Protein Family IF09062
Metagenome
Isolate
128
Members
45
Samples
113
Scaffolds
349.7
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_277608|Ga0466702_277608_3214_4275
- Length
- 353 aa
- Sequence
- MYTREILAPVNSPIEDGKPLYGTWNRAFEKVDLQEIRRPYRYPLPRWARNYRIKEWECFSAQDEHFLLEAIFCNVKLYRMAQVVLYDKDNDKKFVFRKIKPGTGWQLPLSLSNASVDSHSSSFYFRIHSWLDADTIKLDINVEASRSRPSLTVHLAYNVSRQDVTPMAVSLGISEQRSMYAYKALAPVRGDIVLGGRHIIFKQDACSGFFCDYKGYFPYRMQTTFCSAMGFSDTAGEEKKRFGFHIAESQTRESNRNNENAMWINGQLTPLPPVLITMPHGSDADWVIQDLEGMVDLTFTPKEQNKSGVNLLFTNADFNAPIGYYNGMLVSSDGTQIQIKNLIGIGEKLYLRV
Sample Types
Isolate
11.7%
Metagenome
88.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.8%
Unclassified
37.2%
Kalotermitidae
11.6%
Rhinotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 3 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 13 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 19 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 20 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 26 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 27 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 38 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 39 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 40 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 41 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 42 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10003181 | 3300010049 | Bacteria | 17262 |
| 2 | Ga0123356_10006588 | 3300010049 | Bacteria | 11702 |
| 3 | Ga0123356_10151220 | 3300010049 | Bacteria | 2305 |
| 4 | Ga0466718_064176 | 3300042617 | Bacteria | 9765 |
| 5 | 2230969614 | 2228664004 | Bacteria | 11396 |
| 6 | JGI24698J34947_10001672 | 3300002449 | Bacteria | 11841 |
| 7 | JGI24695J34938_10000205 | 3300002450 | Bacteria | 55959 |
| 8 | JGI24695J34938_10000613 | 3300002450 | Bacteria | 34131 |
| 9 | JGI24695J34938_10012418 | 3300002450 | Bacteria | 4514 |
| 10 | JGI24695J34938_10022343 | 3300002450 | Bacteria | 3073 |
| 11 | Ga0072940_1004044 | 3300005200 | Bacteria | 5082 |
| 12 | Ga0072941_1022554 | 3300005201 | Bacteria | 12389 |
| 13 | Ga0264413_111735 | 3300024493 | Bacteria | 3444 |
| 14 | Ga0466694_001700 | 3300042594 | Bacteria | 12564 |
| 15 | Ga0466694_404902 | 3300042594 | Bacteria | 9975 |
| 16 | Ga0466702_277608 | 3300042635 | Bacteria | 17818 |
| 17 | Ga0466720_146820 | 3300042607 | Bacteria | 22628 |
| 18 | Ga0466712_036926 | 3300042614 | Bacteria | 53774 |
| 19 | AustNasuHG_c1014541 | 3300000089 | Bacteria | 2673 |
| 20 | JGI24695J34938_10001204 | 3300002450 | Bacteria | 22938 |
| 21 | JGI24695J34938_10010402 | 3300002450 | Bacteria | 5093 |
| 22 | JGI24695J34938_10067429 | 3300002450 | Bacteria | 1505 |
| 23 | Ga0072941_1011847 | 3300005201 | Bacteria | 41565 |
| 24 | Ga0466690_013107 | 3300042590 | Bacteria | 3135 |
| 25 | Ga0466691_169516 | 3300042593 | Bacteria | 3644 |
| 26 | Ga0466699_425977 | 3300042597 | Unclassified | 18731 |
