Protein Family IF09082
Metagenome
Isolate
153
Members
64
Samples
141
Scaffolds
130.94
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_012461|Ga0466703_012461_281_754
- Length
- 157 aa
- Sequence
- MVLTFFIHFNNKQQIDIAKITNKFKDMDKIKSLADLKKKRDELKANMSLREDGDNADQVVQIKVAMSTCGIASGAKPVMDALIESCSSLNIRAVVTQTGCMGYCYAEPTVEITKPGQEPIVFGYVTVEKAKNLVEKYIVNNEILEGVIPHSYQSIDN
Sample Types
Isolate
7.8%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.6%
Kalotermitidae
23.0%
Unclassified
23.0%
Rhinotermitidae
3.3%
Passalidae
3.3%
Hodotermitidae
1.6%
Blattidae
1.6%
Termopsidae
1.6%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 38 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 39 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 40 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 49 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 56 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 57 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 58 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 64 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_192079 | 3300042659 | Bacteria | 1401 |
| 2 | Ga0466705_515646 | 3300042612 | Bacteria | 5410 |
| 3 | Ga0123353_10048308 | 3300010167 | Bacteria | 6775 |
| 4 | Ga0123353_10207444 | 3300010167 | Bacteria | 3077 |
| 5 | Ga0123353_10293904 | 3300010167 | Bacteria | 2485 |
| 6 | Ga0123353_10294602 | 3300010167 | Bacteria | 2481 |
| 7 | Ga0123353_10738146 | 3300010167 | Bacteria | 1373 |
| 8 | Ga0123353_10946804 | 3300010167 | Bacteria | 1165 |
| 9 | Ga0123354_10337929 | 3300010882 | Bacteria | 1362 |
| 10 | Ga0123354_10473616 | 3300010882 | Bacteria | 996 |
| 11 | Ga0466702_401637 | 3300042635 | Bacteria | 2136 |
| 12 | Ga0466708_393213 | 3300042652 | Bacteria | 15609 |
| 13 | IMNBL1DRAFT_c0049240 | 3300000062 | Bacteria | 1345 |
| 14 | JGI24702J35022_10000267 | 3300002462 | Bacteria | 30031 |
| 15 | JGI24699J35502_10879147 | 3300002509 | Bacteria | 1005 |
| 16 | Ga0466694_331267 | 3300042594 | Bacteria | 2243 |
| 17 | Ga0466694_390050 | 3300042594 | Bacteria | 3275 |
| 18 | Ga0466713_149502 | 3300042602 | Bacteria | 31162 |
| 19 | Ga0466720_058763 | 3300042607 | Bacteria | 1662 |
| 20 | Ga0466718_098844 | 3300042617 | Bacteria | 1426 |
| 21 | Ga0466723_101863 | 3300042618 | Bacteria | 35831 |
| 22 | Ga0123356_11309607 | 3300010049 | Bacteria | 887 |
| 23 | Ga0123353_10001306 | 3300010167 | Bacteria | 30511 |
| 24 | Ga0123354_10221239 | 3300010882 | Bacteria | 2010 |
| 25 | Ga0466731_320360 | 3300042622 | Bacteria | 32587 |
| 26 | Ga0466724_58953 | 3300042649 | Bacteria | 1081 |
| 27 | IMNBL1DRAFT_c0009153 | 3300000062 | Unclassified | 4934 |
| 28 | IMNBL1DRAFT_c0038213 | 3300000062 | Bacteria | 1653 |
| 29 | FAAS_10615769 | 3300001880 | Bacteria | 546 |
| 30 | Ga0466694_154103 | 3300042594 | Bacteria | 1042 |
| 31 | Ga0466696_127620 | 3300042596 | Bacteria | 11807 |
