Protein Family IF09079

Metagenome Isolate
162 Members
45 Samples
146 Scaffolds
487.5 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_007688|Ga0466703_007688_837_2498
Length
553 aa
Sequence
MNKILKEKIMEAFSSVLPITAIVLIVSVVLVPMPAGTILMFLVGAALLIIGMGFFTLGADMAMMPMGEGIGVQLTRSSNLFLVLFVSFVMGLIITIAEPDLQVLARQVPSVPSMVLIITVGAGVGLFLLISVLRILLKIRLSALLVIFYLGVFILACLPVTSSSFIPVAFDSGGVTTGPITVPFILAMGIGVASIRSDKNSQDDSFGLIALCSIGPILAVLILGAFFNPDSAAVESHTVPVVASSREVVQAFTRELPEYAKEVLLAMGAIVLFFLVFQLITKRFKKHQLARMAVGFIYTFIGLVFFLTGVSVGFIPVGHLVGSELAASSFKWILVPLGMIIGYFIVAAEPAVHVLNKQVEEISSGAITAKLMNRGLSVGMAIALAITMIRILTGISLLWILIPGYTFALFLTFFVPPIFTGVAFDSGGVCSGPMTSTFLLPLAMGTCEGAGGNLMTDAFGIVAMVAMTPLIIIQLMGVLFVHRAKKAALVQAVEQAERISGITKEEAEAITEFADIPGNYETDFSAASAVREGTDMTLINKEMPSEGKEPSNG

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 31.8%
Kalotermitidae 31.8%
Termitidae 11.4%
Rhinotermitidae 6.8%
Termopsidae 6.8%
Unclassified 6.8%
Passalidae 2.3%
Blaberidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
3 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
4 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
5 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
17 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
39 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
40 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 2772190975 Treponema sp. RmG30 Isolate Blaberidae
44 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
45 650716102 Treponema primitia ZAS-2 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_072243 3300042612 Bacteria 5934
2 Ga0466705_238128 3300042612 Bacteria 14245
3 Ga0466716_113126 3300042605 Bacteria 2015
4 Ga0466735_008483 3300042624 Bacteria 4143
5 Ga0466703_059325 3300042636 Bacteria 9671
6 Ga0466709_150700 3300042648 Bacteria 2143
7 Ga0466708_144805 3300042652 Bacteria 3365
8 Ga0466715_077254 3300042616 Bacteria 24143
9 Ga0466715_580172 3300042616 Bacteria 2887
10 Ga0466726_440508 3300042619 Bacteria 11362
11 Ga0466728_026520 3300042620 Bacteria 18025
12 Ga0466728_269904 3300042620 Bacteria 6681
13 Ga0466691_105196 3300042593 Unclassified 9390
14 Ga0466696_083034 3300042596 Bacteria 1992
15 Ga0466696_092289 3300042596 Bacteria 12876
16 Ga0466705_033200 3300042612 Bacteria 12778
17 Ga0466705_199681 3300042612 Bacteria 3478
18 Ga0466705_218358 3300042612 Bacteria 8829
19 Ga0466719_286242 3300042606 Bacteria 14418
20 Ga0466703_007688 3300042636 Bacteria 23124
21 Ga0466704_615696 3300042643 Bacteria 10094
22 Ga0466709_236782 3300042648 Bacteria 6193
23 Ga0466708_427818 3300042652 Bacteria 41992
24 Ga0466727_284023 3300042655 Bacteria 10103
25 Ga0466711_097729 3300042615 Bacteria 8108
26 Ga0466715_407106 3300042616 Bacteria 11966
27 Ga0466723_337213 3300042618 Bacteria 2524
28 Ga0466728_208461 3300042620 Bacteria 2577
29 Ga0466691_017747 3300042593 Bacteria 9335
30 Ga0466691_052486 3300042593 Bacteria 28400
31 Ga0466696_086151 3300042596 Bacteria 9966
32 JGI24702J35022_10038080 3300002462 Bacteria 2567
33 Ga0466705_044170 3300042612 Bacteria 9389
34 Ga0466705_082797 3300042612 Bacteria 13500
