 | Ga0072940_10578862 | 203 |
| 30 | 3300005200 | Ga0072940_1057887 | Ga0072940_10578872 | 203 |
| 31 | 3300042590 | Ga0466690_160933 | Ga0466690_160933_584_1195 | 203 |
| 32 | 3300042593 | Ga0466691_003750 | Ga0466691_003750_3059_3670 | 203 |
| 33 | 3300042593 | Ga0466691_060750 | Ga0466691_060750_155_766 | 203 |
| 34 | 3300042594 | Ga0466694_179796 | Ga0466694_179796_720_1331 | 203 |
| 35 | 3300042597 | Ga0466699_013441 | Ga0466699_013441_6899_7510 | 203 |
| 36 | 3300042597 | Ga0466699_016455 | Ga0466699_016455_612_1223 | 203 |
| 37 | 3300042597 | Ga0466699_075353 | Ga0466699_075353_1714_2325 | 203 |
| 38 | 3300042597 | Ga0466699_080027 | Ga0466699_080027_636_1247 | 203 |
| 39 | 3300042604 | Ga0466717_120153 | Ga0466717_120153_98_709 | 203 |
| 40 | 3300042604 | Ga0466717_298795 | Ga0466717_298795_744_1355 | 203 |
| 41 | 3300042605 | Ga0466716_294836 | Ga0466716_294836_56_667 | 203 |
| 42 | 3300042606 | Ga0466719_334812 | Ga0466719_334812_1110_1721 | 203 |
| 43 | 3300042606 | Ga0466719_558416 | Ga0466719_558416_638_1249 | 203 |
| 44 | 3300042609 | Ga0466722_137320 | Ga0466722_137320_10100_10711 | 203 |
| 45 | 3300042609 | Ga0466722_153640 | Ga0466722_153640_1770_2381 | 203 |
| 46 | 3300042612 | Ga0466705_265325 | Ga0466705_265325_4583_5194 | 203 |
| 47 | 3300042612 | Ga0466705_451984 | Ga0466705_451984_725_1336 | 203 |
| 48 | 3300042612 | Ga0466705_457060 | Ga0466705_457060_1065_1676 | 203 |
| 49 | 3300042616 | Ga0466715_040990 | Ga0466715_040990_681_1292 | 203 |
| 50 | 3300042616 | Ga0466715_544995 | Ga0466715_544995_849_1460 | 203 |
| 51 | 3300042618 | Ga0466723_146614 | Ga0466723_146614_446_1057 | 203 |
| 52 | 3300042620 | Ga0466728_132582 | Ga0466728_132582_1182_1793 | 203 |
| 53 | 3300042643 | Ga0466704_018295 | Ga0466704_018295_699_1310 | 203 |
| 54 | 3300042643 | Ga0466704_074758 | Ga0466704_074758_16114_16725 | 203 |
| 55 | 3300042643 | Ga0466704_200948 | Ga0466704_200948_55_666 | 203 |
| 56 | 3300042652 | Ga0466708_321737 | Ga0466708_321737_48525_49136 | 203 |
| 57 | 3300042655 | Ga0466727_053072 | Ga0466727_053072_160_771 | 203 |
| 58 | 3300042655 | Ga0466727_298080 | Ga0466727_298080_1234_1845 | 203 |
| 59 | 3300042656 | Ga0466732_180954 | Ga0466732_180954_215_826 | 203 |
| 60 | 3300042659 | Ga0466733_025515 | Ga0466733_025515_1474_2085 | 203 |
| 61 | 3300000089 | AustNasuHG_c1032959 | AustNasuHG_10329594 | 204 |
| 62 | 3300010049 | Ga0123356_10152076 | Ga0123356_101520762 | 204 |
| 63 | 3300042591 | Ga0466692_031579 | Ga0466692_031579_173_787 | 204 |
| 64 | 3300042605 | Ga0466716_255704 | Ga0466716_255704_4782_5396 | 204 |
| 65 | 3300042615 | Ga0466711_317824 | Ga0466711_317824_1296_1910 | 204 |
| 66 | 3300042617 | Ga0466718_015461 | Ga0466718_015461_8209_8823 | 204 |
| 67 | 3300042617 | Ga0466718_030894 | Ga0466718_030894_4551_5165 | 204 |
| 68 | 3300042617 | Ga0466718_096800 | Ga0466718_096800_427_1041 | 204 |
| 69 | 3300042618 | Ga0466723_116749 | Ga0466723_116749_6490_7104 | 204 |