| 32 | Ga0466706_012634 | 3300042599 | Bacteria | 153886 |
| 33 | Ga0466700_191494 | 3300042600 | Bacteria | 1438 |
| 34 | Ga0466707_135441 | 3300042601 | Bacteria | 11161 |
| 35 | Ga0466707_248325 | 3300042601 | Bacteria | 5976 |
| 36 | Ga0466714_003150 | 3300042603 | Bacteria | 1102 |
| 37 | Ga0466716_101861 | 3300042605 | Bacteria | 9983 |
| 38 | Ga0466719_478715 | 3300042606 | Bacteria | 1681 |
| 39 | Ga0466732_344547 | 3300042656 | Bacteria | 4747 |
| 40 | Ga0123356_10003573 | 3300010049 | Bacteria | 16250 |
| 41 | Ga0123356_10247701 | 3300010049 | Bacteria | 1857 |
| 42 | Ga0123353_10000053 | 3300010167 | Bacteria | 130089 |
| 43 | Ga0123353_10343160 | 3300010167 | Unclassified | 2255 |
| 44 | Ga0123354_10200591 | 3300010882 | Bacteria | 2195 |
| 45 | Ga0466729_300116 | 3300042621 | Bacteria | 1335 |
| 46 | Ga0466703_085452 | 3300042636 | Bacteria | 5214 |
| 47 | Ga0466724_03661 | 3300042649 | Bacteria | 3319 |
| 48 | Ga0072941_1730711 | 3300005201 | Unclassified | 704 |
| 49 | Ga0265387_1008250 | 3300024582 | Bacteria | 1399 |
| 50 | Ga0466693_146115 | 3300042592 | Bacteria | 4177 |
| 51 | Ga0466693_435207 | 3300042592 | Bacteria | 1353 |
| 52 | Ga0466691_088613 | 3300042593 | Bacteria | 13196 |
| 53 | Ga0466694_365523 | 3300042594 | Unclassified | 1214 |
| 54 | Ga0466696_483911 | 3300042596 | Bacteria | 15522 |
| 55 | Ga0466699_179041 | 3300042597 | Bacteria | 2568 |
| 56 | Ga0466713_133014 | 3300042602 | Bacteria | 13295 |
| 57 | Ga0466719_467633 | 3300042606 | Bacteria | 1599 |
| 58 | Ga0466698_037406 | 3300042610 | Bacteria | 1633 |
| 59 | Ga0466733_124286 | 3300042659 | Bacteria | 33275 |
| 60 | Ga0466733_152570 | 3300042659 | Bacteria | 60084 |
| 61 | Ga0466711_360476 | 3300042615 | Bacteria | 8481 |
| 62 | Ga0466723_233013 | 3300042618 | Bacteria | 5736 |
| 63 | Ga0466729_253199 | 3300042621 | Bacteria | 4178 |
| 64 | Ga0466704_278504 | 3300042643 | Bacteria | 29381 |
| 65 | Ga0466709_132170 | 3300042648 | Bacteria | 17289 |
| 66 | 2227540745 | 2225789004 | Unclassified | 2994 |
| 67 | IMNBL1DRAFT_c0007678 | 3300000062 | Unclassified | 5627 |
| 68 | JGI24698J34947_10190016 | 3300002449 | Bacteria | 813 |
| 69 | Ga0466657_118705 | 3300042582 | Bacteria | 8646 |
| 70 | Ga0466690_204901 | 3300042590 | Bacteria | 5415 |
| 71 | Ga0466694_402829 | 3300042594 | Bacteria | 1465 |
| 72 | Ga0466706_152064 | 3300042599 | Bacteria | 39646 |
| 73 | Ga0466714_124442 | 3300042603 | Bacteria | 4377 |
| 74 | Ga0466698_089917 | 3300042610 | Bacteria | 2322 |
| 75 | Ga0466705_226291 | 3300042612 | Bacteria | 5701 |
| 76 | Ga0466710_020279 | 3300042613 | Bacteria | 6296 |
| 77 | Ga0466715_140613 | 3300042616 | Bacteria | 6123 |
| 78 | Ga0123356_11018851 | 3300010049 | Unclassified | 998 |
| 79 | Ga0123356_12214583 | 3300010049 | Bacteria | 687 |
| 80 | Ga0123353_10004001 | 3300010167 | Bacteria | 18870 |
| 81 | Ga0123353_10448320 | 3300010167 | Bacteria | 1901 |