35 Ga0466707_114761 3300042601 Bacteria 2034
36 Ga0466713_133878 3300042602 Unclassified 3813
37 Ga0466716_210549 3300042605 Bacteria 15132
38 Ga0466716_298696 3300042605 Bacteria 2098
39 Ga0466719_134180 3300042606 Bacteria 2246
40 Ga0466719_543334 3300042606 Unclassified 9314
41 Ga0466735_048613 3300042624 Bacteria 3032
42 Ga0466703_049444 3300042636 Bacteria 6048
43 Ga0466703_381872 3300042636 Bacteria 12519
44 Ga0466704_055119 3300042643 Unclassified 3313
45 Ga0466704_235687 3300042643 Bacteria 94333
46 Ga0466709_016027 3300042648 Bacteria 7234
47 Ga0466709_164449 3300042648 Bacteria 8247
48 Ga0466709_218646 3300042648 Bacteria 3428
49 Ga0466727_308800 3300042655 Bacteria 1572
50 Ga0466727_336788 3300042655 Bacteria 2613
51 Ga0466711_024293 3300042615 Bacteria 2378
52 Ga0466711_341599 3300042615 Bacteria 30993
53 Ga0466715_002177 3300042616 Bacteria 2879
54 Ga0466723_358005 3300042618 Bacteria 10827
55 Ga0466726_060655 3300042619 Bacteria 3036
56 Ga0466726_182377 3300042619 Bacteria 1649
57 Ga0466729_125602 3300042621 Bacteria 5010
58 Ga0466690_230675 3300042590 Bacteria 12493
59 Ga0466705_003041 3300042612 Bacteria 14560
60 Ga0466705_159156 3300042612 Bacteria 6274
61 Ga0466716_130183 3300042605 Bacteria 21500
62 Ga0466722_252056 3300042609 Bacteria 5714
63 Ga0466703_043354 3300042636 Bacteria 4111
64 Ga0466709_379280 3300042648 Bacteria 4282
65 Ga0466708_046682 3300042652 Bacteria 25817
66 Ga0466705_491135 3300042612 Bacteria 2926
67 Ga0466715_355198 3300042616 Bacteria 4280
68 Ga0466726_251625 3300042619 Bacteria 2214
69 Ga0466728_090859 3300042620 Bacteria 3131
70 Ga0466728_355117 3300042620 Bacteria 8121
71 Ga0466691_042306 3300042593 Bacteria 12800
72 AustNasuHG_c1000901 3300000089 Bacteria 10724
73 JGI24702J35022_10016381 3300002462 Bacteria 4063
74 Ga0466719_057724 3300042606 Bacteria 7308
75 Ga0466735_007341 3300042624 Bacteria 1996
76 Ga0466704_395243 3300042643 Bacteria 3941
77 Ga0466704_564678 3300042643 Bacteria 3869
78 Ga0466709_361519 3300042648 Bacteria 14108
79 Ga0466727_088130 3300042655 Bacteria 2085
80 Ga0466723_305384 3300042618 Bacteria 3834
81 Ga0466726_112274 3300042619 Bacteria 1808
82 Ga0466728_456091 3300042620 Bacteria 2789
83 Ga0466729_128797 3300042621 Bacteria 2425
84 Ga0466690_231972 3300042590 Bacteria 3370
85 Ga0466690_368532 3300042590 Bacteria 5556
86 Ga0466691_065323 3300042593 Bacteria 8951
87 Ga0072941_1011982 3300005201 Bacteria 17576
88 Ga0466705_007953 3300042612 Bacteria 6103
89 Ga0466735_056321 3300042624 Bacteria 3945
90 Ga0466735_218288 3300042624 Bacteria 1587
91 Ga0466709_310581 3300042648 Bacteria 13889
92 Ga0466727_175956 3300042655 Bacteria 3572
93 Ga0466727_274766 3300042655 Bacteria 3766
94 Ga0466711_011963 3300042615 Bacteria 11744
95 Ga0466711_092868 3300042615 Bacteria 5466
96 Ga0466723_023544 3300042618 Bacteria 21695
97 Ga0466723_073780 3300042618 Bacteria 7547
98 Ga0466723_303097 3300042618 Bacteria 8192
99 Ga0466723_359305 3300042618 Bacteria 32167
100 Ga0466728_178757 3300042620 Bacteria 6061
