Protein Family IF09031

Metagenome Metatranscriptome Isolate
213 Members
58 Samples
203 Scaffolds
362.35 Avg Length

🧬 Representative Sequence

ID
3300042635|Ga0466702_015189|Ga0466702_015189_1238_2299
Length
353 aa
Sequence
MSEKVLMKGNDAIAEAAIRAGCGAYFGYPITPQNELIAYMAKNMLDKGRIFIQAESEIAAIIMVYGASCAGLRAMTSSSSPGISLKQEGMSYAAGADVPLVLVNVVRGGPGLGNIAPAQSDYMQSTRGGGHGDYRSIVLAPKSVQECADQTYLAFDLADKYRMPVIILADGMIGQMIEGVTLPPEKEPPKREWSVGNMASKKKAVHITSIDLVPERLEAQTKARFERYEKVKEAEIRFEENSCADADLVMVAYGTSSRVCLGAQMLAKKEGIKLGLFRPITLWPFPYEALGKIAAQGKPVLTVEMSEGQLVEDVKLSAFQAGAKNNIHLLAHSGGIIPTEEEVFAKAKEILKK

πŸ“Š Sample Types

Isolate 4.7%
Metagenome 94.8%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 42.9%
Kalotermitidae 25.0%
Unclassified 19.6%
Rhinotermitidae 7.1%
Termopsidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 206
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
2 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
13 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
14 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
20 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
21 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
22 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
23 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
31 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
41 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
42 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
43 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
44 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
45 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
46 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
50 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
51 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
52 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
53 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
55 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
56 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
57 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
58 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_086293 3300042612 Bacteria 3337
2 Ga0466705_210971 3300042612 Bacteria 12078
3 Ga0415639_027225 3300038395 Bacteria 1387
4 Ga0466690_050608 3300042590 Bacteria 16411
5 Ga0466692_107474 3300042591 Bacteria 5402
6 Ga0466693_410767 3300042592 Bacteria 1661
7 Ga0466691_006514 3300042593 Bacteria 12658
8 Ga0466691_027014 3300042593 Bacteria 1285
9 Ga0466691_110786 3300042593 Bacteria 5830
10 Ga0466694_268649 3300042594 Bacteria 30529
11 Ga0466696_039989 3300042596 Bacteria 12013
12 Ga0466696_329205 3300042596 Bacteria 9038
13 Ga0466699_044217 3300042597 Bacteria 6587
14 JGI24695J34938_10003783 3300002450 Bacteria 10307
15 JGI24695J34938_10030755 3300002450 Bacteria 2497
16 Ga0466718_164752 3300042617 Bacteria 4130
17 Ga0466726_178485 3300042619 Bacteria 1512
18 Ga0123353_10074768 3300010167 Bacteria 5446
19 Ga0123353_10611947 3300010167 Bacteria 1554
20 Ga0466730_038157 3300042625 Bacteria 1154
21 Ga0466703_023957 3300042636 Bacteria 4133
22 Ga0466704_170021 3300042643 Bacteria 6719