| 82 | Ga0123354_10150703 | 3300010882 | Bacteria | 2819 |
| 83 | Ga0466731_120935 | 3300042622 | Bacteria | 1353 |
| 84 | Ga0466709_190200 | 3300042648 | Bacteria | 25612 |
| 85 | Ga0466724_48278 | 3300042649 | Bacteria | 1722 |
| 86 | IMNBL1DRAFT_c0027880 | 3300000062 | Unclassified | 2116 |
| 87 | IMNBL1DRAFT_c0030928 | 3300000062 | Bacteria | 1954 |
| 88 | Ga0466657_125058 | 3300042582 | Unclassified | 5886 |
| 89 | Ga0466695_284886 | 3300042595 | Unclassified | 8739 |
| 90 | Ga0466696_244380 | 3300042596 | Bacteria | 4440 |
| 91 | Ga0466697_024197 | 3300042611 | Bacteria | 1054 |
| 92 | Ga0466710_107009 | 3300042613 | Bacteria | 1413 |
| 93 | Ga0466729_171987 | 3300042621 | Bacteria | 1659 |
| 94 | Ga0123356_10011880 | 3300010049 | Bacteria | 8476 |
| 95 | Ga0123353_10431642 | 3300010167 | Unclassified | 1948 |
| 96 | Ga0466731_431444 | 3300042622 | Bacteria | 1268 |
| 97 | Ga0466703_012461 | 3300042636 | Bacteria | 5780 |
| 98 | Ga0466724_50291 | 3300042649 | Bacteria | 3122 |
| 99 | Ga0466725_458067 | 3300042654 | Bacteria | 10039 |
| 100 | IMNBL1DRAFT_c0000077 | 3300000062 | Bacteria | 88150 |
| 101 | IMNBL1DRAFT_c0045228 | 3300000062 | Bacteria | 1439 |
| 102 | JGI24702J35022_10101831 | 3300002462 | Bacteria | 1573 |
| 103 | JGI24702J35022_10659832 | 3300002462 | Bacteria | 649 |
| 104 | Ga0466696_136045 | 3300042596 | Bacteria | 1201 |
| 105 | Ga0466696_410853 | 3300042596 | Bacteria | 7401 |
| 106 | Ga0466701_005835 | 3300042598 | Bacteria | 2179 |
| 107 | Ga0466701_027442 | 3300042598 | Bacteria | 43852 |
| 108 | Ga0466707_353989 | 3300042601 | Bacteria | 10261 |
| 109 | Ga0466722_230574 | 3300042609 | Bacteria | 3320 |
| 110 | Ga0466698_148947 | 3300042610 | Bacteria | 2088 |
| 111 | Ga0466732_189145 | 3300042656 | Bacteria | 4886 |
| 112 | Ga0466733_144653 | 3300042659 | Bacteria | 6837 |
| 113 | Ga0466708_278902 | 3300042652 | Bacteria | 28854 |
| 114 | 2227221385 | 2225789004 | Bacteria | 1388 |
| 115 | 2227480171 | 2225789004 | Bacteria | 93917 |
| 116 | JGI24698J34947_10082215 | 3300002449 | Bacteria | 1506 |
| 117 | JGI24702J35022_10040906 | 3300002462 | Bacteria | 2472 |
| 118 | Ga0072941_1596178 | 3300005201 | Bacteria | 704 |
| 119 | Ga0466690_102871 | 3300042590 | Bacteria | 10931 |
| 120 | Ga0466714_002912 | 3300042603 | Bacteria | 31802 |
| 121 | Ga0466714_131484 | 3300042603 | Bacteria | 2770 |
| 122 | Ga0466698_398492 | 3300042610 | Bacteria | 6371 |
| 123 | Ga0466697_105795 | 3300042611 | Bacteria | 8965 |
| 124 | Ga0466733_182431 | 3300042659 | Bacteria | 2974 |
| 125 | Ga0466733_193715 | 3300042659 | Bacteria | 1163 |
| 126 | Ga0466733_218589 | 3300042659 | Bacteria | 4973 |
| 127 | Ga0466712_111729 | 3300042614 | Unclassified | 1403 |
| 128 | Ga0466726_026365 | 3300042619 | Bacteria | 7869 |
| 129 | Ga0466728_113815 | 3300042620 | Bacteria | 10677 |
| 130 | 2227080801 | 2225789004 | Bacteria | 40926 |
| 131 | JGI24702J35022_10002483 | 3300002462 | Bacteria | 11260 |