101 Ga0466728_383002 3300042620 Bacteria 5438
102 Ga0466690_133887 3300042590 Bacteria 2197
103 Ga0466696_105614 3300042596 Bacteria 4190
104 Ga0466696_147665 3300042596 Bacteria 4125
105 Ga0466705_026481 3300042612 Bacteria 6896
106 Ga0466719_430816 3300042606 Bacteria 25582
107 Ga0466703_008942 3300042636 Bacteria 4501
108 Ga0466704_523828 3300042643 Unclassified 1788
109 Ga0466708_076209 3300042652 Unclassified 5867
110 Ga0466727_336158 3300042655 Bacteria 2168
111 Ga0466705_514040 3300042612 Bacteria 10928
112 Ga0466715_147642 3300042616 Bacteria 7327
113 Ga0466715_458288 3300042616 Bacteria 5638
114 Ga0466723_000917 3300042618 Bacteria 1935
115 Ga0466723_063603 3300042618 Unclassified 8915
116 Ga0466723_164847 3300042618 Bacteria 38657
117 Ga0466726_261291 3300042619 Bacteria 2972
118 Ga0466728_140758 3300042620 Bacteria 4052
119 Ga0466728_165867 3300042620 Bacteria 8063
120 Ga0466728_240624 3300042620 Bacteria 12770
121 Ga0466692_066433 3300042591 Bacteria 43794
122 Ga0466691_008752 3300042593 Bacteria 4710
123 Ga0072940_1008788 3300005200 Bacteria 12159
124 Ga0466705_197407 3300042612 Bacteria 15274
125 Ga0466707_230050 3300042601 Bacteria 2006
126 Ga0466716_169690 3300042605 Bacteria 13745
127 Ga0466719_261345 3300042606 Bacteria 15808
128 Ga0466735_152832 3300042624 Bacteria 8576
129 Ga0466703_099000 3300042636 Bacteria 2211
130 Ga0466704_063937 3300042643 Bacteria 21423
131 Ga0466708_238944 3300042652 Bacteria 3959
132 Ga0466711_070350 3300042615 Bacteria 2942
133 Ga0466711_484750 3300042615 Bacteria 31730
134 Ga0466715_146553 3300042616 Bacteria 21620
135 Ga0466715_199822 3300042616 Bacteria 9044
136 Ga0466718_147364 3300042617 Bacteria 21998
137 Ga0466723_005344 3300042618 Bacteria 11560
138 Ga0466723_054494 3300042618 Bacteria 10416
139 Ga0466723_073684 3300042618 Unclassified 9025
140 Ga0466726_033587 3300042619 Bacteria 7253
141 Ga0466728_111301 3300042620 Bacteria 3970
142 Ga0466690_199716 3300042590 Bacteria 9185
143 Ga0466692_044411 3300042591 Bacteria 37141
144 Ga0466691_070657 3300042593 Bacteria 6074
145 Ga0466694_121698 3300042594 Bacteria 9072
146 IMNBL1DRAFT_c0001724 3300000062 Bacteria 16057

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_523828 Ga0466704_523828_502_1776 402
2 3300042655 Ga0466727_308800 Ga0466727_308800_44_1321 425
3 3300042648 Ga0466709_361519 Ga0466709_361519_11751_13283 443
4 3300042590 Ga0466690_368532 Ga0466690_368532_85_1635 445
5 3300042618 Ga0466723_337213 Ga0466723_337213_686_2239 446
6 3300042655 Ga0466727_336788 Ga0466727_336788_1150_2583 446
7 3300042618 Ga0466723_073684 Ga0466723_073684_1909_3339 447
8 3300042636 Ga0466703_043354 Ga0466703_043354_1372_2916 451
9 3300042620 Ga0466728_208461 Ga0466728_208461_762_2306 452
10 3300042643 Ga0466704_564678 Ga0466704_564678_1113_2660 453
11 3300042596 Ga0466696_086151 Ga0466696_086151_8069_9619 457
12 3300042617 Ga0466718_147364 Ga0466718_147364_6024_7571 458
13 3300042605 Ga0466716_113126 Ga0466716_113126_506_1957 459
14 3300042621 Ga0466729_128797 Ga0466729_128797_17_1456 459
