Protein Family IF08979
Metagenome
Isolate
231
Members
188
Samples
99
Scaffolds
341.24
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_061587|Ga0466730_061587_749_1897
- Length
- 382 aa
- Sequence
- VVSVTIGPSIYLTWSVKETVFILIMECVKWGKPVLTRIRVMKKIGFLSFGHWTPSSQSATRSAADTLLQSIDLAVAAEELGADGAYFRVHHFARQLSSPFPLLAAIGAKTKRIEIGTGVIDMRYENPMYMAEEASAADLISGGRLQLGISRGSPEQVIDGWRYFGYVPQEGENESDMARRHTEVLLEALRGEGFAKPNPQPMFPNPPGLLRLEPHSEGLRDRIWWGAGSNATAVWAAQLGMNLQSSTLKDDETGEPFHIQQAKQIRAYREAWAQAGHTRTPRVSVSRSIFALMNDRDRSYFGASRNDSDSVGFLDEKTRAIFGRSYAAEPDKLIDQLKQDEAIAEADTLLLTVPNQLGVDYNAHVIESILKHVAPALGWRDS
Sample Types
Isolate
57.1%
Metagenome
42.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
15.3%
Termitidae
8.5%
Culicidae
8.5%
Anthocoridae
7.9%
Muscidae
7.9%
Coreidae
7.9%
Drosophilidae
7.9%
Curculionidae
6.2%
Tenebrionidae
4.0%
Armadillidiidae
4.0%
Elmidae
2.8%
Scarabaeidae
2.3%
Cambaridae
1.7%
Cerambycidae
1.7%
Apidae
1.7%
Calliphoridae
1.7%
Aphididae
1.1%
Sarcophagidae
1.1%
Largidae
1.1%
Formicidae
1.1%
Thripidae
0.6%
Anthomyiidae
0.6%
Cimicidae
0.6%
Plutellidae
0.6%
Crambidae
0.6%
Daphniidae
0.6%
Thomisidae
0.6%
Hydrophilidae
0.6%
Reduviidae
0.6%
Tephritidae
0.6%
Taxonomy
Archaea
0
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 2 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 3 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 4 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 5 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 6 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 7 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 8 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 9 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 10 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 11 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 12 | 2958255616 | Serratia marcescens TM | Isolate | |
| 13 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 19 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 20 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 21 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 22 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 23 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 24 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 25 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 26 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 27 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 28 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 29 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 30 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 31 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 32 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 33 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 34 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 35 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 38 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 39 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 40 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 41 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 42 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 43 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 44 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 45 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 46 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 47 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 48 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 49 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 50 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 51 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 52 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 53 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 54 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 55 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 56 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 57 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 58 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 59 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 60 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 61 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 62 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 63 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 64 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 65 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 66 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 67 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 68 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 69 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 70 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 71 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 72 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 73 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 74 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 75 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 76 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 77 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 78 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 79 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 80 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 81 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 82 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 83 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 84 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 85 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 86 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 87 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 88 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 89 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 90 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 