23 Ga0466727_157650 3300042655 Bacteria 11131
24 Ga0466716_003336 3300042605 Bacteria 2149
25 Ga0466720_135022 3300042607 Bacteria 4855
26 Ga0466720_172082 3300042607 Unclassified 2967
27 Ga0466705_253181 3300042612 Bacteria 6539
28 Ga0223687_100376 3300021217 Bacteria 1138
29 Ga0264413_100675 3300024493 Bacteria 52863
30 Ga0466690_155651 3300042590 Bacteria 10688
31 Ga0466692_138827 3300042591 Bacteria 1603
32 Ga0466693_023818 3300042592 Bacteria 15300
33 Ga0466691_121254 3300042593 Bacteria 16039
34 AustNasuHG_c1000135 3300000089 Bacteria 22970
35 AustNasuHG_c1014546 3300000089 Bacteria 2672
36 JGI24695J34938_10009476 3300002450 Bacteria 5413
37 JGI24695J34938_10073124 3300002450 Bacteria 1428
38 Ga0466711_030716 3300042615 Bacteria 19173
39 Ga0466711_136100 3300042615 Bacteria 7327
40 Ga0466718_153082 3300042617 Bacteria 1344
41 Ga0466723_011294 3300042618 Bacteria 53611
42 Ga0123357_10185937 3300009784 Bacteria 2411
43 Ga0123356_10424105 3300010049 Bacteria 1473
44 Ga0466703_161480 3300042636 Bacteria 28463
45 Ga0466708_059682 3300042652 Bacteria 15983
46 Ga0466706_194410 3300042599 Bacteria 6028
47 Ga0466713_014972 3300042602 Bacteria 1362
48 Ga0466722_075469 3300042609 Bacteria 5149
49 Ga0466722_080196 3300042609 Bacteria 4429
50 Ga0466722_167162 3300042609 Bacteria 10567
51 Ga0466722_263493 3300042609 Bacteria 4318
52 Ga0264413_101463 3300024493 Bacteria 9391
53 Ga0466692_030327 3300042591 Bacteria 3140
54 Ga0466692_046498 3300042591 Bacteria 16917
55 Ga0466691_013286 3300042593 Bacteria 5352
56 Ga0466695_220293 3300042595 Bacteria 1581
57 Ga0466699_272911 3300042597 Bacteria 4868
58 Ga0466699_294460 3300042597 Bacteria 2588
59 JGI24695J34938_10000048 3300002450 Bacteria 91577
60 JGI24695J34938_10001343 3300002450 Bacteria 21253
61 Ga0466711_153118 3300042615 Bacteria 2069
62 Ga0466715_508524 3300042616 Unclassified 2532
63 Ga0466718_063151 3300042617 Bacteria 1151
64 Ga0466723_296272 3300042618 Bacteria 6055
65 Ga0466726_122771 3300042619 Bacteria 5589
66 Ga0466726_339688 3300042619 Bacteria 4574
67 Ga0466726_466054 3300042619 Bacteria 4237
68 Ga0123356_10000059 3300010049 Bacteria 117133
69 Ga0123353_10082593 3300010167 Bacteria 5168
70 Ga0123353_10528414 3300010167 Bacteria 1709
71 Ga0466704_035234 3300042643 Bacteria 3438
72 Ga0466704_119486 3300042643 Bacteria 3229
73 Ga0466709_041394 3300042648 Bacteria 16988
74 Ga0466709_227983 3300042648 Bacteria 10490
75 Ga0466708_209929 3300042652 Bacteria 22287
76 Ga0466727_222092 3300042655 Bacteria 3428
77 Ga0466720_048449 3300042607 Unclassified 1760
78 Ga0264413_100676 3300024493 Bacteria 7753
79 Ga0456237_0007860 3300041968 Unclassified 1631
80 Ga0466694_024974 3300042594 Bacteria 29638
81 Ga0466694_029819 3300042594 Bacteria 1446
82 Ga0466694_119073 3300042594 Bacteria 2437
83 Ga0466696_304377 3300042596 Bacteria 4821
84 Ga0466696_396422 3300042596 Bacteria 1526
85 Ga0466699_403811 3300042597 Bacteria 9279
86 Ga0072941_1013730 3300005201 Bacteria 14915
87 Ga0466712_062399 3300042614 Bacteria 1508
88 Ga0466711_394207 3300042615 Bacteria 10941
89 Ga0466723_088339 3300042618 Bacteria 2428
90 Ga0466723_237253 3300042618 Bacteria 3874