15 3300042643 Ga0466704_615696 Ga0466704_615696_5966_7510 460
16 3300042612 Ga0466705_082797 Ga0466705_082797_8115_9662 462
17 3300042618 Ga0466723_303097 Ga0466723_303097_3585_5123 462
18 3300042620 Ga0466728_090859 Ga0466728_090859_1533_3080 462
19 3300042590 Ga0466690_199716 Ga0466690_199716_2325_3869 464
20 3300042593 Ga0466691_017747 Ga0466691_017747_1487_3040 464
21 3300042620 Ga0466728_111301 Ga0466728_111301_2009_3553 465
22 3300042620 Ga0466728_140758 Ga0466728_140758_2089_3633 465
23 3300042593 Ga0466691_042306 Ga0466691_042306_8788_10332 466
24 3300042618 Ga0466723_164847 Ga0466723_164847_4072_5616 466
25 3300042615 Ga0466711_092868 Ga0466711_092868_3323_4873 467
26 3300042616 Ga0466715_077254 Ga0466715_077254_10946_12499 467
27 3300042643 Ga0466704_055119 Ga0466704_055119_352_1902 467
28 3300042620 Ga0466728_240624 Ga0466728_240624_5561_7105 468
29 3300042620 Ga0466728_269904 Ga0466728_269904_3079_4620 468
30 3300042655 Ga0466727_175956 Ga0466727_175956_24_1568 468
31 3300042606 Ga0466719_057724 Ga0466719_057724_2604_4151 469
32 3300042636 Ga0466703_099000 Ga0466703_099000_471_2030 469
33 3300042590 Ga0466690_231972 Ga0466690_231972_848_2395 470
34 3300042619 Ga0466726_112274 Ga0466726_112274_47_1480 470
35 3300042619 Ga0466726_182377 Ga0466726_182377_89_1633 470
36 3300042594 Ga0466694_121698 Ga0466694_121698_3169_4692 471
37 3300042616 Ga0466715_355198 Ga0466715_355198_2763_4265 471
38 3300042655 Ga0466727_336158 Ga0466727_336158_236_1795 471
39 3300042593 Ga0466691_065323 Ga0466691_065323_6391_7938 472
40 3300042612 Ga0466705_003041 Ga0466705_003041_9567_11105 472
41 3300042615 Ga0466711_341599 Ga0466711_341599_26141_27682 472
42 3300042618 Ga0466723_054494 Ga0466723_054494_2871_4415 472
43 3300042648 Ga0466709_016027 Ga0466709_016027_3394_4941 472
44 3300042606 Ga0466719_286242 Ga0466719_286242_3948_5507 473
45 3300042616 Ga0466715_580172 Ga0466715_580172_1090_2634 473
46 3300042648 Ga0466709_150700 Ga0466709_150700_242_1792 473
47 3300042619 Ga0466726_060655 Ga0466726_060655_1100_2614 474
48 3300042624 Ga0466735_007341 Ga0466735_007341_24_1568 475
49 3300042648 Ga0466709_218646 Ga0466709_218646_1748_3292 475
50 3300042596 Ga0466696_083034 Ga0466696_083034_19_1563 476
51 3300042612 Ga0466705_072243 Ga0466705_072243_4170_5714 477
52 3300042612 Ga0466705_218358 Ga0466705_218358_6658_8199 477
53 3300042612 Ga0466705_238128 Ga0466705_238128_7913_9472 477
54 3300042615 Ga0466711_484750 Ga0466711_484750_25989_27533 477
55 3300042606 Ga0466719_261345 Ga0466719_261345_2943_4478 478
56 3300042616 Ga0466715_407106 Ga0466715_407106_7917_9449 478
57 3300042620 Ga0466728_355117 Ga0466728_355117_1509_3092 478
58 3300005200 Ga0072940_1008788 Ga0072940_10087886 479
59 3300042606 Ga0466719_134180 Ga0466719_134180_274_1842 480
60 3300042621 Ga0466729_125602 Ga0466729_125602_2293_3858 480
61 3300042591 Ga0466692_066433 Ga0466692_066433_17080_18621 481
62 3300042612 Ga0466705_007953 Ga0466705_007953_898_2436 481
63 3300042624 Ga0466735_056321 Ga0466735_056321_946_2523 481
