Protein Family IF08979

Metagenome Isolate
231 Members
188 Samples
99 Scaffolds
341.24 Avg Length

🧬 Representative Sequence

ID
3300042625|Ga0466730_061587|Ga0466730_061587_749_1897
Length
382 aa
Sequence
VVSVTIGPSIYLTWSVKETVFILIMECVKWGKPVLTRIRVMKKIGFLSFGHWTPSSQSATRSAADTLLQSIDLAVAAEELGADGAYFRVHHFARQLSSPFPLLAAIGAKTKRIEIGTGVIDMRYENPMYMAEEASAADLISGGRLQLGISRGSPEQVIDGWRYFGYVPQEGENESDMARRHTEVLLEALRGEGFAKPNPQPMFPNPPGLLRLEPHSEGLRDRIWWGAGSNATAVWAAQLGMNLQSSTLKDDETGEPFHIQQAKQIRAYREAWAQAGHTRTPRVSVSRSIFALMNDRDRSYFGASRNDSDSVGFLDEKTRAIFGRSYAAEPDKLIDQLKQDEAIAEADTLLLTVPNQLGVDYNAHVIESILKHVAPALGWRDS

📊 Sample Types

Isolate 57.1%
Metagenome 42.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 15.3%
Termitidae 8.5%
Culicidae 8.5%
Anthocoridae 7.9%
Muscidae 7.9%
Coreidae 7.9%
Drosophilidae 7.9%
Curculionidae 6.2%
Tenebrionidae 4.0%
Armadillidiidae 4.0%
Elmidae 2.8%
Scarabaeidae 2.3%
Cambaridae 1.7%
Cerambycidae 1.7%
Apidae 1.7%
Calliphoridae 1.7%
Aphididae 1.1%
Sarcophagidae 1.1%
Largidae 1.1%
Formicidae 1.1%
Thripidae 0.6%
Anthomyiidae 0.6%
Cimicidae 0.6%
Plutellidae 0.6%
Crambidae 0.6%
Daphniidae 0.6%
Thomisidae 0.6%
Hydrophilidae 0.6%
Reduviidae 0.6%
Tephritidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 27