91 Ga0466726_224555 3300042619 Bacteria 8011
92 Ga0466728_101158 3300042620 Bacteria 7513
93 Ga0466728_356316 3300042620 Bacteria 6303
94 Ga0466729_249938 3300042621 Bacteria 1714
95 Ga0466702_015189 3300042635 Bacteria 6131
96 Ga0466703_025784 3300042636 Bacteria 9815
97 Ga0466703_314709 3300042636 Bacteria 6827
98 Ga0466704_198864 3300042643 Bacteria 4218
99 Ga0466709_353295 3300042648 Bacteria 7078
100 Ga0466708_037942 3300042652 Bacteria 2983
101 Ga0466722_167562 3300042609 Bacteria 2796
102 Ga0466705_241169 3300042612 Bacteria 18952
103 Ga0466732_054799 3300042656 Bacteria 38151
104 Ga0466733_083144 3300042659 Bacteria 1729
105 Ga0456237_0002871 3300041968 Bacteria 2796
106 Ga0466690_131904 3300042590 Unclassified 7775
107 Ga0466692_127392 3300042591 Bacteria 10743
108 Ga0466692_135679 3300042591 Bacteria 12494
109 Ga0466693_187683 3300042592 Bacteria 64758
110 Ga0466691_015410 3300042593 Bacteria 9318
111 Ga0466699_178630 3300042597 Bacteria 1431
112 Ga0466699_419178 3300042597 Bacteria 17419
113 JGI24698J34947_10003808 3300002449 Bacteria 8219
114 JGI24696J40584_12951473 3300002834 Bacteria 2248
115 Ga0466712_061426 3300042614 Unclassified 1765
116 Ga0466712_062408 3300042614 Bacteria 9799
117 Ga0466711_109103 3300042615 Bacteria 16915
118 Ga0466723_065698 3300042618 Bacteria 2730
119 Ga0466723_071185 3300042618 Bacteria 53854
120 Ga0466723_109373 3300042618 Bacteria 9822
121 Ga0466726_174911 3300042619 Bacteria 5892
122 Ga0466726_233407 3300042619 Bacteria 6256
123 Ga0466726_489090 3300042619 Bacteria 5911
124 Ga0466728_337586 3300042620 Bacteria 3420
125 Ga0123353_10010965 3300010167 Bacteria 12713
126 Ga0123353_10303995 3300010167 Bacteria 2433
127 Ga0466702_160761 3300042635 Bacteria 6932
128 Ga0466703_200148 3300042636 Bacteria 16464
129 Ga0466703_370479 3300042636 Bacteria 72306
130 Ga0466704_263754 3300042643 Bacteria 34688
131 Ga0466709_019038 3300042648 Bacteria 10439
132 Ga0466708_283378 3300042652 Bacteria 3764
133 Ga0466727_061387 3300042655 Bacteria 3300
134 Ga0466717_054594 3300042604 Bacteria 2378
135 Ga0466716_240321 3300042605 Bacteria 1820
136 Ga0466719_014192 3300042606 Bacteria 9128
137 Ga0466719_015498 3300042606 Bacteria 9322
138 Ga0466722_108234 3300042609 Bacteria 4076
139 Ga0456237_0000425 3300041968 Bacteria 6382
140 Ga0466692_107443 3300042591 Bacteria 1450
141 Ga0466692_112428 3300042591 Bacteria 3787
142 Ga0466693_121162 3300042592 Bacteria 2241
143 Ga0466691_027913 3300042593 Bacteria 52900
144 Ga0466696_192002 3300042596 Bacteria 11633
145 JGI24695J34938_10000137 3300002450 Bacteria 66242
146 Ga0074263_113663 3300005485 Bacteria 3269
147 Ga0466712_247660 3300042614 Bacteria 8293
148 Ga0466715_165751 3300042616 Bacteria 3424
149 Ga0466718_104039 3300042617 Bacteria 3403
150 Ga0123356_10418338 3300010049 Bacteria 1482
151 Ga0123353_10679895 3300010167 Bacteria 1450
152 Ga0466719_539018 3300042606 Bacteria 14735
153 Ga0466720_000962 3300042607 Bacteria 4576
154 Ga0415639_095575 3300038395 Unclassified 1707
155 Ga0466690_029986 3300042590 Bacteria 7139
156 Ga0466692_148882 3300042591 Bacteria 1407
157 Ga0466693_207622 3300042592 Bacteria 1268
