Protein Family IF09058

Metagenome Isolate
129 Members
71 Samples
104 Scaffolds
241.84 Avg Length

🧬 Representative Sequence

ID
3300042635|Ga0466702_239362|Ga0466702_239362_598_1404
Length
268 aa
Sequence
MPPHGGIKQKSDEEHEERRVYMDYRNSVEFSVKGDCALFSDPVTRVGGEKCSYHIPTYEALKGILHSVYWKPTIVWDIDKVRVMNQIQTATQNVRPIDYNNDGNDLAIYTYLRDVHYQVKAHFDWNYNRPELLPDRNEHKHHNIAKRMISRGGRRDIFLGTRECQGYVEPCAFGEGNGFYDGMPELAFGYMFHGFTYADEAVREEEKMKLSVRFFRPVMRKGVVSFPLPEECGEKDRRIIRDFPIKSFGEGNFVGLAEFAQGAGGADL

📊 Sample Types

Isolate 19.4%
Metagenome 80.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.9%
Kalotermitidae 19.1%
Apidae 16.2%
Unclassified 8.8%
Tenebrionidae 5.9%
Scarabaeidae 4.4%
Termopsidae 4.4%
Rhinotermitidae 2.9%
Passalidae 2.9%
Hodotermitidae 1.5%
Blattidae 1.5%
Noctuidae 1.5%
Libellulidae 1.5%
Bombycidae 1.5%