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2505679068 Isoptericola variabilis 225 Isolate Unclassified
2 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
3 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
4 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
5 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
6 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
7 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
8 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
9 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
10 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
11 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
12 2958255616 Serratia marcescens TM Isolate
13 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
16 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
17 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
20 8062637095 Yimella sp. cx-51 Isolate Cambaridae
21 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
22 8102117041 Caballeronia sp. INML3 Isolate Coreidae
23 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
24 8102982778 Erwinia sp. S63 Isolate Curculionidae
25 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
26 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
27 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
28 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
29 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
30 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
31 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
32 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
33 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
34 2909412500 Yimella sp. cx-573 Isolate Cambaridae
35 2931425734 Nocardioides sp. J2M5 Isolate
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
38 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
39 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
40 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
41 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
42 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
43 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
44 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
45 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
46 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
47 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
48 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
49 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
50 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
51 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
52 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
53 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
54 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
55 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
56 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
57 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
58 2937735258 Serratia marcescens KZ11 Isolate Apidae
59 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
60 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
61 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
62 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
63 8062747827 Yimella sp. cx-51 Isolate Cambaridae
64 8100181737 Kosakonia sp. S58 Isolate Curculionidae
65 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
66 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
67 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
68 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
69 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
70 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
71 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
72 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
73 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
74 2645727860 Winslowiella iniecta B120 Isolate Aphididae
75 2703719240 Serratia marcescens ano2 Isolate Unclassified
76 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
77 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
78 2871771314 Pantoea sp. Ae16 Isolate Culicidae
79 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
80 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
81 2854540230 Acetobacter sp. DsW_063 Isolate Drosophilidae
82 648276708 Pantoea sp. aB Isolate Unclassified
83 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
84 8073544309 Actinomadura sp. RB99 Isolate Termitidae
85 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
86 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
87 8102102351 Caballeronia sp. INML1 Isolate Coreidae
88 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
89 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
90 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
91 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
92 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
93 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
94 2504756063 Isoptericola variabilis J5 Isolate Unclassified
95 2556921669 Shinella sp. DD12 Isolate Daphniidae
96 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
97 2718217944 Serratia marcescens AS1 Isolate Culicidae
98 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
99 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
100 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
101 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
102 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
103 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
104 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
105 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
106 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
107 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
108 8100176769 Kosakonia sp. S57 Isolate Curculionidae
109 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
110 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
111 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
112 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
113 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
114 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
115 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
116 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
117 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
118 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
119 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
120 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
121 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
122 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
123 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
124 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
125 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
126 8100171289 Kosakonia sp. S42 Isolate Curculionidae
127 8102124461 Caballeronia sp. INML3B Isolate Coreidae
128 8103002986 Erwinia sp. S38 Isolate Curculionidae
129 8103008710 Erwinia sp. S43 Isolate Curculionidae
130 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
131 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
132 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
133 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
134 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
135 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
136 2648501209 Winslowiella iniecta B149 Isolate Aphididae
137 2703719239 Serratia marcescens ano1 Isolate Unclassified
138 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
