Protein Family IF09082

Metagenome Isolate
153 Members
64 Samples
141 Scaffolds
130.94 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_012461|Ga0466703_012461_281_754
Length
157 aa
Sequence
MVLTFFIHFNNKQQIDIAKITNKFKDMDKIKSLADLKKKRDELKANMSLREDGDNADQVVQIKVAMSTCGIASGAKPVMDALIESCSSLNIRAVVTQTGCMGYCYAEPTVEITKPGQEPIVFGYVTVEKAKNLVEKYIVNNEILEGVIPHSYQSIDN

πŸ“Š Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 42.6%
Kalotermitidae 23.0%
Unclassified 23.0%
Rhinotermitidae 3.3%
Passalidae 3.3%
Hodotermitidae 1.6%
Blattidae 1.6%
Termopsidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
28 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
38 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
39 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
40 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
46 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
48 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
55 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
56 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
57 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
58 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
60 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
63 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
64 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_192079 3300042659 Bacteria 1401
2 Ga0466705_515646 3300042612 Bacteria 5410
3 Ga0123353_10048308 3300010167 Bacteria 6775
4 Ga0123353_10207444 3300010167 Bacteria 3077
5 Ga0123353_10293904 3300010167 Bacteria 2485
6 Ga0123353_10294602 3300010167 Bacteria 2481
7 Ga0123353_10738146 3300010167 Bacteria 1373
8 Ga0123353_10946804 3300010167 Bacteria 1165
9 Ga0123354_10337929 3300010882 Bacteria 1362
10 Ga0123354_10473616 3300010882 Bacteria 996
11 Ga0466702_401637 3300042635 Bacteria 2136
12 Ga0466708_393213 3300042652 Bacteria 15609
13 IMNBL1DRAFT_c0049240 3300000062 Bacteria 1345
14 JGI24702J35022_10000267 3300002462 Bacteria 30031
15 JGI24699J35502_10879147 3300002509 Bacteria 1005
16 Ga0466694_331267 3300042594 Bacteria 2243
17 Ga0466694_390050 3300042594 Bacteria 3275
18 Ga0466713_149502 3300042602 Bacteria 31162
19 Ga0466720_058763 3300042607 Bacteria 1662
20 Ga0466718_098844 3300042617 Bacteria 1426
21 Ga0466723_101863 3300042618 Bacteria 35831
22 Ga0123356_11309607 3300010049 Bacteria 887
23 Ga0123353_10001306 3300010167 Bacteria 30511
24 Ga0123354_10221239 3300010882 Bacteria 2010
25 Ga0466731_320360 3300042622 Bacteria 32587
26 Ga0466724_58953 3300042649 Bacteria 1081
27 IMNBL1DRAFT_c0009153 3300000062 Unclassified 4934
28 IMNBL1DRAFT_c0038213 3300000062 Bacteria 1653
29 FAAS_10615769 3300001880 Bacteria 546
30 Ga0466694_154103 3300042594 Bacteria 1042
31 Ga0466696_127620 3300042596 Bacteria 11807
32 Ga0466706_012634 3300042599 Bacteria 153886
33 Ga0466700_191494 3300042600 Bacteria 1438
34 Ga0466707_135441 3300042601 Bacteria 11161
35 Ga0466707_248325 3300042601 Bacteria 5976
36 Ga0466714_003150 3300042603 Bacteria 1102
37 Ga0466716_101861 3300042605 Bacteria 9983
38 Ga0466719_478715 3300042606 Bacteria 1681
39 Ga0466732_344547 3300042656 Bacteria 4747
40 Ga0123356_10003573 3300010049 Bacteria 16250
41 Ga0123356_10247701 3300010049 Bacteria 1857
42 Ga0123353_10000053 3300010167 Bacteria 130089
43 Ga0123353_10343160 3300010167 Unclassified 2255
44 Ga0123354_10200591 3300010882 Bacteria 2195
45 Ga0466729_300116 3300042621 Bacteria 1335