158 Ga0466696_096338 3300042596 Bacteria 6303
159 Ga0466699_398496 3300042597 Bacteria 26587
160 AustNasuHG_c1007376 3300000089 Bacteria 3914
161 JGI24698J34947_10003831 3300002449 Bacteria 8189
162 JGI24695J34938_10001829 3300002450 Bacteria 17383
163 JGI24695J34938_10008580 3300002450 Bacteria 5810
164 Ga0072940_1127670 3300005200 Bacteria 1990
165 Ga0466711_196498 3300042615 Bacteria 2035
166 Ga0466715_088707 3300042616 Bacteria 3025
167 Ga0466715_096965 3300042616 Bacteria 2973
168 Ga0466723_035078 3300042618 Bacteria 74340
169 Ga0466723_165588 3300042618 Bacteria 2459
170 Ga0466726_050757 3300042619 Bacteria 1708
171 Ga0466726_261634 3300042619 Bacteria 1245
172 Ga0466726_335378 3300042619 Bacteria 2747
173 Ga0123353_10026461 3300010167 Bacteria 8860
174 Ga0466703_108586 3300042636 Bacteria 3096
175 Ga0466704_431663 3300042643 Bacteria 11076
176 Ga0466708_161973 3300042652 Bacteria 41034
177 Ga0466708_231994 3300042652 Bacteria 19095
178 Ga0466708_290798 3300042652 Bacteria 2958
179 Ga0466732_055294 3300042656 Bacteria 5843
180 Ga0466733_017112 3300042659 Bacteria 2376
181 Ga0466733_191093 3300042659 Bacteria 1807
182 Ga0264413_100674 3300024493 Bacteria 17366
183 Ga0264413_101139 3300024493 Bacteria 4468
184 Ga0466692_082197 3300042591 Bacteria 8006
185 Ga0466692_142514 3300042591 Bacteria 23774
186 Ga0466692_187653 3300042591 Bacteria 1978
187 Ga0466693_002405 3300042592 Bacteria 54310
188 Ga0466691_104347 3300042593 Bacteria 19831
189 Ga0466699_272603 3300042597 Bacteria 1290
190 AustNasuHG_c1018887 3300000089 Bacteria 2268
191 JGI24698J34947_10001100 3300002449 Bacteria 13934
192 JGI24698J34947_10068616 3300002449 Bacteria 1714
193 JGI24695J34938_10000266 3300002450 Bacteria 50844
194 Ga0466715_046154 3300042616 Bacteria 2298
195 Ga0466726_165702 3300042619 Bacteria 7153
196 Ga0123356_10228106 3300010049 Bacteria 1924
197 Ga0123353_10045837 3300010167 Bacteria 6943
198 Ga0123353_10456414 3300010167 Bacteria 1879
199 Ga0466709_363533 3300042648 Bacteria 1760
200 Ga0466708_040343 3300042652 Bacteria 5964
201 Ga0466719_525115 3300042606 Bacteria 18067
202 Ga0466722_003775 3300042609 Bacteria 3801
203 Ga0466698_059742 3300042610 Bacteria 1739

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042621 Ga0466729_249938 Ga0466729_249938_587_1690 325
2 3300042594 Ga0466694_268649 Ga0466694_268649_2417_3457 346
3 3300042614 Ga0466712_061426 Ga0466712_061426_243_1283 346
4 3300042614 Ga0466712_062399 Ga0466712_062399_310_1350 346
5 3300002449 JGI24698J34947_10003831 JGI24698J34947_100038314 347
6 3300010049 Ga0123356_10228106 Ga0123356_102281062 347
7 3300010167 Ga0123353_10074768 Ga0123353_100747684 347
8 3300021217 Ga0223687_100376 Ga0223687_1003761 347
9 3300042614 Ga0466712_062408 Ga0466712_062408_4116_5159 347
10 3300042614 Ga0466712_247660 Ga0466712_247660_1775_2818 347
11 3300042617 Ga0466718_063151 Ga0466718_063151_29_1075 348
12 3300042617 Ga0466718_104039 Ga0466718_104039_911_1957 348
13 3300042656 Ga0466732_055294 Ga0466732_055294_1751_2797 348
14 3300010167 Ga0123353_10026461 Ga0123353_100264617 349
15 3300010049 Ga0123356_10418338 Ga0123356_104183382 350