| 132 | Ga0068305_10006033 | 3300005083 | Bacteria | 8266 |
| 133 | Ga0466657_350354 | 3300042582 | Bacteria | 1267 |
| 134 | Ga0466701_041932 | 3300042598 | Bacteria | 42746 |
| 135 | Ga0466701_067433 | 3300042598 | Bacteria | 4931 |
| 136 | Ga0466706_057169 | 3300042599 | Bacteria | 13233 |
| 137 | Ga0466706_284939 | 3300042599 | Bacteria | 31061 |
| 138 | Ga0466700_263055 | 3300042600 | Bacteria | 1264 |
| 139 | Ga0466713_117396 | 3300042602 | Bacteria | 36879 |
| 140 | Ga0466698_210077 | 3300042610 | Bacteria | 2608 |
| 141 | Ga0466697_027697 | 3300042611 | Bacteria | 8522 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042595 | Ga0466695_284886 | Ga0466695_284886_6121_6522 | 109 |
| 2 | 3300010167 | Ga0123353_10343160 | Ga0123353_103431602 | 111 |
| 3 | 3300010167 | Ga0123353_10448320 | Ga0123353_104483203 | 112 |
| 4 | 3300042602 | Ga0466713_117396 | Ga0466713_117396_4600_4980 | 126 |
| 5 | 3300042598 | Ga0466701_027442 | Ga0466701_027442_3296_3679 | 127 |
| 6 | 3300042598 | Ga0466701_041932 | Ga0466701_041932_7420_7803 | 127 |
| 7 | 3300042611 | Ga0466697_024197 | Ga0466697_024197_348_731 | 127 |
| 8 | 3300042613 | Ga0466710_020279 | Ga0466710_020279_5629_6012 | 127 |
| 9 | 3300042613 | Ga0466710_107009 | Ga0466710_107009_750_1133 | 127 |
| 10 | 3300042635 | Ga0466702_401637 | Ga0466702_401637_338_721 | 127 |
| 11 | 3300042649 | Ga0466724_03661 | Ga0466724_03661_2262_2645 | 127 |
| 12 | 3300042649 | Ga0466724_48278 | Ga0466724_48278_450_833 | 127 |
| 13 | 3300042649 | Ga0466724_50291 | Ga0466724_50291_1414_1797 | 127 |
| 14 | 3300042649 | Ga0466724_58953 | Ga0466724_58953_236_619 | 127 |
| 15 | 3300042656 | Ga0466732_189145 | Ga0466732_189145_447_830 | 127 |
| 16 | iso_pr_bacteria | 2820735654 | 2820735688 | 127 |
| 17 | 3300002462 | JGI24702J35022_10000267 | JGI24702J35022_1000026710 | 128 |
| 18 | 3300002462 | JGI24702J35022_10040906 | JGI24702J35022_100409063 | 128 |
| 19 | 3300002462 | JGI24702J35022_10101831 | JGI24702J35022_101018313 | 128 |
| 20 | 3300002462 | JGI24702J35022_10659832 | JGI24702J35022_106598322 | 128 |
| 21 | 3300042594 | Ga0466694_331267 | Ga0466694_331267_1431_1817 | 128 |
| 22 | 3300042596 | Ga0466696_410853 | Ga0466696_410853_79_465 | 128 |
| 23 | 3300042598 | Ga0466701_005835 | Ga0466701_005835_1282_1668 | 128 |
| 24 | 3300010049 | Ga0123356_10011880 | Ga0123356_100118808 | 129 |
| 25 | 3300010049 | Ga0123356_12214583 | Ga0123356_122145832 | 129 |
| 26 | 3300010167 | Ga0123353_10001306 | Ga0123353_1000130616 | 129 |
| 27 | 3300010167 | Ga0123353_10004001 | Ga0123353_1000400118 | 129 |
| 28 | 3300010167 | Ga0123353_10048308 | Ga0123353_100483087 | 129 |
| 29 | 3300010167 | Ga0123353_10738146 | Ga0123353_107381462 | 129 |
| 30 | 3300010882 | Ga0123354_10150703 | Ga0123354_101507032 | 129 |
| 31 | 3300042590 | Ga0466690_102871 | Ga0466690_102871_5904_6293 | 129 |