| 27 | Ga0466721_315556 | 3300042608 | Bacteria | 9037 |
| 28 | Ga0123356_10002659 | 3300010049 | Bacteria | 18993 |
| 29 | Ga0123356_10009883 | 3300010049 | Unclassified | 9395 |
| 30 | JGI24698J34947_10000491 | 3300002449 | Bacteria | 18592 |
| 31 | JGI24698J34947_10013673 | 3300002449 | Bacteria | 4422 |
| 32 | JGI24695J34938_10000239 | 3300002450 | Bacteria | 52549 |
| 33 | JGI24695J34938_10006995 | 3300002450 | Bacteria | 6688 |
| 34 | Ga0264413_108324 | 3300024493 | Bacteria | 12410 |
| 35 | Ga0466694_069852 | 3300042594 | Bacteria | 47276 |
| 36 | Ga0466705_170422 | 3300042612 | Bacteria | 3524 |
| 37 | Ga0466731_265933 | 3300042622 | Bacteria | 3680 |
| 38 | Ga0466720_083736 | 3300042607 | Bacteria | 5023 |
| 39 | Ga0466720_151136 | 3300042607 | Bacteria | 2097 |
| 40 | Ga0123356_10359546 | 3300010049 | Bacteria | 1582 |
| 41 | Ga0123353_10005537 | 3300010167 | Bacteria | 16599 |
| 42 | Ga0466712_029724 | 3300042614 | Bacteria | 17236 |
| 43 | Ga0466712_073680 | 3300042614 | Bacteria | 30571 |
| 44 | Ga0466718_003703 | 3300042617 | Bacteria | 8470 |
| 45 | 2230930164 | 2228664001 | Bacteria | 2493 |
| 46 | JGI24695J34938_10000054 | 3300002450 | Bacteria | 90526 |
| 47 | JGI24695J34938_10000204 | 3300002450 | Bacteria | 55960 |
| 48 | JGI24695J34938_10003431 | 3300002450 | Bacteria | 11093 |
| 49 | Ga0264413_102974 | 3300024493 | Bacteria | 24770 |
| 50 | Ga0466696_300163 | 3300042596 | Bacteria | 19461 |
| 51 | Ga0466699_065431 | 3300042597 | Bacteria | 25231 |
| 52 | Ga0466702_391567 | 3300042635 | Bacteria | 17763 |
| 53 | Ga0466698_350036 | 3300042610 | Bacteria | 21324 |
| 54 | Ga0123356_10000747 | 3300010049 | Bacteria | 35948 |
| 55 | Ga0123356_10002137 | 3300010049 | Bacteria | 21316 |
| 56 | Ga0123356_10034226 | 3300010049 | Bacteria | 4749 |
| 57 | Ga0466712_065088 | 3300042614 | Bacteria | 15347 |
| 58 | Ga0466712_162807 | 3300042614 | Bacteria | 18281 |
| 59 | Ga0466718_008050 | 3300042617 | Bacteria | 9988 |
| 60 | Ga0466718_017588 | 3300042617 | Bacteria | 6508 |
| 61 | Ga0466718_128558 | 3300042617 | Bacteria | 2679 |
| 62 | JGI24698J34947_10000928 | 3300002449 | Bacteria | 14892 |
| 63 | JGI24695J34938_10000248 | 3300002450 | Bacteria | 52089 |
| 64 | JGI24695J34938_10003599 | 3300002450 | Bacteria | 10654 |
| 65 | JGI24702J35022_10002662 | 3300002462 | Bacteria | 10841 |
| 66 | Ga0264413_117182 | 3300024493 | Bacteria | 1602 |
| 67 | Ga0415639_017351 | 3300038395 | Bacteria | 6845 |
| 68 | Ga0415639_021237 | 3300038395 | Bacteria | 2632 |
| 69 | Ga0466693_230190 | 3300042592 | Bacteria | 5780 |
| 70 | Ga0466691_029797 | 3300042593 | Bacteria | 4715 |
| 71 | Ga0466702_159365 | 3300042635 | Bacteria | 1598 |
| 72 | Ga0466712_024215 | 3300042614 | Bacteria | 4169 |
| 73 | Ga0466712_026794 | 3300042614 | Bacteria | 12133 |
| 74 | Ga0466712_071809 | 3300042614 | Bacteria | 23029 |
| 75 | Ga0466712_106730 | 3300042614 | Bacteria | 12105 |