16 3300010167 Ga0123353_10528414 Ga0123353_105284141 350
17 3300042594 Ga0466694_119073 Ga0466694_119073_251_1303 350
18 3300041968 Ga0456237_0002871 Ga0456237_0002871_390_1445 351
19 3300042596 Ga0466696_396422 Ga0466696_396422_386_1495 351
20 3300042619 Ga0466726_466054 Ga0466726_466054_1525_2580 351
21 3300042595 Ga0466695_220293 Ga0466695_220293_122_1180 352
22 iso_pr_bacteria 2781125691 2781429234 352
23 3300042591 Ga0466692_142514 Ga0466692_142514_14188_15249 353
24 3300042592 Ga0466693_187683 Ga0466693_187683_63120_64181 353
25 3300042597 Ga0466699_294460 Ga0466699_294460_1345_2457 353
26 3300042635 Ga0466702_015189 Ga0466702_015189_1238_2299 353
27 iso_pr_bacteria 2781125690 2781428782 353
28 3300000089 AustNasuHG_c1018887 AustNasuHG_10188873 354
29 3300002449 JGI24698J34947_10003808 JGI24698J34947_100038089 354
30 3300002834 JGI24696J40584_12951473 JGI24696J40584_129514732 354
31 3300005201 Ga0072941_1013730 Ga0072941_101373014 354
32 3300024493 Ga0264413_100674 Ga0264413_10067421 354
33 3300024493 Ga0264413_101139 Ga0264413_1011394 354
34 3300042635 Ga0466702_160761 Ga0466702_160761_5729_6793 354
35 3300042659 Ga0466733_083144 Ga0466733_083144_380_1444 354
36 3300042659 Ga0466733_191093 Ga0466733_191093_525_1589 354
37 iso_pr_bacteria 2781125634 2781276108 354
38 iso_pr_bacteria 2781125660 2781330162 354
39 3300000089 AustNasuHG_c1014546 AustNasuHG_10145465 355
40 3300002449 JGI24698J34947_10068616 JGI24698J34947_100686162 355
41 3300002450 JGI24695J34938_10000048 JGI24695J34938_1000004853 355
42 3300002450 JGI24695J34938_10073124 JGI24695J34938_100731242 355
43 3300010049 Ga0123356_10000059 Ga0123356_1000005969 355
44 3300038395 Ga0415639_027225 Ga0415639_027225_169_1236 355
45 3300038395 Ga0415639_095575 Ga0415639_095575_40_1107 355
46 3300041968 Ga0456237_0000425 Ga0456237_0000425_2566_3633 355
47 3300041968 Ga0456237_0007860 Ga0456237_0007860_121_1227 355
48 3300042591 Ga0466692_107474 Ga0466692_107474_3828_4895 355
49 3300042597 Ga0466699_178630 Ga0466699_178630_152_1219 355
50 3300042606 Ga0466719_015498 Ga0466719_015498_5998_7089 355
51 3300042625 Ga0466730_038157 Ga0466730_038157_58_1125 355
52 3300042652 Ga0466708_209929 Ga0466708_209929_7534_8601 355
53 3300042659 Ga0466733_017112 Ga0466733_017112_115_1182 355
54 iso_pr_bacteria 2781125635 2781278171 355
55 iso_pr_bacteria 2781125645 2781299584 355
56 3300002449 JGI24698J34947_10001100 JGI24698J34947_1000110011 356
57 3300002450 JGI24695J34938_10000266 JGI24695J34938_1000026613 356
58 3300002450 JGI24695J34938_10001343 JGI24695J34938_1000134319 356
59 3300002450 JGI24695J34938_10001829 JGI24695J34938_100018295 356
60 3300010049 Ga0123356_10424105 Ga0123356_104241052 356
61 3300042597 Ga0466699_044217 Ga0466699_044217_999_2069 356
62 3300042609 Ga0466722_075469 Ga0466722_075469_1563_2633 356
63 3300042617 Ga0466718_153082 Ga0466718_153082_31_1101 356
64 3300042591 Ga0466692_112428 Ga0466692_112428_1019_2092 357
65 3300042592 Ga0466693_002405 Ga0466693_002405_9846_10919 357
66 3300042592 Ga0466693_207622 Ga0466693_207622_19_1092 357
67 3300042592 Ga0466693_410767 Ga0466693_410767_329_1402 357