| 32 | 3300042596 | Ga0466696_127620 | Ga0466696_127620_220_609 | 129 |
| 33 | 3300042605 | Ga0466716_101861 | Ga0466716_101861_949_1338 | 129 |
| 34 | 3300042606 | Ga0466719_467633 | Ga0466719_467633_997_1386 | 129 |
| 35 | 3300042611 | Ga0466697_105795 | Ga0466697_105795_5458_5847 | 129 |
| 36 | 3300042614 | Ga0466712_111729 | Ga0466712_111729_168_557 | 129 |
| 37 | 3300042618 | Ga0466723_101863 | Ga0466723_101863_21901_22290 | 129 |
| 38 | 3300042621 | Ga0466729_171987 | Ga0466729_171987_44_433 | 129 |
| 39 | 3300042652 | Ga0466708_278902 | Ga0466708_278902_22601_22990 | 129 |
| 40 | iso_pr_bacteria | 2820736622 | 2820737374 | 129 |
| 41 | 3300000062 | IMNBL1DRAFT_c0049240 | IMNBL1DRAFT_00492402 | 130 |
| 42 | 3300002462 | JGI24702J35022_10002483 | JGI24702J35022_100024835 | 130 |
| 43 | 3300010049 | Ga0123356_10247701 | Ga0123356_102477012 | 130 |
| 44 | 3300010167 | Ga0123353_10207444 | Ga0123353_102074442 | 130 |
| 45 | 3300010167 | Ga0123353_10294602 | Ga0123353_102946022 | 130 |
| 46 | 3300042599 | Ga0466706_152064 | Ga0466706_152064_11262_11654 | 130 |
| 47 | 3300042601 | Ga0466707_135441 | Ga0466707_135441_9728_10120 | 130 |
| 48 | 3300042603 | Ga0466714_124442 | Ga0466714_124442_1443_1835 | 130 |
| 49 | 3300042648 | Ga0466709_190200 | Ga0466709_190200_15042_15434 | 130 |
| 50 | 3300042659 | Ga0466733_152570 | Ga0466733_152570_40578_40970 | 130 |
| 51 | 3300042659 | Ga0466733_192079 | Ga0466733_192079_211_603 | 130 |
| 52 | 2225789004 | 2227080801 | 2227454463 | 131 |
| 53 | 3300002449 | JGI24698J34947_10082215 | JGI24698J34947_100822152 | 131 |
| 54 | 3300005201 | Ga0072941_1596178 | Ga0072941_15961782 | 131 |
| 55 | 3300010049 | Ga0123356_11309607 | Ga0123356_113096072 | 131 |
| 56 | 3300042582 | Ga0466657_125058 | Ga0466657_125058_1475_1870 | 131 |
| 57 | 3300042590 | Ga0466690_204901 | Ga0466690_204901_4947_5342 | 131 |
| 58 | 3300042593 | Ga0466691_088613 | Ga0466691_088613_7085_7480 | 131 |
| 59 | 3300042594 | Ga0466694_154103 | Ga0466694_154103_176_571 | 131 |
| 60 | 3300042594 | Ga0466694_365523 | Ga0466694_365523_605_1000 | 131 |
| 61 | 3300042594 | Ga0466694_390050 | Ga0466694_390050_1842_2237 | 131 |
| 62 | 3300042596 | Ga0466696_244380 | Ga0466696_244380_4016_4411 | 131 |
| 63 | 3300042598 | Ga0466701_067433 | Ga0466701_067433_2662_3057 | 131 |
| 64 | 3300042599 | Ga0466706_012634 | Ga0466706_012634_15692_16087 | 131 |
| 65 | 3300042600 | Ga0466700_191494 | Ga0466700_191494_145_540 | 131 |
| 66 | 3300042601 | Ga0466707_353989 | Ga0466707_353989_458_853 | 131 |
| 67 | 3300042602 | Ga0466713_133014 | Ga0466713_133014_8661_9056 | 131 |
| 68 | 3300042602 | Ga0466713_149502 | Ga0466713_149502_4919_5314 | 131 |
| 69 | 3300042603 | Ga0466714_003150 | Ga0466714_003150_683_1078 | 131 |
| 70 | 3300042603 | Ga0466714_131484 | Ga0466714_131484_352_747 | 131 |
| 71 | 3300042606 | Ga0466719_478715 | Ga0466719_478715_689_1084 | 131 |