🌳 Taxonomy

Archaea 2
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
2 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
3 2595698193 Melissococcus plutonius B5 Isolate Apidae
4 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
14 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
15 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
16 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
17 2595698195 Melissococcus plutonius 119 Isolate Apidae
18 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
26 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
27 2595698197 Melissococcus plutonius H6 Isolate Apidae
28 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
33 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
34 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
35 2595698198 Melissococcus plutonius L9 Isolate Apidae
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
43 2595698199 Melissococcus plutonius 60 Isolate Apidae
44 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
45 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
49 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
50 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
51 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
52 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
53 8007237282 Enterococcus sp. DIV0212c Isolate
54 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
55 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
56 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
57 2627853628 Melissococcus plutonius 82 Isolate Apidae
58 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
59 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
60 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
61 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
62 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
67 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
68 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
69 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
70 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
71 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562375_0018 3300056856 Bacteria 940838
2 Ga0123357_10026727 3300009784 Unclassified 7794
3 Ga0123356_10020109 3300010049 Bacteria 6323
4 Ga0123354_10153035 3300010882 Bacteria 2783
5 Ga0466690_061637 3300042590 Bacteria 4298
6 Ga0466693_227140 3300042592 Bacteria 2157
7 Ga0466707_239214 3300042601 Bacteria 1275
8 Ga0466713_064266 3300042602 Unclassified 2278
9 Ga0466698_096028 3300042610 Bacteria 7374
10 Ga0466726_452863 3300042619 Bacteria 6293
11 Ga0466734_002632 3300042623 Bacteria 4671
12 Ga0466703_219754 3300042636 Bacteria 56946
13 Ga0466708_262036 3300042652 Bacteria 12041
14 Ga0466733_120828 3300042659 Bacteria 3118
15 Ga0123355_10007403 3300009826 Bacteria 16442
16 Ga0123353_10000332 3300010167 Bacteria 58261
17 Ga0123353_11422971 3300010167 Bacteria 889
18 IMNBL1DRAFT_c0002233 3300000062 Bacteria 13657
19 Ga0466707_143114 3300042601 Bacteria 1731
20 Ga0466715_621324 3300042616 Bacteria 2876
21 Ga0466704_428567 3300042643 Bacteria 7849
22 Ga0466709_100720 3300042648 Bacteria 19504
23 Ga0530661_002377 3300056564 Bacteria 7180
24 Ga0562374_0565 3300057007 Unclassified 59401
25 Ga0123355_10025775 3300009826 Bacteria 9470
26 Ga0123353_10322480 3300010167 Bacteria 2343
27 Ga0123353_11051442 3300010167 Bacteria 1087
28 Ga0123353_11354364 3300010167 Bacteria 919
29 Ga0123354_10291122 3300010882 Bacteria 1565