68 3300042594 Ga0466694_024974 Ga0466694_024974_14568_15641 357
69 3300042609 Ga0466722_263493 Ga0466722_263493_1845_2918 357
70 3300042618 Ga0466723_109373 Ga0466723_109373_3519_4592 357
71 3300002450 JGI24695J34938_10000137 JGI24695J34938_100001374 358
72 3300002450 JGI24695J34938_10008580 JGI24695J34938_100085805 358
73 3300010167 Ga0123353_10303995 Ga0123353_103039952 358
74 3300024493 Ga0264413_100675 Ga0264413_10067529 358
75 3300042591 Ga0466692_030327 Ga0466692_030327_1201_2277 358
76 3300042591 Ga0466692_082197 Ga0466692_082197_5376_6452 358
77 3300042591 Ga0466692_187653 Ga0466692_187653_81_1157 358
78 3300042602 Ga0466713_014972 Ga0466713_014972_124_1200 358
79 3300042605 Ga0466716_003336 Ga0466716_003336_272_1348 358
80 3300042609 Ga0466722_108234 Ga0466722_108234_1401_2477 358
81 3300042609 Ga0466722_167562 Ga0466722_167562_175_1251 358
82 3300042619 Ga0466726_050757 Ga0466726_050757_241_1317 358
83 3300042619 Ga0466726_165702 Ga0466726_165702_1530_2606 358
84 3300042620 Ga0466728_337586 Ga0466728_337586_1858_2934 358
85 3300042636 Ga0466703_370479 Ga0466703_370479_44860_45936 358
86 iso_pr_bacteria 2781125636 2781280629 358
87 iso_pr_bacteria 2781125646 2781302184 358
88 3300002450 JGI24695J34938_10003783 JGI24695J34938_100037836 359
89 3300005200 Ga0072940_1127670 Ga0072940_11276703 359
90 3300042593 Ga0466691_027014 Ga0466691_027014_67_1146 359
91 3300042599 Ga0466706_194410 Ga0466706_194410_1420_2499 359
92 3300042609 Ga0466722_003775 Ga0466722_003775_2220_3299 359
93 3300042636 Ga0466703_025784 Ga0466703_025784_8399_9478 359
94 3300042652 Ga0466708_283378 Ga0466708_283378_81_1160 359
95 3300000089 AustNasuHG_c1000135 AustNasuHG_10001354 360
96 3300042591 Ga0466692_135679 Ga0466692_135679_3464_4546 360
97 3300042593 Ga0466691_013286 Ga0466691_013286_2299_3381 360
98 3300042604 Ga0466717_054594 Ga0466717_054594_1095_2177 360
99 3300042619 Ga0466726_174911 Ga0466726_174911_1792_2874 360
100 iso_pr_bacteria 2772190978 2773731256 360
101 3300010167 Ga0123353_10010965 Ga0123353_100109653 361
102 3300042590 Ga0466690_050608 Ga0466690_050608_9677_10762 361
103 3300042592 Ga0466693_023818 Ga0466693_023818_1567_2652 361
104 3300042592 Ga0466693_121162 Ga0466693_121162_304_1389 361
105 3300042593 Ga0466691_121254 Ga0466691_121254_3405_4490 361
106 3300042594 Ga0466694_029819 Ga0466694_029819_36_1121 361
107 3300042596 Ga0466696_329205 Ga0466696_329205_277_1362 361
108 3300042615 Ga0466711_030716 Ga0466711_030716_3119_4204 361
109 3300042616 Ga0466715_508524 Ga0466715_508524_449_1534 361
110 3300042618 Ga0466723_071185 Ga0466723_071185_34256_35341 361
111 iso_pr_bacteria 2781125639 2781285787 361
112 3300002450 JGI24695J34938_10009476 JGI24695J34938_100094765 362
113 3300002450 JGI24695J34938_10030755 JGI24695J34938_100307552 362
114 3300010167 Ga0123353_10456414 Ga0123353_104564142 362
115 3300042607 Ga0466720_000962 Ga0466720_000962_1264_2352 362
116 3300042607 Ga0466720_048449 Ga0466720_048449_139_1227 362
117 3300042607 Ga0466720_135022 Ga0466720_135022_3152_4240 362
118 3300042607 Ga0466720_172082 Ga0466720_172082_1264_2352 362