| 72 | 3300042610 | Ga0466698_089917 | Ga0466698_089917_372_767 | 131 |
| 73 | 3300042610 | Ga0466698_210077 | Ga0466698_210077_1902_2297 | 131 |
| 74 | 3300042611 | Ga0466697_027697 | Ga0466697_027697_3821_4216 | 131 |
| 75 | 3300042615 | Ga0466711_360476 | Ga0466711_360476_7149_7544 | 131 |
| 76 | 3300042616 | Ga0466715_140613 | Ga0466715_140613_5693_6088 | 131 |
| 77 | 3300042617 | Ga0466718_098844 | Ga0466718_098844_659_1054 | 131 |
| 78 | 3300042618 | Ga0466723_233013 | Ga0466723_233013_218_613 | 131 |
| 79 | 3300042619 | Ga0466726_026365 | Ga0466726_026365_2614_3009 | 131 |
| 80 | 3300042620 | Ga0466728_113815 | Ga0466728_113815_5773_6168 | 131 |
| 81 | 3300042621 | Ga0466729_253199 | Ga0466729_253199_1017_1412 | 131 |
| 82 | 3300042622 | Ga0466731_120935 | Ga0466731_120935_132_527 | 131 |
| 83 | 3300042622 | Ga0466731_320360 | Ga0466731_320360_11821_12216 | 131 |
| 84 | 3300042622 | Ga0466731_431444 | Ga0466731_431444_132_527 | 131 |
| 85 | 3300042636 | Ga0466703_085452 | Ga0466703_085452_346_741 | 131 |
| 86 | 3300042643 | Ga0466704_278504 | Ga0466704_278504_27013_27408 | 131 |
| 87 | 3300042652 | Ga0466708_393213 | Ga0466708_393213_4662_5057 | 131 |
| 88 | 3300042659 | Ga0466733_193715 | Ga0466733_193715_189_584 | 131 |
| 89 | iso_pr_bacteria | 2820753519 | 2820753773 | 131 |
| 90 | iso_pr_bacteria | 2820755292 | 2820757215 | 131 |
| 91 | iso_pr_bacteria | 2820783511 | 2820784467 | 131 |
| 92 | iso_pr_bacteria | 2820792843 | 2820794288 | 131 |
| 93 | iso_pr_bacteria | 2820795054 | 2820797000 | 131 |
| 94 | iso_pr_bacteria | 2820797595 | 2820798063 | 131 |
| 95 | 3300000062 | IMNBL1DRAFT_c0000077 | IMNBL1DRAFT_000007733 | 132 |
| 96 | 3300000062 | IMNBL1DRAFT_c0009153 | IMNBL1DRAFT_00091532 | 132 |
| 97 | 3300000062 | IMNBL1DRAFT_c0030928 | IMNBL1DRAFT_00309281 | 132 |
| 98 | 3300000062 | IMNBL1DRAFT_c0045228 | IMNBL1DRAFT_00452281 | 132 |
| 99 | 3300002509 | JGI24699J35502_10879147 | JGI24699J35502_108791471 | 132 |
| 100 | 3300005083 | Ga0068305_10006033 | Ga0068305_100060336 | 132 |
| 101 | 3300005201 | Ga0072941_1730711 | Ga0072941_17307111 | 132 |
| 102 | 3300010049 | Ga0123356_10003573 | Ga0123356_100035739 | 132 |
| 103 | 3300010049 | Ga0123356_11018851 | Ga0123356_110188512 | 132 |
| 104 | 3300010167 | Ga0123353_10431642 | Ga0123353_104316422 | 132 |
| 105 | 3300010167 | Ga0123353_10946804 | Ga0123353_109468041 | 132 |
| 106 | 3300010882 | Ga0123354_10200591 | Ga0123354_102005914 | 132 |
| 107 | 3300010882 | Ga0123354_10337929 | Ga0123354_103379292 | 132 |
| 108 | 3300024582 | Ga0265387_1008250 | Ga0265387_10082502 | 132 |
| 109 | 3300042582 | Ga0466657_118705 | Ga0466657_118705_3118_3516 | 132 |
| 110 | 3300042582 | Ga0466657_350354 | Ga0466657_350354_720_1118 | 132 |
| 111 | 3300042592 | Ga0466693_435207 | Ga0466693_435207_765_1163 | 132 |
| 112 | 3300042594 | Ga0466694_402829 | Ga0466694_402829_1030_1428 | 132 |
| 113 | 3300042597 | Ga0466699_179041 | Ga0466699_179041_1664_2062 | 132 |