139 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
140 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
141 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
142 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
143 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
144 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
145 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
146 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
147 8004541719 Serratia marcescens KZ19 Isolate Apidae
148 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
149 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
150 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
151 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
152 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
153 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
154 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
155 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
156 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
157 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
158 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
159 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
160 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
161 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
162 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
163 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
164 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
165 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
166 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
167 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
168 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
169 2908241010 Streptomyces sp. HF10 Isolate Termitidae
170 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
171 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
172 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
173 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
174 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
175 8018312681 Enterobacter sp. OLF Isolate Tephritidae
176 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
177 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
178 8099192374 Erwinia typographi IC4 Isolate Curculionidae
179 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
180 8102109360 Caballeronia sp. INML2 Isolate Coreidae
181 2978161719 Serratia marcescens KZ2 Isolate Apidae
182 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
183 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
184 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
185 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
186 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
187 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
188 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 DPOL_contig00234 2035918003 Bacteria 11698
2 FGTW_contig25759 2065487013 Unclassified 8189
3 CVPL010L_1002744 3300002932 Unclassified 3041
4 Ga0104049_1025004 3300007103 Bacteria 3335
5 Ga0105005_1024968 3300007505 Unclassified 11864
6 Ga0123355_10009012 3300009826 Unclassified 15124
7 Ga0123356_10074150 3300010049 Bacteria 3201
8 Ga0160465_100002 3300012803 Bacteria 834901
9 Ga0466730_073669 3300042625 Bacteria 406091
10 Ga0466730_091986 3300042625 Bacteria 1636
11 Ga0466724_06048 3300042649 Unclassified 26129
12 Ga0466724_14457 3300042649 Unclassified 137665
13 Ga0466724_45081 3300042649 Bacteria 99888
14 Ga0160447_103027 3300012849 Bacteria 5572
15 Ga0160430_104927 3300012852 Bacteria 3181
16 Ga0160457_1001637 3300012858 Unclassified 5830
17 Ga0104045_1002470 3300007085 Bacteria 2318
18 Ga0123355_10020226 3300009826 Unclassified 10623
19 Ga0123356_10004020 3300010049 Bacteria 15266
20 Ga0466724_47439 3300042649 Bacteria 410820
21 Ga0160440_100657 3300012815 Bacteria 7994
22 Ga0160432_100229 3300012818 Bacteria 47865
23 Ga0160455_104790 3300012837 Unclassified 1580
24 Ga0160472_101056 3300012839 Unclassified 9619
25 Ga0160433_100127 3300012846 Bacteria 68773
26 Ga0160457_1005859 3300012858 Bacteria 1846
27 Ga0160457_1006584 3300012858 Bacteria 1724
28 Ga0466701_103424 3300042598 Unclassified 117519
29 Ga0562378_3801 3300056814 Bacteria 7819
30 CVPL010L_1000006 3300002932 Bacteria 148663
31 Ga0063521_1000457 3300003973 Bacteria 20381
32 Ga0104051_1102961 3300007078 Unclassified 1696
33 Ga0123356_10032651 3300010049 Bacteria 4870
34 Ga0123353_10001155 3300010167 Bacteria 32219
35 Ga0466730_041094 3300042625 Unclassified 9355
36 Ga0466724_21836 3300042649 Bacteria 1615
37 Ga0466724_48624 3300042649 Unclassified 6284
38 Ga0160459_100628 3300012831 Unclassified 12670
39 Ga0160446_100169 3300012835 Bacteria 50416
40 Ga0160436_1000138 3300012861 Bacteria 37086
41 Ga0316159_10278 3300030930 Bacteria 8439
42 Ga0466710_302047 3300042613 Bacteria 3606
43 FGTW_contig21348 2065487013 Bacteria 1581
44 Ga0123355_10035632 3300009826 Unclassified 8087
45 Ga0123356_10000321 3300010049 Bacteria 55175
46 Ga0466730_075830 3300042625 Unclassified 50863
47 Ga0160467_100823 3300012829 Bacteria 20487
48 Ga0160459_103631 3300012831 Bacteria 2196
49 Ga0160446_100103 3300012835 Bacteria 77158
50 Ga0160472_100052 3300012839 Bacteria 192881
51 Ga0160433_100310 3300012846 Bacteria 31416
52 Ga0160434_110108 3300012850 Bacteria 1533
53 Meta3P_1008852 3300002464 Unclassified 3646
54 Ga0160471_100020 3300012812 Bacteria 340969
55 Ga0466734_096875 3300042623 Bacteria 1577
56 Ga0466725_019120 3300042654 Bacteria 2293
57 Ga0160468_100172 3300012819 Bacteria 48018
58 Ga0160455_100028 3300012837 Bacteria 333132
59 Ga0160460_100023 3300012845 Bacteria 338828
60 Ga0160445_100643 3300012847 Unclassified 14598
61 Ga0160443_100006 3300012848 Bacteria 647325
62 Ga0160434_100161 3300012850 Bacteria 34797
63 Ga0265387_1000026 3300024582 Bacteria 60790
64 Ga0466713_120225 3300042602 Bacteria 135023
65 Ga0530661_000201 3300056564 Bacteria 50515
66 Ga0562375_0559 3300056856 Bacteria 73847
67 Ga0074188_1000288 3300005318 Bacteria 35346
68 Ga0123355_10036228 3300009826 Bacteria 8022
69 Ga0160442_100095 3300012806 Bacteria 101997
70 Ga0160471_100257 3300012812 Bacteria 17526
71 Ga0160441_100119 3300012825 Bacteria 90566
72 Ga0160472_100081 3300012839 Bacteria 156805
73 Ga0160443_100184 3300012848 Bacteria 84526
74 Ga0247289_0041 3300035363 Bacteria 40105
75 Ga0466657_127725 3300042582 Bacteria 62629
76 Ga0562378_0014 3300056814 Bacteria 962225
77 FGTW_contig31427 2065487013 Bacteria 4532
78 Ga0063521_1000032 3300003973 Bacteria 118735
79 Ga0063521_1001353 3300003973 Unclassified 6910
80 Ga0123355_10020087 3300009826 Bacteria 10654
81 Ga0123355_10106937 3300009826 Unclassified 4384
82 Ga0160470_101895 3300012813 Unclassified 4445
83 Ga0160452_100025 3300012834 Bacteria 245284
84 Ga0160435_1000470 3300012857 Unclassified 13485
85 Ga0247289_0187 3300035363 Unclassified 14097
86 Ga0415639_073305 3300038395 Bacteria 2693
87 Ga0466707_422806 3300042601 Bacteria 1598
88 Ga0562375_1015 3300056856 Bacteria 44532
89 Ga0562376_1567 3300056857 Unclassified 31408
90 DPOL_contig14439 2035918003 Bacteria 12480
91 Ga0104041_1001647 3300007106 Unclassified 11734
92 Ga0104147_1012250 3300007224 Bacteria 9168
93 Ga0123355_10522123 3300009826 Bacteria 1452
94 Ga0123356_10005071 3300010049 Bacteria 13501
95 Ga0123353_10043284 3300010167 Unclassified 7132
96 Ga0466697_200239 3300042611 Bacteria 2099
97 Ga0466730_061587 3300042625 Bacteria 10763
98 Ga0160460_104572 3300012845 Bacteria 2099
99 Ga0316159_10343 3300030930 Bacteria 9155