46 Ga0466703_085452 3300042636 Bacteria 5214
47 Ga0466724_03661 3300042649 Bacteria 3319
48 Ga0072941_1730711 3300005201 Unclassified 704
49 Ga0265387_1008250 3300024582 Bacteria 1399
50 Ga0466693_146115 3300042592 Bacteria 4177
51 Ga0466693_435207 3300042592 Bacteria 1353
52 Ga0466691_088613 3300042593 Bacteria 13196
53 Ga0466694_365523 3300042594 Unclassified 1214
54 Ga0466696_483911 3300042596 Bacteria 15522
55 Ga0466699_179041 3300042597 Bacteria 2568
56 Ga0466713_133014 3300042602 Bacteria 13295
57 Ga0466719_467633 3300042606 Bacteria 1599
58 Ga0466698_037406 3300042610 Bacteria 1633
59 Ga0466733_124286 3300042659 Bacteria 33275
60 Ga0466733_152570 3300042659 Bacteria 60084
61 Ga0466711_360476 3300042615 Bacteria 8481
62 Ga0466723_233013 3300042618 Bacteria 5736
63 Ga0466729_253199 3300042621 Bacteria 4178
64 Ga0466704_278504 3300042643 Bacteria 29381
65 Ga0466709_132170 3300042648 Bacteria 17289
66 2227540745 2225789004 Unclassified 2994
67 IMNBL1DRAFT_c0007678 3300000062 Unclassified 5627
68 JGI24698J34947_10190016 3300002449 Bacteria 813
69 Ga0466657_118705 3300042582 Bacteria 8646
70 Ga0466690_204901 3300042590 Bacteria 5415
71 Ga0466694_402829 3300042594 Bacteria 1465
72 Ga0466706_152064 3300042599 Bacteria 39646
73 Ga0466714_124442 3300042603 Bacteria 4377
74 Ga0466698_089917 3300042610 Bacteria 2322
75 Ga0466705_226291 3300042612 Bacteria 5701
76 Ga0466710_020279 3300042613 Bacteria 6296
77 Ga0466715_140613 3300042616 Bacteria 6123
78 Ga0123356_11018851 3300010049 Unclassified 998
79 Ga0123356_12214583 3300010049 Bacteria 687
80 Ga0123353_10004001 3300010167 Bacteria 18870
81 Ga0123353_10448320 3300010167 Bacteria 1901
82 Ga0123354_10150703 3300010882 Bacteria 2819
83 Ga0466731_120935 3300042622 Bacteria 1353
84 Ga0466709_190200 3300042648 Bacteria 25612
85 Ga0466724_48278 3300042649 Bacteria 1722
86 IMNBL1DRAFT_c0027880 3300000062 Unclassified 2116
87 IMNBL1DRAFT_c0030928 3300000062 Bacteria 1954
88 Ga0466657_125058 3300042582 Unclassified 5886
89 Ga0466695_284886 3300042595 Unclassified 8739
90 Ga0466696_244380 3300042596 Bacteria 4440
91 Ga0466697_024197 3300042611 Bacteria 1054
92 Ga0466710_107009 3300042613 Bacteria 1413
93 Ga0466729_171987 3300042621 Bacteria 1659
94 Ga0123356_10011880 3300010049 Bacteria 8476
95 Ga0123353_10431642 3300010167 Unclassified 1948
96 Ga0466731_431444 3300042622 Bacteria 1268
97 Ga0466703_012461 3300042636 Bacteria 5780
98 Ga0466724_50291 3300042649 Bacteria 3122
99 Ga0466725_458067 3300042654 Bacteria 10039
100 IMNBL1DRAFT_c0000077 3300000062 Bacteria 88150
101 IMNBL1DRAFT_c0045228 3300000062 Bacteria 1439
102 JGI24702J35022_10101831 3300002462 Bacteria 1573
103 JGI24702J35022_10659832 3300002462 Bacteria 649
104 Ga0466696_136045 3300042596 Bacteria 1201
105 Ga0466696_410853 3300042596 Bacteria 7401
106 Ga0466701_005835 3300042598 Bacteria 2179
107 Ga0466701_027442 3300042598 Bacteria 43852
108 Ga0466707_353989 3300042601 Bacteria 10261
109 Ga0466722_230574 3300042609 Bacteria 3320
110 Ga0466698_148947 3300042610 Bacteria 2088
111 Ga0466732_189145 3300042656 Bacteria 4886
112 Ga0466733_144653 3300042659 Bacteria 6837
113 Ga0466708_278902 3300042652 Bacteria 28854
114 2227221385 2225789004 Bacteria 1388
115 2227480171 2225789004 Bacteria 93917
116 JGI24698J34947_10082215 3300002449 Bacteria 1506
117 JGI24702J35022_10040906 3300002462 Bacteria 2472
118 Ga0072941_1596178 3300005201 Bacteria 704