64 3300042643 Ga0466704_235687 Ga0466704_235687_67321_68859 481
65 3300042655 Ga0466727_284023 Ga0466727_284023_4523_6067 481
66 3300042615 Ga0466711_011963 Ga0466711_011963_9488_11032 482
67 3300042615 Ga0466711_024293 Ga0466711_024293_637_2181 482
68 3300042624 Ga0466735_008483 Ga0466735_008483_204_1748 482
69 3300002462 JGI24702J35022_10016381 JGI24702J35022_100163812 483
70 3300042612 Ga0466705_199681 Ga0466705_199681_810_2351 484
71 3300042624 Ga0466735_152832 Ga0466735_152832_4268_5857 484
72 3300042605 Ga0466716_210549 Ga0466716_210549_7134_8702 485
73 3300042616 Ga0466715_199822 Ga0466715_199822_258_1805 485
74 3300042648 Ga0466709_379280 Ga0466709_379280_1716_3284 485
75 3300042652 Ga0466708_427818 Ga0466708_427818_29878_31446 485
76 3300042593 Ga0466691_105196 Ga0466691_105196_5310_6845 486
77 3300042596 Ga0466696_092289 Ga0466696_092289_6516_8063 486
78 3300042618 Ga0466723_063603 Ga0466723_063603_3048_4601 486
79 3300042648 Ga0466709_164449 Ga0466709_164449_161_1705 486
80 3300042616 Ga0466715_147642 Ga0466715_147642_5643_7211 487
81 3300042624 Ga0466735_218288 Ga0466735_218288_51_1544 488
82 3300042648 Ga0466709_236782 Ga0466709_236782_2992_4545 489
83 3300042652 Ga0466708_144805 Ga0466708_144805_13_1530 489
84 3300042618 Ga0466723_000917 Ga0466723_000917_300_1868 490
85 3300042652 Ga0466708_076209 Ga0466708_076209_1553_3097 490
86 3300042590 Ga0466690_230675 Ga0466690_230675_2238_3794 491
87 3300042601 Ga0466707_230050 Ga0466707_230050_342_1913 491
88 3300042612 Ga0466705_514040 Ga0466705_514040_2556_4097 491
89 3300042624 Ga0466735_048613 Ga0466735_048613_1024_2583 491
90 3300042652 Ga0466708_046682 Ga0466708_046682_14839_16386 491
91 3300042655 Ga0466727_274766 Ga0466727_274766_464_2005 491
92 3300042602 Ga0466713_133878 Ga0466713_133878_1982_3529 492
93 3300042619 Ga0466726_261291 Ga0466726_261291_1272_2840 493
94 3300042636 Ga0466703_008942 Ga0466703_008942_1805_3349 494
95 3300042636 Ga0466703_059325 Ga0466703_059325_2342_3883 494
96 3300000062 IMNBL1DRAFT_c0001724 IMNBL1DRAFT_000172412 495
97 3300042593 Ga0466691_008752 Ga0466691_008752_2498_4042 495
98 3300042655 Ga0466727_088130 Ga0466727_088130_242_1804 495
99 3300042605 Ga0466716_130183 Ga0466716_130183_2781_4343 496
100 3300042636 Ga0466703_381872 Ga0466703_381872_7932_9512 496
101 3300042652 Ga0466708_238944 Ga0466708_238944_406_1959 496
102 3300042612 Ga0466705_197407 Ga0466705_197407_13335_14885 497
103 3300042619 Ga0466726_033587 Ga0466726_033587_1489_3036 497
104 3300042596 Ga0466696_147665 Ga0466696_147665_1043_2593 498
105 3300042591 Ga0466692_044411 Ga0466692_044411_2115_3647 499
106 3300042596 Ga0466696_105614 Ga0466696_105614_1974_3518 499
107 3300042612 Ga0466705_491135 Ga0466705_491135_1319_2866 500
108 3300042620 Ga0466728_178757 Ga0466728_178757_4505_6049 500
109 3300042636 Ga0466703_049444 Ga0466703_049444_3944_5500 500
110 3300042615 Ga0466711_097729 Ga0466711_097729_1124_2659 501
111 3300042618 Ga0466723_005344 Ga0466723_005344_5435_6970 501
112 3300042612 Ga0466705_033200 Ga0466705_033200_5690_7234 502