| 70 | 3300042648 | Ga0466709_215991 | Ga0466709_215991_19300_19914 | 204 |
| 71 | 3300002450 | JGI24695J34938_10027516 | JGI24695J34938_100275162 | 205 |
| 72 | 3300042593 | Ga0466691_119848 | Ga0466691_119848_4450_5067 | 205 |
| 73 | 3300042599 | Ga0466706_204533 | Ga0466706_204533_131_748 | 205 |
| 74 | 3300042604 | Ga0466717_069633 | Ga0466717_069633_35_652 | 205 |
| 75 | 3300042606 | Ga0466719_344297 | Ga0466719_344297_9638_10255 | 205 |
| 76 | 3300042617 | Ga0466718_169569 | Ga0466718_169569_4559_5176 | 205 |
| 77 | 3300042591 | Ga0466692_112283 | Ga0466692_112283_8338_8958 | 206 |
| 78 | 3300042595 | Ga0466695_369580 | Ga0466695_369580_1590_2210 | 206 |
| 79 | 3300042596 | Ga0466696_311655 | Ga0466696_311655_2460_3080 | 206 |
| 80 | 3300042596 | Ga0466696_450427 | Ga0466696_450427_7040_7660 | 206 |
| 81 | 3300042616 | Ga0466715_048251 | Ga0466715_048251_60400_61020 | 206 |
| 82 | 3300042616 | Ga0466715_554656 | Ga0466715_554656_185_805 | 206 |
| 83 | 3300042617 | Ga0466718_160482 | Ga0466718_160482_1544_2164 | 206 |
| 84 | 3300042636 | Ga0466703_169222 | Ga0466703_169222_7689_8309 | 206 |
| 85 | 3300042655 | Ga0466727_233297 | Ga0466727_233297_686_1306 | 206 |
| 86 | 3300042593 | Ga0466691_034439 | Ga0466691_034439_1159_1782 | 207 |
| 87 | 3300042610 | Ga0466698_328976 | Ga0466698_328976_485_1108 | 207 |
| 88 | 3300042616 | Ga0466715_272912 | Ga0466715_272912_6193_6816 | 207 |
| 89 | 3300042618 | Ga0466723_033228 | Ga0466723_033228_590_1240 | 207 |
| 90 | 3300042619 | Ga0466726_188307 | Ga0466726_188307_805_1428 | 207 |
| 91 | 3300042624 | Ga0466735_035964 | Ga0466735_035964_290_913 | 207 |
| 92 | 3300042624 | Ga0466735_190260 | Ga0466735_190260_1298_1921 | 207 |
| 93 | 3300042655 | Ga0466727_214684 | Ga0466727_214684_1077_1700 | 207 |
| 94 | 3300002449 | JGI24698J34947_10019192 | JGI24698J34947_100191923 | 208 |
| 95 | 3300042593 | Ga0466691_092542 | Ga0466691_092542_120_770 | 208 |
| 96 | 3300042605 | Ga0466716_017079 | Ga0466716_017079_1185_1811 | 208 |
| 97 | 3300042606 | Ga0466719_334870 | Ga0466719_334870_472_1098 | 208 |
| 98 | 3300042609 | Ga0466722_060233 | Ga0466722_060233_13837_14463 | 208 |
| 99 | 3300042624 | Ga0466735_051936 | Ga0466735_051936_498_1124 | 208 |
| 100 | 3300005201 | Ga0072941_1020576 | Ga0072941_10205767 | 209 |
| 101 | 3300042612 | Ga0466705_043169 | Ga0466705_043169_2071_2700 | 209 |
| 102 | 3300042612 | Ga0466705_164032 | Ga0466705_164032_1532_2161 | 209 |
| 103 | 3300042616 | Ga0466715_322516 | Ga0466715_322516_323_985 | 209 |
| 104 | 3300010167 | Ga0123353_10069035 | Ga0123353_100690353 | 210 |
| 105 | 3300042591 | Ga0466692_029602 | Ga0466692_029602_908_1540 | 210 |
| 106 | 3300042605 | Ga0466716_049147 | Ga0466716_049147_1831_2463 | 210 |
| 107 | 3300042636 | Ga0466703_006326 | Ga0466703_006326_33025_33657 | 210 |
| 108 | 3300042606 | Ga0466719_379466 | Ga0466719_379466_248_886 | 212 |