119 Ga0466690_102871 3300042590 Bacteria 10931
120 Ga0466714_002912 3300042603 Bacteria 31802
121 Ga0466714_131484 3300042603 Bacteria 2770
122 Ga0466698_398492 3300042610 Bacteria 6371
123 Ga0466697_105795 3300042611 Bacteria 8965
124 Ga0466733_182431 3300042659 Bacteria 2974
125 Ga0466733_193715 3300042659 Bacteria 1163
126 Ga0466733_218589 3300042659 Bacteria 4973
127 Ga0466712_111729 3300042614 Unclassified 1403
128 Ga0466726_026365 3300042619 Bacteria 7869
129 Ga0466728_113815 3300042620 Bacteria 10677
130 2227080801 2225789004 Bacteria 40926
131 JGI24702J35022_10002483 3300002462 Bacteria 11260
132 Ga0068305_10006033 3300005083 Bacteria 8266
133 Ga0466657_350354 3300042582 Bacteria 1267
134 Ga0466701_041932 3300042598 Bacteria 42746
135 Ga0466701_067433 3300042598 Bacteria 4931
136 Ga0466706_057169 3300042599 Bacteria 13233
137 Ga0466706_284939 3300042599 Bacteria 31061
138 Ga0466700_263055 3300042600 Bacteria 1264
139 Ga0466713_117396 3300042602 Bacteria 36879
140 Ga0466698_210077 3300042610 Bacteria 2608
141 Ga0466697_027697 3300042611 Bacteria 8522

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042595 Ga0466695_284886 Ga0466695_284886_6121_6522 109
2 3300010167 Ga0123353_10343160 Ga0123353_103431602 111
3 3300010167 Ga0123353_10448320 Ga0123353_104483203 112
4 3300042602 Ga0466713_117396 Ga0466713_117396_4600_4980 126
5 3300042598 Ga0466701_027442 Ga0466701_027442_3296_3679 127
6 3300042598 Ga0466701_041932 Ga0466701_041932_7420_7803 127
7 3300042611 Ga0466697_024197 Ga0466697_024197_348_731 127
8 3300042613 Ga0466710_020279 Ga0466710_020279_5629_6012 127
9 3300042613 Ga0466710_107009 Ga0466710_107009_750_1133 127
10 3300042635 Ga0466702_401637 Ga0466702_401637_338_721 127
11 3300042649 Ga0466724_03661 Ga0466724_03661_2262_2645 127
12 3300042649 Ga0466724_48278 Ga0466724_48278_450_833 127
13 3300042649 Ga0466724_50291 Ga0466724_50291_1414_1797 127
14 3300042649 Ga0466724_58953 Ga0466724_58953_236_619 127
15 3300042656 Ga0466732_189145 Ga0466732_189145_447_830 127
16 iso_pr_bacteria 2820735654 2820735688 127
17 3300002462 JGI24702J35022_10000267 JGI24702J35022_1000026710 128
18 3300002462 JGI24702J35022_10040906 JGI24702J35022_100409063 128
19 3300002462 JGI24702J35022_10101831 JGI24702J35022_101018313 128
20 3300002462 JGI24702J35022_10659832 JGI24702J35022_106598322 128
21 3300042594 Ga0466694_331267 Ga0466694_331267_1431_1817 128
22 3300042596 Ga0466696_410853 Ga0466696_410853_79_465 128
23 3300042598 Ga0466701_005835 Ga0466701_005835_1282_1668 128
24 3300010049 Ga0123356_10011880 Ga0123356_100118808 129
25 3300010049 Ga0123356_12214583 Ga0123356_122145832 129
26 3300010167 Ga0123353_10001306 Ga0123353_1000130616 129
27 3300010167 Ga0123353_10004001 Ga0123353_1000400118 129
28 3300010167 Ga0123353_10048308 Ga0123353_100483087 129
29 3300010167 Ga0123353_10738146 Ga0123353_107381462 129
30 3300010882 Ga0123354_10150703 Ga0123354_101507032 129
31 3300042590 Ga0466690_102871 Ga0466690_102871_5904_6293 129
32 3300042596 Ga0466696_127620 Ga0466696_127620_220_609 129
33 3300042605 Ga0466716_101861 Ga0466716_101861_949_1338 129
34 3300042606 Ga0466719_467633 Ga0466719_467633_997_1386 129
35 3300042611 Ga0466697_105795 Ga0466697_105795_5458_5847 129
36 3300042614 Ga0466712_111729 Ga0466712_111729_168_557 129
37 3300042618 Ga0466723_101863 Ga0466723_101863_21901_22290 129
38 3300042621 Ga0466729_171987 Ga0466729_171987_44_433 129