| 76 | Ga0466718_076204 | 3300042617 | Bacteria | 27138 |
| 77 | AustNasuHG_c1010930 | 3300000089 | Bacteria | 3151 |
| 78 | JGI24698J34947_10075353 | 3300002449 | Bacteria | 1604 |
| 79 | JGI24695J34938_10000902 | 3300002450 | Bacteria | 27417 |
| 80 | JGI24695J34938_10001396 | 3300002450 | Bacteria | 20635 |
| 81 | JGI24695J34938_10003023 | 3300002450 | Bacteria | 12079 |
| 82 | Ga0072941_1000864 | 3300005201 | Bacteria | 37095 |
| 83 | Ga0072941_1000901 | 3300005201 | Bacteria | 12380 |
| 84 | Ga0072941_1052162 | 3300005201 | Bacteria | 3823 |
| 85 | Ga0264413_103451 | 3300024493 | Bacteria | 5523 |
| 86 | Ga0264413_116050 | 3300024493 | Bacteria | 3797 |
| 87 | Ga0466705_160074 | 3300042612 | Bacteria | 9700 |
| 88 | Ga0466716_173189 | 3300042605 | Bacteria | 10968 |
| 89 | Ga0466720_017268 | 3300042607 | Bacteria | 4927 |
| 90 | Ga0123356_10078267 | 3300010049 | Bacteria | 3121 |
| 91 | Ga0466718_024621 | 3300042617 | Bacteria | 2232 |
| 92 | AustNasuHG_c1000990 | 3300000089 | Bacteria | 10244 |
| 93 | JGI24698J34947_10005600 | 3300002449 | Bacteria | 6890 |
| 94 | JGI24695J34938_10000267 | 3300002450 | Bacteria | 50738 |
| 95 | JGI24695J34938_10000722 | 3300002450 | Bacteria | 31183 |
| 96 | JGI24695J34938_10004027 | 3300002450 | Bacteria | 9871 |
| 97 | Ga0466692_044094 | 3300042591 | Bacteria | 1395 |
| 98 | Ga0466693_361217 | 3300042592 | Bacteria | 6615 |
| 99 | Ga0466702_454726 | 3300042635 | Bacteria | 1596 |
| 100 | Ga0123356_10325885 | 3300010049 | Bacteria | 1651 |
| 101 | Ga0466712_167627 | 3300042614 | Unclassified | 13851 |
| 102 | Ga0466718_005767 | 3300042617 | Bacteria | 3617 |
| 103 | AustNasuHG_c1004238 | 3300000089 | Bacteria | 5147 |
| 104 | JGI24698J34947_10000083 | 3300002449 | Bacteria | 31087 |
| 105 | JGI24698J34947_10043032 | 3300002449 | Bacteria | 2317 |
| 106 | JGI24700J35501_10930874 | 3300002508 | Bacteria | 31128 |
| 107 | Ga0072941_1052160 | 3300005201 | Bacteria | 9148 |
| 108 | Ga0264413_126988 | 3300024493 | Unclassified | 3472 |
| 109 | Ga0466696_076558 | 3300042596 | Bacteria | 15277 |
| 110 | Ga0466699_053212 | 3300042597 | Bacteria | 3057 |
| 111 | Ga0466707_186394 | 3300042601 | Bacteria | 3136 |
| 112 | Ga0466720_006698 | 3300042607 | Bacteria | 5891 |
| 113 | Ga0466720_065223 | 3300042607 | Bacteria | 24050 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300024493 | Ga0264413_126988 | Ga0264413_1269882 | 311 |
| 2 | 3300042593 | Ga0466691_029797 | Ga0466691_029797_1204_2196 | 330 |
| 3 | 3300010049 | Ga0123356_10151220 | Ga0123356_101512201 | 337 |
| 4 | 3300042597 | Ga0466699_065431 | Ga0466699_065431_12451_13473 | 340 |
| 5 | 3300042614 | Ga0466712_026794 | Ga0466712_026794_10587_11621 | 344 |
| 6 | 3300002450 | JGI24695J34938_10003431 | JGI24695J34938_100034317 | 345 |
| 7 | 3300005201 | Ga0072941_1052160 | Ga0072941_10521605 | 345 |
| 8 | 3300010167 | Ga0123353_10005537 | Ga0123353_100055378 | 345 |