113 3300042620 Ga0466728_383002 Ga0466728_383002_277_1836 502
114 3300042605 Ga0466716_169690 Ga0466716_169690_9312_10856 503
115 iso_pr_bacteria 2940230426 2940231363 503
116 iso_pr_bacteria 2940233634 2940234789 503
117 iso_pr_bacteria 2940277027 2940277198 503
118 iso_pr_bacteria 2940280053 2940282086 503
119 iso_pr_bacteria 2940283334 2940284270 503
120 iso_pr_bacteria 2940289514 2940289616 503
121 iso_pr_bacteria 2940292506 2940292608 503
122 iso_pr_bacteria 2940295490 2940295668 503
123 iso_pr_bacteria 2944625312 2944627382 503
124 3300042606 Ga0466719_430816 Ga0466719_430816_16698_18242 504
125 3300042612 Ga0466705_026481 Ga0466705_026481_540_2084 504
126 3300042605 Ga0466716_298696 Ga0466716_298696_29_1546 505
127 3300042618 Ga0466723_358005 Ga0466723_358005_5826_7385 506
128 3300042620 Ga0466728_165867 Ga0466728_165867_6194_7762 506
129 3300042609 Ga0466722_252056 Ga0466722_252056_1104_2672 507
130 3300042616 Ga0466715_458288 Ga0466715_458288_2153_3715 507
131 3300042620 Ga0466728_456091 Ga0466728_456091_576_2126 507
132 3300042593 Ga0466691_070657 Ga0466691_070657_2688_4232 508
133 3300042616 Ga0466715_146553 Ga0466715_146553_15290_16930 508
134 3300042606 Ga0466719_543334 Ga0466719_543334_821_2461 509
135 3300042619 Ga0466726_440508 Ga0466726_440508_8086_9615 509
136 3300042601 Ga0466707_114761 Ga0466707_114761_322_1920 510
137 3300042612 Ga0466705_044170 Ga0466705_044170_3662_5194 510
138 3300042618 Ga0466723_023544 Ga0466723_023544_3429_4961 510
139 3300042620 Ga0466728_026520 Ga0466728_026520_6387_8039 510
140 3300042643 Ga0466704_395243 Ga0466704_395243_411_1943 510
141 3300042648 Ga0466709_310581 Ga0466709_310581_4276_5811 511
142 iso_pr_bacteria 2940264388 2940265961 511
143 iso_pr_bacteria 2940267548 2940269120 511
144 iso_pr_bacteria 2940270707 2940272250 511
145 iso_pr_bacteria 2940273867 2940275446 511
146 3300042590 Ga0466690_133887 Ga0466690_133887_76_1620 514
147 3300042618 Ga0466723_073780 Ga0466723_073780_2263_3807 514
148 3300042618 Ga0466723_305384 Ga0466723_305384_1565_3109 514
149 3300042619 Ga0466726_251625 Ga0466726_251625_586_2169 514
150 3300042612 Ga0466705_159156 Ga0466705_159156_3793_5433 515
151 iso_pr_bacteria 650716102 650880781 515
152 3300042615 Ga0466711_070350 Ga0466711_070350_19_1572 517
153 3300042616 Ga0466715_002177 Ga0466715_002177_807_2384 517
154 iso_pr_bacteria 2772190975 2773725053 517
155 3300000089 AustNasuHG_c1000901 AustNasuHG_100090111 518
156 3300005201 Ga0072941_1011982 Ga0072941_101198210 520
157 3300002462 JGI24702J35022_10038080 JGI24702J35022_100380802 521
158 3300042618 Ga0466723_359305 Ga0466723_359305_11897_13537 521
159 3300042643 Ga0466704_063937 Ga0466704_063937_10498_12138 523
160 3300042593 Ga0466691_052486 Ga0466691_052486_23746_25386 527
161 iso_pr_bacteria 2940286528 2940287916 528
162 3300042636 Ga0466703_007688 Ga0466703_007688_837_2498 553

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07556 DUF1538 Protein of unknown function (DUF1538) 270 479 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.