39 3300042652 Ga0466708_278902 Ga0466708_278902_22601_22990 129
40 iso_pr_bacteria 2820736622 2820737374 129
41 3300000062 IMNBL1DRAFT_c0049240 IMNBL1DRAFT_00492402 130
42 3300002462 JGI24702J35022_10002483 JGI24702J35022_100024835 130
43 3300010049 Ga0123356_10247701 Ga0123356_102477012 130
44 3300010167 Ga0123353_10207444 Ga0123353_102074442 130
45 3300010167 Ga0123353_10294602 Ga0123353_102946022 130
46 3300042599 Ga0466706_152064 Ga0466706_152064_11262_11654 130
47 3300042601 Ga0466707_135441 Ga0466707_135441_9728_10120 130
48 3300042603 Ga0466714_124442 Ga0466714_124442_1443_1835 130
49 3300042648 Ga0466709_190200 Ga0466709_190200_15042_15434 130
50 3300042659 Ga0466733_152570 Ga0466733_152570_40578_40970 130
51 3300042659 Ga0466733_192079 Ga0466733_192079_211_603 130
52 2225789004 2227080801 2227454463 131
53 3300002449 JGI24698J34947_10082215 JGI24698J34947_100822152 131
54 3300005201 Ga0072941_1596178 Ga0072941_15961782 131
55 3300010049 Ga0123356_11309607 Ga0123356_113096072 131
56 3300042582 Ga0466657_125058 Ga0466657_125058_1475_1870 131
57 3300042590 Ga0466690_204901 Ga0466690_204901_4947_5342 131
58 3300042593 Ga0466691_088613 Ga0466691_088613_7085_7480 131
59 3300042594 Ga0466694_154103 Ga0466694_154103_176_571 131
60 3300042594 Ga0466694_365523 Ga0466694_365523_605_1000 131
61 3300042594 Ga0466694_390050 Ga0466694_390050_1842_2237 131
62 3300042596 Ga0466696_244380 Ga0466696_244380_4016_4411 131
63 3300042598 Ga0466701_067433 Ga0466701_067433_2662_3057 131
64 3300042599 Ga0466706_012634 Ga0466706_012634_15692_16087 131
65 3300042600 Ga0466700_191494 Ga0466700_191494_145_540 131
66 3300042601 Ga0466707_353989 Ga0466707_353989_458_853 131
67 3300042602 Ga0466713_133014 Ga0466713_133014_8661_9056 131
68 3300042602 Ga0466713_149502 Ga0466713_149502_4919_5314 131
69 3300042603 Ga0466714_003150 Ga0466714_003150_683_1078 131
70 3300042603 Ga0466714_131484 Ga0466714_131484_352_747 131
71 3300042606 Ga0466719_478715 Ga0466719_478715_689_1084 131
72 3300042610 Ga0466698_089917 Ga0466698_089917_372_767 131
73 3300042610 Ga0466698_210077 Ga0466698_210077_1902_2297 131
74 3300042611 Ga0466697_027697 Ga0466697_027697_3821_4216 131
75 3300042615 Ga0466711_360476 Ga0466711_360476_7149_7544 131
76 3300042616 Ga0466715_140613 Ga0466715_140613_5693_6088 131
77 3300042617 Ga0466718_098844 Ga0466718_098844_659_1054 131
78 3300042618 Ga0466723_233013 Ga0466723_233013_218_613 131
79 3300042619 Ga0466726_026365 Ga0466726_026365_2614_3009 131
80 3300042620 Ga0466728_113815 Ga0466728_113815_5773_6168 131
81 3300042621 Ga0466729_253199 Ga0466729_253199_1017_1412 131
82 3300042622 Ga0466731_120935 Ga0466731_120935_132_527 131
83 3300042622 Ga0466731_320360 Ga0466731_320360_11821_12216 131
84 3300042622 Ga0466731_431444 Ga0466731_431444_132_527 131
85 3300042636 Ga0466703_085452 Ga0466703_085452_346_741 131
86 3300042643 Ga0466704_278504 Ga0466704_278504_27013_27408 131
87 3300042652 Ga0466708_393213 Ga0466708_393213_4662_5057 131
88 3300042659 Ga0466733_193715 Ga0466733_193715_189_584 131
89 iso_pr_bacteria 2820753519 2820753773 131
90 iso_pr_bacteria 2820755292 2820757215 131
91 iso_pr_bacteria 2820783511 2820784467 131
92 iso_pr_bacteria 2820792843 2820794288 131
93 iso_pr_bacteria 2820795054 2820797000 131
94 iso_pr_bacteria 2820797595 2820798063 131
95 3300000062 IMNBL1DRAFT_c0000077 IMNBL1DRAFT_000007733 132
96 3300000062 IMNBL1DRAFT_c0009153 IMNBL1DRAFT_00091532 132