| 109 | 3300042643 | Ga0466704_200207 | Ga0466704_200207_701_1339 | 212 |
| 110 | 3300042594 | Ga0466694_227745 | Ga0466694_227745_875_1516 | 213 |
| 111 | 3300042618 | Ga0466723_133301 | Ga0466723_133301_2561_3256 | 213 |
| 112 | 3300042593 | Ga0466691_032753 | Ga0466691_032753_463_1107 | 214 |
| 113 | 3300042596 | Ga0466696_327363 | Ga0466696_327363_197_913 | 214 |
| 114 | 3300042652 | Ga0466708_063315 | Ga0466708_063315_608_1252 | 214 |
| 115 | 3300042590 | Ga0466690_084144 | Ga0466690_084144_1181_1831 | 216 |
| 116 | 3300042593 | Ga0466691_206892 | Ga0466691_206892_189_842 | 217 |
| 117 | 3300042643 | Ga0466704_516670 | Ga0466704_516670_1393_2046 | 217 |
| 118 | 3300042590 | Ga0466690_268588 | Ga0466690_268588_101_763 | 220 |
| 119 | 3300042605 | Ga0466716_070813 | Ga0466716_070813_1103_1765 | 220 |
| 120 | 3300042609 | Ga0466722_057675 | Ga0466722_057675_1224_1886 | 220 |
| 121 | 3300042636 | Ga0466703_028393 | Ga0466703_028393_563_1279 | 220 |
| 122 | 3300042591 | Ga0466692_053124 | Ga0466692_053124_60_731 | 223 |
| 123 | iso_pr_bacteria | 2781125630 | 2781267482 | 226 |
| 124 | 3300002504 | JGI24705J35276_12052505 | JGI24705J35276_120525051 | 227 |
| 125 | 3300042619 | Ga0466726_435129 | Ga0466726_435129_134_895 | 230 |
| 126 | 3300000089 | AustNasuHG_c1000014 | AustNasuHG_100001433 | 240 |
| 127 | 3300042606 | Ga0466719_196170 | Ga0466719_196170_910_1665 | 251 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r1a-assembly2.cif.gz_H | Crystal structure of the periplasmic lipopolysaccharide transport protein LptA (YhbN), trigonal form | 0.906 | 100 | 218 |
| 4uu4-assembly1.cif.gz_A | Crystal structure of LptH, the LptA homologous periplasmic component of the conserved lipopolysaccharide transport device from Pseudomonas aeruginosa | 0.894 | 98 | 220 |
| 2r1a-assembly2.cif.gz_E | Crystal structure of the periplasmic lipopolysaccharide transport protein LptA (YhbN), trigonal form | 0.863 | 100 | 216 |
| 8gak-assembly1.cif.gz_A | Crystal Structure of E. coli LptA in complex with Chinavia Ubica Thanatin | 0.848 | 134 | 220 |
| 7zax-assembly1.cif.gz_A | Solution structure of thanatin-like derivative 7 in complex with K. pneumoniae LptA | 0.833 | 98 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r1aH00 | Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain | 0.906 | 100 | 218 | 2.60.450.10 |
| 4uu4A00 | Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain | 0.8939 | 98 | 220 | 2.60.450.10 |
| 3my2A00 | Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain | 0.7982 | 103 | 217 | 2.60.450.10 |
| af_P31554_47_205_2.60.450.10 | Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain | 0.7873 | 56 | 218 | 2.60.450.10 |
| af_Q8MLN3_148_217_2.20.110.10 | Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain | 0.7263 | 102 | 139 | 2.20.110.10 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.65 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.