119 3300042616 Ga0466715_088707 Ga0466715_088707_47_1231 362
120 3300042636 Ga0466703_161480 Ga0466703_161480_8989_10077 362
121 3300042656 Ga0466732_054799 Ga0466732_054799_34347_35435 362
122 3300005485 Ga0074263_113663 Ga0074263_1136633 363
123 3300010167 Ga0123353_10082593 Ga0123353_100825933 363
124 3300042590 Ga0466690_155651 Ga0466690_155651_3453_4544 363
125 3300042593 Ga0466691_006514 Ga0466691_006514_5880_6971 363
126 3300042612 Ga0466705_210971 Ga0466705_210971_6192_7283 363
127 3300042620 Ga0466728_101158 Ga0466728_101158_899_1990 363
128 3300042636 Ga0466703_108586 Ga0466703_108586_460_1551 363
129 3300042636 Ga0466703_200148 Ga0466703_200148_124_1215 363
130 3300042643 Ga0466704_431663 Ga0466704_431663_5080_6171 363
131 3300042648 Ga0466709_353295 Ga0466709_353295_240_1331 363
132 3300042648 Ga0466709_363533 Ga0466709_363533_162_1253 363
133 3300042652 Ga0466708_290798 Ga0466708_290798_1253_2344 363
134 3300042615 Ga0466711_109103 Ga0466711_109103_6791_7885 364
135 3300042616 Ga0466715_046154 Ga0466715_046154_957_2051 364
136 3300042619 Ga0466726_233407 Ga0466726_233407_724_1818 364
137 3300042655 Ga0466727_222092 Ga0466727_222092_2038_3132 364
138 3300010167 Ga0123353_10611947 Ga0123353_106119472 365
139 3300010167 Ga0123353_10679895 Ga0123353_106798952 365
140 3300042590 Ga0466690_131904 Ga0466690_131904_5769_6866 365
141 3300042591 Ga0466692_107443 Ga0466692_107443_324_1421 365
142 3300042593 Ga0466691_027913 Ga0466691_027913_15949_17046 365
143 3300042618 Ga0466723_088339 Ga0466723_088339_618_1715 365
144 3300009784 Ga0123357_10185937 Ga0123357_101859372 366
145 3300042591 Ga0466692_046498 Ga0466692_046498_8862_9962 366
146 3300042591 Ga0466692_148882 Ga0466692_148882_84_1184 366
147 3300042596 Ga0466696_192002 Ga0466696_192002_8780_9880 366
148 3300042609 Ga0466722_167162 Ga0466722_167162_2406_3506 366
149 3300042612 Ga0466705_086293 Ga0466705_086293_1688_2824 366
150 3300042612 Ga0466705_253181 Ga0466705_253181_4239_5339 366
151 3300042616 Ga0466715_096965 Ga0466715_096965_332_1432 366
152 3300042619 Ga0466726_122771 Ga0466726_122771_3955_5055 366
153 3300042619 Ga0466726_335378 Ga0466726_335378_1293_2393 366
154 3300042643 Ga0466704_170021 Ga0466704_170021_3854_4954 366
155 3300042591 Ga0466692_127392 Ga0466692_127392_2306_3409 367
156 3300042618 Ga0466723_065698 Ga0466723_065698_1129_2232 367
157 3300042652 Ga0466708_059682 Ga0466708_059682_9679_10860 367
158 3300042655 Ga0466727_061387 Ga0466727_061387_1887_2990 367
159 3300024493 Ga0264413_100676 Ga0264413_1006765 368
160 3300024493 Ga0264413_101463 Ga0264413_10146310 368
161 3300042591 Ga0466692_138827 Ga0466692_138827_319_1425 368
162 3300042597 Ga0466699_272603 Ga0466699_272603_72_1178 368
163 3300042615 Ga0466711_196498 Ga0466711_196498_29_1135 368
164 3300042643 Ga0466704_198864 Ga0466704_198864_286_1392 368
165 3300042648 Ga0466709_019038 Ga0466709_019038_1961_3103 368
166 3300042596 Ga0466696_304377 Ga0466696_304377_867_1976 369
167 3300042597 Ga0466699_419178 Ga0466699_419178_8747_9856 369
168 3300042606 Ga0466719_539018 Ga0466719_539018_5907_7016 369
169 3300042609 Ga0466722_080196 Ga0466722_080196_1994_3103 369