| 9 | 3300042597 | Ga0466699_425977 | Ga0466699_425977_8984_10024 | 346 |
| 10 | 3300042614 | Ga0466712_106730 | Ga0466712_106730_8433_9479 | 348 |
| 11 | 3300042635 | Ga0466702_454726 | Ga0466702_454726_532_1578 | 348 |
| 12 | 2228664001 | 2230930164 | 2230626426 | 349 |
| 13 | 2228664004 | 2230969614 | 2230683055 | 349 |
| 14 | 3300002450 | JGI24695J34938_10000205 | JGI24695J34938_1000020511 | 349 |
| 15 | 3300024493 | Ga0264413_102974 | Ga0264413_1029748 | 349 |
| 16 | 3300024493 | Ga0264413_103451 | Ga0264413_1034513 | 349 |
| 17 | 3300024493 | Ga0264413_111735 | Ga0264413_1117354 | 349 |
| 18 | 3300024493 | Ga0264413_116050 | Ga0264413_1160503 | 349 |
| 19 | 3300024493 | Ga0264413_117182 | Ga0264413_1171822 | 349 |
| 20 | 3300038395 | Ga0415639_017351 | Ga0415639_017351_4299_5348 | 349 |
| 21 | 3300038395 | Ga0415639_021237 | Ga0415639_021237_772_1821 | 349 |
| 22 | 3300042590 | Ga0466690_013107 | Ga0466690_013107_227_1276 | 349 |
| 23 | 3300042591 | Ga0466692_044094 | Ga0466692_044094_216_1265 | 349 |
| 24 | 3300042592 | Ga0466693_230190 | Ga0466693_230190_3247_4296 | 349 |
| 25 | 3300042592 | Ga0466693_361217 | Ga0466693_361217_978_2027 | 349 |
| 26 | 3300042593 | Ga0466691_169516 | Ga0466691_169516_419_1468 | 349 |
| 27 | 3300042594 | Ga0466694_001700 | Ga0466694_001700_3454_4503 | 349 |
| 28 | 3300042594 | Ga0466694_069852 | Ga0466694_069852_35846_36895 | 349 |
| 29 | 3300042594 | Ga0466694_404902 | Ga0466694_404902_870_1919 | 349 |
| 30 | 3300042596 | Ga0466696_076558 | Ga0466696_076558_11750_12799 | 349 |
| 31 | 3300042596 | Ga0466696_300163 | Ga0466696_300163_9510_10559 | 349 |
| 32 | 3300042597 | Ga0466699_053212 | Ga0466699_053212_1422_2471 | 349 |
| 33 | 3300042601 | Ga0466707_186394 | Ga0466707_186394_115_1164 | 349 |
| 34 | 3300042605 | Ga0466716_173189 | Ga0466716_173189_2062_3111 | 349 |
| 35 | 3300042607 | Ga0466720_006698 | Ga0466720_006698_4190_5239 | 349 |
| 36 | 3300042607 | Ga0466720_017268 | Ga0466720_017268_3419_4468 | 349 |
| 37 | 3300042607 | Ga0466720_065223 | Ga0466720_065223_17116_18165 | 349 |
| 38 | 3300042607 | Ga0466720_083736 | Ga0466720_083736_3411_4460 | 349 |
| 39 | 3300042607 | Ga0466720_146820 | Ga0466720_146820_10717_11766 | 349 |
| 40 | 3300042607 | Ga0466720_151136 | Ga0466720_151136_832_1881 | 349 |
| 41 | 3300042608 | Ga0466721_315556 | Ga0466721_315556_7379_8428 | 349 |
| 42 | 3300042610 | Ga0466698_350036 | Ga0466698_350036_4717_5766 | 349 |
| 43 | 3300042612 | Ga0466705_160074 | Ga0466705_160074_761_1810 | 349 |
| 44 | 3300042612 | Ga0466705_170422 | Ga0466705_170422_105_1154 | 349 |
| 45 | 3300042614 | Ga0466712_024215 | Ga0466712_024215_1049_2098 | 349 |
| 46 | 3300042614 | Ga0466712_029724 | Ga0466712_029724_4671_5720 | 349 |
| 47 | 3300042614 | Ga0466712_036926 | Ga0466712_036926_48669_49718 | 349 |
| 48 | 3300042614 | Ga0466712_071809 | Ga0466712_071809_7482_8531 | 349 |