| 114 | 3300042599 | Ga0466706_284939 | Ga0466706_284939_23768_24166 | 132 |
| 115 | 3300042600 | Ga0466700_263055 | Ga0466700_263055_834_1232 | 132 |
| 116 | 3300042601 | Ga0466707_248325 | Ga0466707_248325_269_667 | 132 |
| 117 | 3300042607 | Ga0466720_058763 | Ga0466720_058763_614_1012 | 132 |
| 118 | 3300042609 | Ga0466722_230574 | Ga0466722_230574_2417_2815 | 132 |
| 119 | 3300042610 | Ga0466698_037406 | Ga0466698_037406_641_1039 | 132 |
| 120 | 3300042610 | Ga0466698_148947 | Ga0466698_148947_1055_1453 | 132 |
| 121 | 3300042610 | Ga0466698_398492 | Ga0466698_398492_5841_6239 | 132 |
| 122 | 3300042612 | Ga0466705_226291 | Ga0466705_226291_3069_3467 | 132 |
| 123 | 3300042621 | Ga0466729_300116 | Ga0466729_300116_350_748 | 132 |
| 124 | 3300042656 | Ga0466732_344547 | Ga0466732_344547_246_644 | 132 |
| 125 | 3300042659 | Ga0466733_124286 | Ga0466733_124286_26024_26422 | 132 |
| 126 | 3300042659 | Ga0466733_144653 | Ga0466733_144653_3589_3987 | 132 |
| 127 | 3300042659 | Ga0466733_182431 | Ga0466733_182431_20_418 | 132 |
| 128 | 3300042659 | Ga0466733_218589 | Ga0466733_218589_281_679 | 132 |
| 129 | iso_pr_bacteria | 2820741847 | 2820744207 | 132 |
| 130 | iso_pr_bacteria | 2820768849 | 2820769993 | 132 |
| 131 | iso_pr_bacteria | 2820774381 | 2820775199 | 132 |
| 132 | iso_pr_bacteria | 2940195863 | 2940196811 | 132 |
| 133 | 2225789004 | 2227221385 | 2227654478 | 133 |
| 134 | 2225789004 | 2227480171 | 2227937966 | 133 |
| 135 | 2225789004 | 2227540745 | 2228062088 | 133 |
| 136 | 3300001880 | FAAS_10615769 | FAAS_106157692 | 133 |
| 137 | 3300002449 | JGI24698J34947_10190016 | JGI24698J34947_101900162 | 133 |
| 138 | 3300010167 | Ga0123353_10000053 | Ga0123353_1000005372 | 133 |
| 139 | 3300010882 | Ga0123354_10221239 | Ga0123354_102212393 | 133 |
| 140 | 3300010882 | Ga0123354_10473616 | Ga0123354_104736161 | 133 |
| 141 | 3300042592 | Ga0466693_146115 | Ga0466693_146115_282_683 | 133 |
| 142 | 3300042596 | Ga0466696_483911 | Ga0466696_483911_239_640 | 133 |
| 143 | 3300042599 | Ga0466706_057169 | Ga0466706_057169_10162_10563 | 133 |
| 144 | 3300042603 | Ga0466714_002912 | Ga0466714_002912_30646_31047 | 133 |
| 145 | 3300042612 | Ga0466705_515646 | Ga0466705_515646_4177_4578 | 133 |
| 146 | 3300042654 | Ga0466725_458067 | Ga0466725_458067_7576_7977 | 133 |
| 147 | 3300000062 | IMNBL1DRAFT_c0007678 | IMNBL1DRAFT_00076783 | 134 |
| 148 | 3300000062 | IMNBL1DRAFT_c0038213 | IMNBL1DRAFT_00382132 | 134 |
| 149 | 3300000062 | IMNBL1DRAFT_c0027880 | IMNBL1DRAFT_00278803 | 145 |
| 150 | 3300010167 | Ga0123353_10293904 | Ga0123353_102939043 | 147 |
| 151 | 3300042596 | Ga0466696_136045 | Ga0466696_136045_691_1149 | 152 |
| 152 | 3300042648 | Ga0466709_132170 | Ga0466709_132170_15294_15755 | 153 |
| 153 | 3300042636 | Ga0466703_012461 | Ga0466703_012461_281_754 | 157 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.