91 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 92 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 93 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 94 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 95 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 96 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 97 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 98 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 99 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 100 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 101 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 102 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 103 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 104 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 105 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 106 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 107 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 108 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 109 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 110 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 111 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 112 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 113 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 114 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 115 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 116 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 117 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 118 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 119 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 120 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 121 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 122 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 123 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 124 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 125 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 126 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 127 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 128 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 129 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 130 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 131 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 132 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 133 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 134 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 135 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 136 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 137 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 138 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 139 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 140 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 141 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 142 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 143 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 144 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 145 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 146 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 147 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 148 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 149 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 150 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 151 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 152 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 153 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 154 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 155 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 156 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 157 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 158 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 159 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 160 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 161 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 162 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 163 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 164 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 165 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 166 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 167 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 168 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 169 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 170 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 171 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 172 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 173 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 174 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 175 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 176 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 177 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 178 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 179 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 180 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 181 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 182 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 183 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 184 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 185 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 186 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 187 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 188 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | DPOL_contig00234 | 2035918003 | Bacteria | 11698 |
| 2 | FGTW_contig25759 | 2065487013 | Unclassified | 8189 |
| 3 | CVPL010L_1002744 | 3300002932 | Unclassified | 3041 |
| 4 | Ga0104049_1025004 | 3300007103 | Bacteria | 3335 |
| 5 | Ga0105005_1024968 | 3300007505 | Unclassified | 11864 |
| 6 | Ga0123355_10009012 | 3300009826 | Unclassified | 15124 |
| 7 | Ga0123356_10074150 | 3300010049 | Bacteria | 3201 |
| 8 | Ga0160465_100002 | 3300012803 | Bacteria | 834901 |
| 9 | Ga0466730_073669 | 3300042625 | Bacteria | 406091 |
| 10 | Ga0466730_091986 | 3300042625 | Bacteria | 1636 |
| 11 | Ga0466724_06048 | 3300042649 | Unclassified | 26129 |
| 12 | Ga0466724_14457 | 3300042649 | Unclassified | 137665 |
| 13 | Ga0466724_45081 | 3300042649 | Bacteria | 99888 |
| 14 | Ga0160447_103027 | 3300012849 | Bacteria | 5572 |
| 15 | Ga0160430_104927 | 3300012852 | Bacteria | 3181 |
| 16 | Ga0160457_1001637 | 3300012858 | Unclassified | 5830 |
| 17 | Ga0104045_1002470 | 3300007085 | Bacteria | 2318 |
| 18 | Ga0123355_10020226 | 3300009826 | Unclassified | 10623 |
| 19 | Ga0123356_10004020 | 3300010049 | Bacteria | 15266 |
| 20 | Ga0466724_47439 | 3300042649 | Bacteria | 410820 |
| 21 | Ga0160440_100657 | 3300012815 | Bacteria | 7994 |
| 22 | Ga0160432_100229 | 3300012818 | Bacteria | 47865 |
| 23 | Ga0160455_104790 | 3300012837 | Unclassified | 1580 |
| 24 | Ga0160472_101056 | 3300012839 | Unclassified | 9619 |
| 25 | Ga0160433_100127 | 3300012846 | Bacteria | 68773 |
| 26 | Ga0160457_1005859 | 3300012858 | Bacteria | 1846 |
| 27 | Ga0160457_1006584 | 3300012858 | Bacteria | 1724 |
| 28 | Ga0466701_103424 | 3300042598 | Unclassified | 117519 |
| 29 | Ga0562378_3801 | 3300056814 | Bacteria | 7819 |
| 30 | CVPL010L_1000006 | 3300002932 | Bacteria | 148663 |
| 31 | Ga0063521_1000457 | 3300003973 | Bacteria | 20381 |
| 32 | Ga0104051_1102961 | 3300007078 | Unclassified | 1696 |
| 33 | Ga0123356_10032651 | 3300010049 | Bacteria | 4870 |
| 34 | Ga0123353_10001155 | 3300010167 | Bacteria | 32219 |
| 35 | Ga0466730_041094 | 3300042625 | Unclassified | 9355 |
| 36 | Ga0466724_21836 | 3300042649 | Bacteria | 1615 |
| 37 | Ga0466724_48624 | 3300042649 | Unclassified | 6284 |
| 38 | Ga0160459_100628 | 3300012831 | Unclassified | 12670 |
| 39 | Ga0160446_100169 | 3300012835 | Bacteria | 50416 |
| 40 | Ga0160436_1000138 | 3300012861 | Bacteria | 37086 |
| 41 | Ga0316159_10278 | 3300030930 | Bacteria | 8439 |
| 42 | Ga0466710_302047 | 3300042613 | Bacteria | 3606 |
| 43 | FGTW_contig21348 | 2065487013 | Bacteria | 1581 |
| 44 | Ga0123355_10035632 | 3300009826 | Unclassified | 8087 |
| 45 | Ga0123356_10000321 | 3300010049 | Bacteria | 55175 |
| 46 | Ga0466730_075830 | 3300042625 | Unclassified | 50863 |
| 47 | Ga0160467_100823 | 3300012829 | Bacteria | 20487 |
| 48 | Ga0160459_103631 | 3300012831 | Bacteria | 2196 |
| 49 | Ga0160446_100103 | 3300012835 | Bacteria | 77158 |
| 50 | Ga0160472_100052 | 3300012839 | Bacteria | 192881 |
| 51 | Ga0160433_100310 | 3300012846 | Bacteria | 31416 |
| 52 | Ga0160434_110108 | 3300012850 | Bacteria | 1533 |
| 53 | Meta3P_1008852 | 3300002464 | Unclassified | 3646 |
| 54 | Ga0160471_100020 | 3300012812 | Bacteria | 340969 |
| 55 | Ga0466734_096875 | 3300042623 | Bacteria | 1577 |
| 56 | Ga0466725_019120 | 3300042654 | Bacteria | 2293 |
| 57 | Ga0160468_100172 | 3300012819 | Bacteria | 48018 |
| 58 | Ga0160455_100028 | 3300012837 | Bacteria | 333132 |
| 59 | Ga0160460_100023 | 3300012845 | Bacteria | 338828 |
| 60 | Ga0160445_100643 | 3300012847 | Unclassified | 14598 |
| 61 | Ga0160443_100006 | 3300012848 | Bacteria | 647325 |
| 62 | Ga0160434_100161 | 3300012850 | Bacteria | 34797 |
| 63 | Ga0265387_1000026 | 3300024582 | Bacteria | 60790 |
| 64 | Ga0466713_120225 | 3300042602 | Bacteria | 135023 |
| 65 | Ga0530661_000201 | 3300056564 | Bacteria | 50515 |
| 66 | Ga0562375_0559 | 3300056856 | Bacteria | 73847 |
| 67 | Ga0074188_1000288 | 3300005318 | Bacteria | 35346 |
| 68 | Ga0123355_10036228 | 3300009826 | Bacteria | 8022 |
| 69 | Ga0160442_100095 | 3300012806 | Bacteria | 101997 |
| 70 | Ga0160471_100257 | 3300012812 | Bacteria | 17526 |
| 71 | Ga0160441_100119 | 3300012825 | Bacteria | 90566 |
| 72 | Ga0160472_100081 | 3300012839 | Bacteria | 156805 |
| 73 | Ga0160443_100184 | 3300012848 | Bacteria | 84526 |
| 74 | Ga0247289_0041 | 3300035363 | Bacteria | 40105 |
| 75 | Ga0466657_127725 | 3300042582 | Bacteria | 62629 |
| 76 | Ga0562378_0014 | 3300056814 | Bacteria | 962225 |
| 77 | FGTW_contig31427 | 2065487013 | Bacteria | 4532 |
| 78 | Ga0063521_1000032 | 3300003973 | Bacteria | 118735 |
| 79 | Ga0063521_1001353 | 3300003973 | Unclassified | 6910 |
| 80 | Ga0123355_10020087 | 3300009826 | Bacteria | 10654 |
| 81 | Ga0123355_10106937 | 3300009826 | Unclassified | 4384 |
| 82 | Ga0160470_101895 | 3300012813 | Unclassified | 4445 |
| 83 | Ga0160452_100025 | 3300012834 | Bacteria | 245284 |
| 84 | Ga0160435_1000470 | 3300012857 | Unclassified | 13485 |
| 85 | Ga0247289_0187 | 3300035363 | Unclassified | 14097 |
| 86 | Ga0415639_073305 | 3300038395 | Bacteria | 2693 |
| 87 | Ga0466707_422806 | 3300042601 | Bacteria | 1598 |
| 88 | Ga0562375_1015 | 3300056856 | Bacteria | 44532 |
| 89 | Ga0562376_1567 | 3300056857 | Unclassified | 31408 |
| 90 | DPOL_contig14439 | 2035918003 | Bacteria | 12480 |
| 91 | Ga0104041_1001647 | 3300007106 | Unclassified | 11734 |
| 92 | Ga0104147_1012250 | 3300007224 | Bacteria | 9168 |
| 93 | Ga0123355_10522123 | 3300009826 | Bacteria | 1452 |
| 94 | Ga0123356_10005071 | 3300010049 | Bacteria | 13501 |
| 95 | Ga0123353_10043284 | 3300010167 | Unclassified | 7132 |
| 96 | Ga0466697_200239 | 3300042611 | Bacteria | 2099 |
| 97 | Ga0466730_061587 | 3300042625 | Bacteria | 10763 |
| 98 | Ga0160460_104572 | 3300012845 | Bacteria | 2099 |
| 99 | Ga0316159_10343 | 3300030930 | Bacteria | 9155 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00296 | Bac_luciferase | Luciferase-like monooxygenase | 48 | 291 | 0.86 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00296 | GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.