97 3300000062 IMNBL1DRAFT_c0030928 IMNBL1DRAFT_00309281 132
98 3300000062 IMNBL1DRAFT_c0045228 IMNBL1DRAFT_00452281 132
99 3300002509 JGI24699J35502_10879147 JGI24699J35502_108791471 132
100 3300005083 Ga0068305_10006033 Ga0068305_100060336 132
101 3300005201 Ga0072941_1730711 Ga0072941_17307111 132
102 3300010049 Ga0123356_10003573 Ga0123356_100035739 132
103 3300010049 Ga0123356_11018851 Ga0123356_110188512 132
104 3300010167 Ga0123353_10431642 Ga0123353_104316422 132
105 3300010167 Ga0123353_10946804 Ga0123353_109468041 132
106 3300010882 Ga0123354_10200591 Ga0123354_102005914 132
107 3300010882 Ga0123354_10337929 Ga0123354_103379292 132
108 3300024582 Ga0265387_1008250 Ga0265387_10082502 132
109 3300042582 Ga0466657_118705 Ga0466657_118705_3118_3516 132
110 3300042582 Ga0466657_350354 Ga0466657_350354_720_1118 132
111 3300042592 Ga0466693_435207 Ga0466693_435207_765_1163 132
112 3300042594 Ga0466694_402829 Ga0466694_402829_1030_1428 132
113 3300042597 Ga0466699_179041 Ga0466699_179041_1664_2062 132
114 3300042599 Ga0466706_284939 Ga0466706_284939_23768_24166 132
115 3300042600 Ga0466700_263055 Ga0466700_263055_834_1232 132
116 3300042601 Ga0466707_248325 Ga0466707_248325_269_667 132
117 3300042607 Ga0466720_058763 Ga0466720_058763_614_1012 132
118 3300042609 Ga0466722_230574 Ga0466722_230574_2417_2815 132
119 3300042610 Ga0466698_037406 Ga0466698_037406_641_1039 132
120 3300042610 Ga0466698_148947 Ga0466698_148947_1055_1453 132
121 3300042610 Ga0466698_398492 Ga0466698_398492_5841_6239 132
122 3300042612 Ga0466705_226291 Ga0466705_226291_3069_3467 132
123 3300042621 Ga0466729_300116 Ga0466729_300116_350_748 132
124 3300042656 Ga0466732_344547 Ga0466732_344547_246_644 132
125 3300042659 Ga0466733_124286 Ga0466733_124286_26024_26422 132
126 3300042659 Ga0466733_144653 Ga0466733_144653_3589_3987 132
127 3300042659 Ga0466733_182431 Ga0466733_182431_20_418 132
128 3300042659 Ga0466733_218589 Ga0466733_218589_281_679 132
129 iso_pr_bacteria 2820741847 2820744207 132
130 iso_pr_bacteria 2820768849 2820769993 132
131 iso_pr_bacteria 2820774381 2820775199 132
132 iso_pr_bacteria 2940195863 2940196811 132
133 2225789004 2227221385 2227654478 133
134 2225789004 2227480171 2227937966 133
135 2225789004 2227540745 2228062088 133
136 3300001880 FAAS_10615769 FAAS_106157692 133
137 3300002449 JGI24698J34947_10190016 JGI24698J34947_101900162 133
138 3300010167 Ga0123353_10000053 Ga0123353_1000005372 133
139 3300010882 Ga0123354_10221239 Ga0123354_102212393 133
140 3300010882 Ga0123354_10473616 Ga0123354_104736161 133
141 3300042592 Ga0466693_146115 Ga0466693_146115_282_683 133
142 3300042596 Ga0466696_483911 Ga0466696_483911_239_640 133
143 3300042599 Ga0466706_057169 Ga0466706_057169_10162_10563 133
144 3300042603 Ga0466714_002912 Ga0466714_002912_30646_31047 133
145 3300042612 Ga0466705_515646 Ga0466705_515646_4177_4578 133
146 3300042654 Ga0466725_458067 Ga0466725_458067_7576_7977 133
147 3300000062 IMNBL1DRAFT_c0007678 IMNBL1DRAFT_00076783 134
148 3300000062 IMNBL1DRAFT_c0038213 IMNBL1DRAFT_00382132 134
149 3300000062 IMNBL1DRAFT_c0027880 IMNBL1DRAFT_00278803 145
150 3300010167 Ga0123353_10293904 Ga0123353_102939043 147
151 3300042596 Ga0466696_136045 Ga0466696_136045_691_1149 152
152 3300042648 Ga0466709_132170 Ga0466709_132170_15294_15755 153
153 3300042636 Ga0466703_012461 Ga0466703_012461_281_754 157

🧩 MSA Aligner

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.