30 2227496852 2225789004 Bacteria 19894
31 JGI24702J35022_10144983 3300002462 Bacteria 1328
32 Ga0068302_10070142 3300005071 Unclassified 4836
33 Ga0466706_103383 3300042599 Bacteria 3073
34 Ga0466735_164414 3300042624 Unclassified 1086
35 Ga0466704_249649 3300042643 Bacteria 11970
36 Ga0466708_240919 3300042652 Bacteria 39444
37 Ga0530661_000547 3300056564 Bacteria 26314
38 Ga0123356_10047050 3300010049 Bacteria 4014
39 Ga0123356_10086449 3300010049 Bacteria 2976
40 Ga0123354_10263511 3300010882 Bacteria 1715
41 IMNBL1DRAFT_c0000717 3300000062 Bacteria 26446
42 IMNBL1DRAFT_c0001959 3300000062 Bacteria 14829
43 JGI24696J40584_12778140 3300002834 Bacteria 832
44 Ga0466706_137482 3300042599 Bacteria 1705
45 Ga0466700_046155 3300042600 Bacteria 2550
46 Ga0466707_233193 3300042601 Bacteria 9404
47 Ga0466714_018776 3300042603 Bacteria 9947
48 Ga0466722_047851 3300042609 Bacteria 49648
49 Ga0466715_101664 3300042616 Bacteria 3975
50 Ga0466718_132366 3300042617 Bacteria 24100
51 Ga0466702_239362 3300042635 Bacteria 1559
52 Ga0466703_406126 3300042636 Bacteria 1556
53 Ga0530661_000027 3300056564 Bacteria 177246
54 Ga0530661_002110 3300056564 Unclassified 8084
55 Ga0123355_10199929 3300009826 Bacteria 2922
56 Ga0160452_100291 3300012834 Bacteria 46805
57 Ga0466694_135302 3300042594 Bacteria 2869
58 Ga0466707_075174 3300042601 Bacteria 159565
59 Ga0466719_405979 3300042606 Bacteria 1354
60 Ga0466705_519925 3300042612 Bacteria 55786
61 Ga0466711_307281 3300042615 Bacteria 12437
62 Ga0466715_180208 3300042616 Bacteria 9225
63 Ga0466726_004082 3300042619 Bacteria 10861
64 Ga0466726_422686 3300042619 Bacteria 2111
65 Ga0466728_040320 3300042620 Bacteria 5277
66 Ga0466735_085784 3300042624 Bacteria 5130
67 Ga0466703_255005 3300042636 Bacteria 1463
68 Ga0466708_379484 3300042652 Bacteria 12028
69 Ga0466733_146375 3300042659 Bacteria 9726
70 Ga0123353_10084459 3300010167 Unclassified 5111
71 IMNBL1DRAFT_c0000342 3300000062 Archaea 39457
72 IMNBL1DRAFT_c0005259 3300000062 Bacteria 7466
73 IMNBL1DRAFT_c0006000 3300000062 Bacteria 6776
74 Ga0265387_1001246 3300024582 Bacteria 3750
75 Ga0466696_203476 3300042596 Bacteria 1767
76 Ga0466712_074731 3300042614 Bacteria 6849
77 Ga0466711_016730 3300042615 Bacteria 1445
78 Ga0466723_028079 3300042618 Bacteria 1449
79 Ga0466729_213213 3300042621 Bacteria 3643
80 Ga0466704_298697 3300042643 Bacteria 7053
81 Ga0466704_335107 3300042643 Bacteria 8888
82 Ga0562375_0118 3300056856 Bacteria 236233
83 Ga0123353_10035666 3300010167 Bacteria 7780
84 Ga0123354_10293180 3300010882 Bacteria 1554
85 JGI24702J35022_10320221 3300002462 Bacteria 920
86 JGI24705J35276_12188508 3300002504 Bacteria 1441
87 JGI24705J35276_12237668 3300002504 Bacteria 12417
88 Ga0466691_188157 3300042593 Bacteria 14175
89 Ga0466706_052335 3300042599 Bacteria 10688
90 Ga0466711_082375 3300042615 Bacteria 9598
91 Ga0466715_031469 3300042616 Bacteria 7002
92 Ga0466715_044661 3300042616 Bacteria 3498
93 Ga0466715_045581 3300042616 Bacteria 16064
94 Ga0466729_213371 3300042621 Bacteria 4303
95 Ga0466704_466603 3300042643 Bacteria 1019
96 Ga0123355_10000364 3300009826 Bacteria 58670
97 Ga0123355_10124824 3300009826 Bacteria 3981
98 Ga0123353_10147298 3300010167 Bacteria 3763
99 Ga0466714_030748 3300042603 Bacteria 21529
100 Ga0466714_093722 3300042603 Bacteria 1552
101 Ga0466711_110937 3300042615 Bacteria 4781
102 Ga0466715_296460 3300042616 Bacteria 2544
103 Ga0466726_057928 3300042619 Archaea 22876
104 Ga0466708_129204 3300042652 Bacteria 3781