| 49 | 3300042614 | Ga0466712_167627 | Ga0466712_167627_8290_9339 | 349 |
| 50 | 3300042617 | Ga0466718_005767 | Ga0466718_005767_1040_2089 | 349 |
| 51 | 3300042617 | Ga0466718_017588 | Ga0466718_017588_5258_6307 | 349 |
| 52 | 3300042617 | Ga0466718_076204 | Ga0466718_076204_9313_10362 | 349 |
| 53 | 3300042617 | Ga0466718_128558 | Ga0466718_128558_1089_2138 | 349 |
| 54 | 3300042622 | Ga0466731_265933 | Ga0466731_265933_2541_3590 | 349 |
| 55 | 3300042635 | Ga0466702_159365 | Ga0466702_159365_487_1536 | 349 |
| 56 | 3300042635 | Ga0466702_391567 | Ga0466702_391567_12863_13912 | 349 |
| 57 | iso_pr_bacteria | 2781125637 | 2781282140 | 349 |
| 58 | iso_pr_bacteria | 2781125638 | 2781284169 | 349 |
| 59 | iso_pr_bacteria | 2781125642 | 2781291925 | 349 |
| 60 | iso_pr_bacteria | 2781125647 | 2781302759 | 349 |
| 61 | iso_pr_bacteria | 2781125649 | 2781306716 | 349 |
| 62 | iso_pr_bacteria | 2781125650 | 2781308198 | 349 |
| 63 | iso_pr_bacteria | 2781125657 | 2781324307 | 349 |
| 64 | iso_pr_bacteria | 2781125663 | 2781337821 | 349 |
| 65 | iso_pr_bacteria | 2781125692 | 2781431068 | 349 |
| 66 | iso_pr_bacteria | 2781125696 | 2781440104 | 349 |
| 67 | iso_pr_bacteria | 2819992462 | 2819993402 | 349 |
| 68 | iso_pr_bacteria | 2819994798 | 2819998026 | 349 |
| 69 | 3300000089 | AustNasuHG_c1000990 | AustNasuHG_10009907 | 350 |
| 70 | 3300000089 | AustNasuHG_c1004238 | AustNasuHG_10042383 | 350 |
| 71 | 3300000089 | AustNasuHG_c1010930 | AustNasuHG_10109303 | 350 |
| 72 | 3300002449 | JGI24698J34947_10000491 | JGI24698J34947_100004918 | 350 |
| 73 | 3300002449 | JGI24698J34947_10000928 | JGI24698J34947_100009284 | 350 |
| 74 | 3300002449 | JGI24698J34947_10001672 | JGI24698J34947_100016728 | 350 |
| 75 | 3300002449 | JGI24698J34947_10005600 | JGI24698J34947_100056004 | 350 |
| 76 | 3300002449 | JGI24698J34947_10013673 | JGI24698J34947_100136732 | 350 |
| 77 | 3300002449 | JGI24698J34947_10043032 | JGI24698J34947_100430322 | 350 |
| 78 | 3300002449 | JGI24698J34947_10075353 | JGI24698J34947_100753532 | 350 |
| 79 | 3300002450 | JGI24695J34938_10000054 | JGI24695J34938_1000005472 | 350 |
| 80 | 3300002450 | JGI24695J34938_10000204 | JGI24695J34938_1000020429 | 350 |
| 81 | 3300002450 | JGI24695J34938_10000239 | JGI24695J34938_1000023935 | 350 |
| 82 | 3300002450 | JGI24695J34938_10000248 | JGI24695J34938_1000024817 | 350 |
| 83 | 3300002450 | JGI24695J34938_10000267 | JGI24695J34938_1000026712 | 350 |
| 84 | 3300002450 | JGI24695J34938_10000613 | JGI24695J34938_1000061315 | 350 |
| 85 | 3300002450 | JGI24695J34938_10000722 | JGI24695J34938_1000072217 | 350 |
| 86 | 3300002450 | JGI24695J34938_10000902 | JGI24695J34938_100009028 | 350 |
| 87 | 3300002450 | JGI24695J34938_10001204 | JGI24695J34938_100012046 | 350 |
| 88 | 3300002450 | JGI24695J34938_10003599 | JGI24695J34938_100035994 | 350 |
| 89 | 3300002450 | JGI24695J34938_10004027 | JGI24695J34938_100040277 | 350 |