170 3300042636 Ga0466703_023957 Ga0466703_023957_2468_3577 369
171 3300042643 Ga0466704_119486 Ga0466704_119486_839_1948 369
172 3300010167 Ga0123353_10045837 Ga0123353_100458376 370
173 3300042593 Ga0466691_015410 Ga0466691_015410_5736_6848 370
174 3300042593 Ga0466691_110786 Ga0466691_110786_620_1732 370
175 3300042597 Ga0466699_272911 Ga0466699_272911_3129_4241 370
176 3300042612 Ga0466705_241169 Ga0466705_241169_15248_16360 370
177 3300042618 Ga0466723_011294 Ga0466723_011294_7068_8180 370
178 3300042643 Ga0466704_263754 Ga0466704_263754_3835_4947 370
179 3300042655 Ga0466727_157650 Ga0466727_157650_9580_10692 370
180 3300042619 Ga0466726_224555 Ga0466726_224555_384_1499 371
181 3300042593 Ga0466691_104347 Ga0466691_104347_5711_6829 372
182 3300042597 Ga0466699_403811 Ga0466699_403811_4017_5135 372
183 3300042616 Ga0466715_165751 Ga0466715_165751_1582_2703 373
184 3300042618 Ga0466723_035078 Ga0466723_035078_58603_59724 373
185 3300042648 Ga0466709_041394 Ga0466709_041394_11618_12739 373
186 3300042652 Ga0466708_040343 Ga0466708_040343_3403_4551 373
187 3300042652 Ga0466708_161973 Ga0466708_161973_24724_25845 373
188 3300042652 Ga0466708_231994 Ga0466708_231994_15628_16776 373
189 3300042606 Ga0466719_525115 Ga0466719_525115_5517_6641 374
190 3300042615 Ga0466711_136100 Ga0466711_136100_2153_3280 375
191 3300042618 Ga0466723_237253 Ga0466723_237253_13_1140 375
192 3300042619 Ga0466726_489090 Ga0466726_489090_4022_5149 375
193 3300042590 Ga0466690_029986 Ga0466690_029986_3750_4880 376
194 3300042606 Ga0466719_014192 Ga0466719_014192_1156_2286 376
195 3300042619 Ga0466726_339688 Ga0466726_339688_2982_4115 377
196 3300042615 Ga0466711_153118 Ga0466711_153118_737_1873 378
197 3300042619 Ga0466726_178485 Ga0466726_178485_267_1403 378
198 3300042596 Ga0466696_039989 Ga0466696_039989_1597_2736 379
199 3300042610 Ga0466698_059742 Ga0466698_059742_151_1290 379
200 3300042615 Ga0466711_394207 Ga0466711_394207_2974_4113 379
201 3300042619 Ga0466726_261634 Ga0466726_261634_20_1159 379
202 3300042617 Ga0466718_164752 Ga0466718_164752_1814_2959 381
203 3300042596 Ga0466696_096338 Ga0466696_096338_1635_2783 382
204 3300042597 Ga0466699_398496 Ga0466699_398496_15172_16320 382
205 3300042618 Ga0466723_165588 Ga0466723_165588_564_1712 382
206 3300042636 Ga0466703_314709 Ga0466703_314709_4678_5826 382
207 3300042605 Ga0466716_240321 Ga0466716_240321_634_1788 384
208 3300042620 Ga0466728_356316 Ga0466728_356316_4513_5739 385
209 3300042643 Ga0466704_035234 Ga0466704_035234_1122_2285 387
210 3300042648 Ga0466709_227983 Ga0466709_227983_9115_10284 389
211 3300042652 Ga0466708_037942 Ga0466708_037942_1595_2767 390
212 3300000089 AustNasuHG_c1007376 AustNasuHG_10073764 394
213 3300042618 Ga0466723_296272 Ga0466723_296272_1894_3117 407

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II 246 343 0.96
PF02780 Transketolase_C Transketolase, C-terminal domain 244 304 0.95
PF01855 POR_N Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg 15 216 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01855 GO:0016491 oxidoreductase activity MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.