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2849104611 2849106839 208
2 3300042643 Ga0466704_466603 Ga0466704_466603_260_937 225
3 3300024582 Ga0265387_1001246 Ga0265387_10012462 227
4 2225789004 2227496852 2227975100 229
5 3300000062 IMNBL1DRAFT_c0002233 IMNBL1DRAFT_000223310 229
6 3300042600 Ga0466700_046155 Ga0466700_046155_341_1030 229
7 3300042624 Ga0466735_164414 Ga0466735_164414_260_949 229
8 3300000062 IMNBL1DRAFT_c0005259 IMNBL1DRAFT_00052596 231
9 3300000062 IMNBL1DRAFT_c0000342 IMNBL1DRAFT_00003429 232
10 3300042624 Ga0466735_085784 Ga0466735_085784_1250_1948 232
11 3300042636 Ga0466703_219754 Ga0466703_219754_5337_6035 232
12 3300042652 Ga0466708_379484 Ga0466708_379484_5814_6512 232
13 3300042596 Ga0466696_203476 Ga0466696_203476_543_1244 233
14 3300042619 Ga0466726_057928 Ga0466726_057928_16588_17289 233
15 3300002462 JGI24702J35022_10320221 JGI24702J35022_103202211 234
16 3300010167 Ga0123353_10147298 Ga0123353_101472982 234
17 3300042593 Ga0466691_188157 Ga0466691_188157_8379_9083 234
18 3300042616 Ga0466715_031469 Ga0466715_031469_2754_3458 234
19 3300042617 Ga0466718_132366 Ga0466718_132366_18175_18879 234
20 3300042620 Ga0466728_040320 Ga0466728_040320_1649_2353 234
21 3300042636 Ga0466703_406126 Ga0466703_406126_331_1035 234
22 3300042652 Ga0466708_240919 Ga0466708_240919_4439_5143 234
23 3300010167 Ga0123353_10084459 Ga0123353_100844596 235
24 3300042609 Ga0466722_047851 Ga0466722_047851_3461_4168 235
25 3300042623 Ga0466734_002632 Ga0466734_002632_2619_3326 235
26 3300042601 Ga0466707_143114 Ga0466707_143114_999_1709 236
27 3300042601 Ga0466707_239214 Ga0466707_239214_84_794 236
28 3300042603 Ga0466714_030748 Ga0466714_030748_15415_16125 236
29 3300042616 Ga0466715_101664 Ga0466715_101664_2574_3284 236
30 3300002834 JGI24696J40584_12778140 JGI24696J40584_127781401 237
31 3300010882 Ga0123354_10153035 Ga0123354_101530352 237
32 3300042599 Ga0466706_052335 Ga0466706_052335_4308_5054 237
33 3300042601 Ga0466707_233193 Ga0466707_233193_7371_8084 237
34 iso_pr_bacteria 2820280018 2820281514 237
35 3300009826 Ga0123355_10000364 Ga0123355_100003646 238
36 3300009826 Ga0123355_10007403 Ga0123355_100074035 238
37 3300010167 Ga0123353_10322480 Ga0123353_103224802 238
38 3300010882 Ga0123354_10263511 Ga0123354_102635112 238
39 3300042616 Ga0466715_296460 Ga0466715_296460_434_1150 238
40 3300002504 JGI24705J35276_12188508 JGI24705J35276_121885082 239
41 3300056564 Ga0530661_002377 Ga0530661_002377_3684_4403 239
42 3300056856 Ga0562375_0018 Ga0562375_0018_370535_371254 239
43 iso_pr_bacteria 2563367190 2565789147 239
44 iso_pr_bacteria 2576861701 2579273790 239
45 iso_pr_bacteria 2595698190 2596206500 239
46 iso_pr_bacteria 2595698193 2596211912 239
47 iso_pr_bacteria 2595698194 2596212352 239
48 iso_pr_bacteria 2595698195 2596215588 239
49 iso_pr_bacteria 2595698196 2596217415 239
50 iso_pr_bacteria 2595698197 2596219251 239
51 iso_pr_bacteria 2595698198 2596221083 239
52 iso_pr_bacteria 2595698199 2596222888 239
53 iso_pr_bacteria 2627853628 2628281297 239
54 iso_pr_bacteria 2852337885 2852338323 239
55 iso_pr_bacteria 650716050 650845900 239
56 iso_pr_bacteria 8012939035 8012940928 239
57 iso_pr_bacteria 8061045771 8061047463 239
58 3300010167 Ga0123353_10000332 Ga0123353_100003324 240
59 3300042652 Ga0466708_129204 Ga0466708_129204_529_1251 240
60 iso_pr_bacteria 2822232166 2822232578 240
61 iso_pr_bacteria 2822450720 2822453360 240
62 iso_pr_bacteria 2827179085 2827182876 240
63 3300012834 Ga0160452_100291 Ga0160452_10029124 241
64 3300042602 Ga0466713_064266 Ga0466713_064266_546_1271 241
65 3300042619 Ga0466726_422686 Ga0466726_422686_1054_1779 241
66 3300042621 Ga0466729_213371 Ga0466729_213371_43_768 241
67 3300056564 Ga0530661_000547 Ga0530661_000547_16606_17331 241
68 3300042592 Ga0466693_227140 Ga0466693_227140_1086_1814 242
69 3300042614 Ga0466712_074731 Ga0466712_074731_3018_3746 242
70 3300042616 Ga0466715_180208 Ga0466715_180208_2757_3485 242
71 3300042590 Ga0466690_061637 Ga0466690_061637_1610_2341 243
72 3300042599 Ga0466706_137482 Ga0466706_137482_552_1283 243
73 3300042659 Ga0466733_120828 Ga0466733_120828_944_1675 243
74 iso_pr_bacteria 8007237282 8007238210 243
75 iso_pr_bacteria 8114541043 8114544030 243
76 3300000062 IMNBL1DRAFT_c0001959 IMNBL1DRAFT_00019597 244
77 3300010882 Ga0123354_10293180 Ga0123354_102931802 244
78 3300042603 Ga0466714_018776 Ga0466714_018776_5406_6140 244