| 90 | 3300002450 | JGI24695J34938_10006995 | JGI24695J34938_100069953 | 350 |
| 91 | 3300002450 | JGI24695J34938_10010402 | JGI24695J34938_100104024 | 350 |
| 92 | 3300002450 | JGI24695J34938_10022343 | JGI24695J34938_100223432 | 350 |
| 93 | 3300002462 | JGI24702J35022_10002662 | JGI24702J35022_100026627 | 350 |
| 94 | 3300002508 | JGI24700J35501_10930874 | JGI24700J35501_1093087417 | 350 |
| 95 | 3300005200 | Ga0072940_1004044 | Ga0072940_10040443 | 350 |
| 96 | 3300005201 | Ga0072941_1000864 | Ga0072941_100086425 | 350 |
| 97 | 3300005201 | Ga0072941_1000901 | Ga0072941_10009015 | 350 |
| 98 | 3300005201 | Ga0072941_1011847 | Ga0072941_101184720 | 350 |
| 99 | 3300005201 | Ga0072941_1022554 | Ga0072941_10225548 | 350 |
| 100 | 3300005201 | Ga0072941_1052162 | Ga0072941_10521622 | 350 |
| 101 | 3300010049 | Ga0123356_10000747 | Ga0123356_100007475 | 350 |
| 102 | 3300010049 | Ga0123356_10002137 | Ga0123356_100021374 | 350 |
| 103 | 3300010049 | Ga0123356_10002659 | Ga0123356_1000265915 | 350 |
| 104 | 3300010049 | Ga0123356_10003181 | Ga0123356_1000318118 | 350 |
| 105 | 3300010049 | Ga0123356_10009883 | Ga0123356_100098835 | 350 |
| 106 | 3300010049 | Ga0123356_10078267 | Ga0123356_100782673 | 350 |
| 107 | 3300010049 | Ga0123356_10325885 | Ga0123356_103258851 | 350 |
| 108 | 3300010049 | Ga0123356_10359546 | Ga0123356_103595461 | 350 |
| 109 | 3300042617 | Ga0466718_003703 | Ga0466718_003703_3725_4777 | 350 |
| 110 | 3300042617 | Ga0466718_008050 | Ga0466718_008050_5468_6520 | 350 |
| 111 | 3300042617 | Ga0466718_024621 | Ga0466718_024621_339_1391 | 350 |
| 112 | 3300042614 | Ga0466712_065088 | Ga0466712_065088_8974_10035 | 353 |
| 113 | 3300042635 | Ga0466702_277608 | Ga0466702_277608_3214_4275 | 353 |
| 114 | 3300024493 | Ga0264413_108324 | Ga0264413_1083244 | 355 |
| 115 | 3300042614 | Ga0466712_073680 | Ga0466712_073680_22483_23550 | 355 |
| 116 | 3300042614 | Ga0466712_162807 | Ga0466712_162807_7773_8840 | 355 |
| 117 | iso_pr_bacteria | 2781125643 | 2781293341 | 355 |
| 118 | iso_pr_bacteria | 2781125660 | 2781331489 | 355 |
| 119 | iso_pr_bacteria | 2820020240 | 2820021609 | 355 |
| 120 | 3300000089 | AustNasuHG_c1014541 | AustNasuHG_10145411 | 356 |
| 121 | 3300002449 | JGI24698J34947_10000083 | JGI24698J34947_100000837 | 356 |
| 122 | 3300002450 | JGI24695J34938_10003023 | JGI24695J34938_100030236 | 356 |
| 123 | 3300002450 | JGI24695J34938_10067429 | JGI24695J34938_100674292 | 356 |
| 124 | 3300010049 | Ga0123356_10034226 | Ga0123356_100342263 | 356 |
| 125 | 3300002450 | JGI24695J34938_10012418 | JGI24695J34938_100124181 | 357 |
| 126 | 3300010049 | Ga0123356_10006588 | Ga0123356_100065884 | 358 |
| 127 | 3300002450 | JGI24695J34938_10001396 | JGI24695J34938_1000139616 | 363 |
| 128 | 3300042617 | Ga0466718_064176 | Ga0466718_064176_3221_4381 | 386 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.91 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.