79 3300042615 Ga0466711_082375 Ga0466711_082375_2423_3157 244
80 3300042615 Ga0466711_307281 Ga0466711_307281_5277_6011 244
81 3300042616 Ga0466715_044661 Ga0466715_044661_434_1168 244
82 3300042616 Ga0466715_045581 Ga0466715_045581_9933_10667 244
83 3300056564 Ga0530661_000027 Ga0530661_000027_7388_8122 244
84 3300056564 Ga0530661_002110 Ga0530661_002110_3715_4449 244
85 3300056856 Ga0562375_0118 Ga0562375_0118_163842_164576 244
86 3300057007 Ga0562374_0565 Ga0562374_0565_54468_55202 244
87 iso_pr_bacteria 2820398208 2820399828 244
88 3300000062 IMNBL1DRAFT_c0006000 IMNBL1DRAFT_00060004 245
89 3300042612 Ga0466705_519925 Ga0466705_519925_31595_32332 245
90 3300000062 IMNBL1DRAFT_c0000717 IMNBL1DRAFT_000071710 246
91 3300002462 JGI24702J35022_10144983 JGI24702J35022_101449831 246
92 3300042610 Ga0466698_096028 Ga0466698_096028_2291_3031 246
93 3300042643 Ga0466704_249649 Ga0466704_249649_5253_5993 246
94 3300005071 Ga0068302_10070142 Ga0068302_100701422 247
95 3300009784 Ga0123357_10026727 Ga0123357_100267278 247
96 3300010049 Ga0123356_10020109 Ga0123356_100201093 247
97 3300010167 Ga0123353_10035666 Ga0123353_100356662 247
98 3300010167 Ga0123353_11354364 Ga0123353_113543642 247
99 iso_pr_bacteria 2820587002 2820589993 247
100 3300009826 Ga0123355_10025775 Ga0123355_100257752 248
101 3300009826 Ga0123355_10124824 Ga0123355_101248242 248
102 3300010049 Ga0123356_10047050 Ga0123356_100470502 248
103 3300010167 Ga0123353_11051442 Ga0123353_110514422 248
104 3300042594 Ga0466694_135302 Ga0466694_135302_441_1187 248
105 3300042619 Ga0466726_452863 Ga0466726_452863_3080_3826 248
106 3300042636 Ga0466703_255005 Ga0466703_255005_574_1320 248
107 3300042648 Ga0466709_100720 Ga0466709_100720_7652_8398 248
108 3300009826 Ga0123355_10199929 Ga0123355_101999292 249
109 3300042606 Ga0466719_405979 Ga0466719_405979_341_1090 249
110 3300042652 Ga0466708_262036 Ga0466708_262036_7664_8413 249
111 iso_pr_bacteria 2940228231 2940230089 249
112 3300010049 Ga0123356_10086449 Ga0123356_100864491 251
113 3300042621 Ga0466729_213213 Ga0466729_213213_2665_3420 251
114 3300042643 Ga0466704_428567 Ga0466704_428567_1435_2241 251
115 3300002504 JGI24705J35276_12237668 JGI24705J35276_122376685 252
116 3300010167 Ga0123353_11422971 Ga0123353_114229711 252
117 3300042615 Ga0466711_110937 Ga0466711_110937_2873_3631 252
118 3300042643 Ga0466704_298697 Ga0466704_298697_2918_3676 252
119 3300042615 Ga0466711_016730 Ga0466711_016730_204_965 253
120 3300010882 Ga0123354_10291122 Ga0123354_102911222 254
121 3300042599 Ga0466706_103383 Ga0466706_103383_610_1374 254
122 3300042603 Ga0466714_093722 Ga0466714_093722_278_1042 254
123 3300042659 Ga0466733_146375 Ga0466733_146375_6575_7339 254
124 3300042601 Ga0466707_075174 Ga0466707_075174_54438_55211 257
125 3300042616 Ga0466715_621324 Ga0466715_621324_1377_2153 258
126 3300042618 Ga0466723_028079 Ga0466723_028079_215_991 258
127 3300042619 Ga0466726_004082 Ga0466726_004082_4651_5427 258
128 3300042643 Ga0466704_335107 Ga0466704_335107_5007_5786 259
129 3300042635 Ga0466702_239362 Ga0466702_239362_598_1404 268

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5) 28 226 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF09704 GO:0043571 maintenance of CRISPR repeat elements BP

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3vzh-assembly1.cif.gz_A Crystal Structure of CRISPR-associated Protein 0.944 27 232
4f3m-assembly3.cif.gz_A Crystal structure of CRISPR-associated protein 0.927 25 247
4r0j-assembly1.cif.gz_A The crystal structure of a functionally uncharacterized protein SMU1763c from Streptococcus mutans 0.925 27 232
4f3m-assembly3.cif.gz_B Crystal structure of CRISPR-associated protein 0.901 24 250
8dfo-assembly1.cif.gz_A type I-C Cascade bound to AcrIC4 0.84 27 236
IDDescriptionScoreStartEndSuperfamily
4f3mB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9323 24 247 3.30.70.2660
4r0jA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9238 27 232 3.30.70.2660
3kg4A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.83 26 227 3.30.70.2660
3vziB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7981 21 231 3.30.70.2660
af_Q4CNT0_2_79_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7721 86 112 3.30.300.20
IDDescriptionScoreStartEndGO Terms
AF-X8J7V4-F1-model_v4 pre-crRNA processing endonuclease 0.9635 22 248 GO:0004519
GO:0016787
GO:0003723
GO:0051607
GO:0043571

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.