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012852 Ga0160430_104927 Ga0160430_1049272 312
2 2065487013 FGTW_contig21348 FGTW_01526850 321
3 3300012831 Ga0160459_103631 Ga0160459_1036312 321
4 3300010167 Ga0123353_10001155 Ga0123353_100011553 327
5 3300009826 Ga0123355_10522123 Ga0123355_105221231 328
6 3300010167 Ga0123353_10043284 Ga0123353_100432843 330
7 3300038395 Ga0415639_073305 Ga0415639_073305_532_1554 330
8 3300003973 Ga0063521_1000457 Ga0063521_100045718 333
9 3300012858 Ga0160457_1005859 Ga0160457_10058592 337
10 3300056564 Ga0530661_000201 Ga0530661_000201_4160_5245 337
11 iso_pr_bacteria 2820931684 2820931937 338
12 iso_pr_bacteria 646564587 646804423 338
13 3300009826 Ga0123355_10009012 Ga0123355_100090126 339
14 3300010049 Ga0123356_10005071 Ga0123356_100050715 339
15 iso_pr_bacteria 2504756063 2504979371 339
16 iso_pr_bacteria 2505679068 2505952684 339
17 iso_pr_bacteria 2619619079 2620604668 339
18 iso_pr_bacteria 2630969010 2634126476 339
19 iso_pr_bacteria 2675903013 2676276070 339
20 iso_pr_bacteria 2854540230 2854541427 339
21 iso_pr_bacteria 2864773010 2864773292 339
22 iso_pr_bacteria 2864918810 2864920813 339
23 iso_pr_bacteria 2864964650 2864964932 339
24 iso_pr_bacteria 8109397740 8109401910 339
25 2035918003 DPOL_contig00234 DPOLB_1094500 340
26 3300007103 Ga0104049_1025004 Ga0104049_10250041 340
27 3300007106 Ga0104041_1001647 Ga0104041_100164712 340
28 3300007505 Ga0105005_1024968 Ga0105005_10249687 340
29 3300012806 Ga0160442_100095 Ga0160442_10009587 340
30 3300012831 Ga0160459_100628 Ga0160459_1006282 340
31 3300012834 Ga0160452_100025 Ga0160452_100025159 340
32 3300012835 Ga0160446_100103 Ga0160446_10010349 340
33 3300012835 Ga0160446_100169 Ga0160446_10016918 340
34 3300035363 Ga0247289_0041 Ga0247289_0041_21797_22819 340
35 3300042582 Ga0466657_127725 Ga0466657_127725_319_1341 340
36 3300042598 Ga0466701_103424 Ga0466701_103424_76833_77855 340
37 3300042611 Ga0466697_200239 Ga0466697_200239_164_1186 340
38 3300042623 Ga0466734_096875 Ga0466734_096875_452_1474 340
39 3300042625 Ga0466730_073669 Ga0466730_073669_270990_272012 340
40 3300042649 Ga0466724_06048 Ga0466724_06048_6804_7826 340
41 3300042649 Ga0466724_14457 Ga0466724_14457_17380_18402 340
42 3300042649 Ga0466724_21836 Ga0466724_21836_534_1556 340
43 3300042649 Ga0466724_45081 Ga0466724_45081_73884_74906 340
44 3300042649 Ga0466724_47439 Ga0466724_47439_333957_334979 340
45 3300042649 Ga0466724_48624 Ga0466724_48624_2367_3389 340
46 3300056856 Ga0562375_0559 Ga0562375_0559_35024_36046 340
47 iso_pr_bacteria 2519899623 2520395259 340
48 iso_pr_bacteria 2556921669 2558281189 340
49 iso_pr_bacteria 2619619082 2620611044 340
50 iso_pr_bacteria 2645727860 2647288951 340
51 iso_pr_bacteria 2648501209 2648986056 340
52 iso_pr_bacteria 2703719239 2706049834 340
53 iso_pr_bacteria 2703719240 2706055112 340
54 iso_pr_bacteria 2718217944 2719463740 340
55 iso_pr_bacteria 2820146621 2820148494 340
56 iso_pr_bacteria 2820825283 2820827056 340
57 iso_pr_bacteria 2820845766 2820847648 340
58 iso_pr_bacteria 2820863028 2820865320 340
59 iso_pr_bacteria 2820882373 2820884492 340
60 iso_pr_bacteria 2820889385 2820892829 340
61 iso_pr_bacteria 2820894511 2820896368 340
62 iso_pr_bacteria 2821316722 2821319491 340
63 iso_pr_bacteria 2847708326 2847711832 340
64 iso_pr_bacteria 2864878056 2864880766 340
65 iso_pr_bacteria 2864886855 2864889566 340
66 iso_pr_bacteria 2871760914 2871761990 340
67 iso_pr_bacteria 2871771314 2871771559 340
68 iso_pr_bacteria 2873558832 2873560792 340
69 iso_pr_bacteria 2874434233 2874435061 340
70 iso_pr_bacteria 2874504452 2874507445 340
71 iso_pr_bacteria 2878947168 2878948383 340
72 iso_pr_bacteria 2883361506 2883363582 340
73 iso_pr_bacteria 2908241010 2908245140 340
74 iso_pr_bacteria 2922113941 2922116355 340
75 iso_pr_bacteria 2931425734 2931428570 340
76 iso_pr_bacteria 2937735258 2937738448 340
77 iso_pr_bacteria 2937751072 2937752355 340
78 iso_pr_bacteria 2958255616 2958259381 340
79 iso_pr_bacteria 2961206375 2961207285 340
80 iso_pr_bacteria 2961232173 2961235245 340
81 iso_pr_bacteria 2961247850 2961248309 340
82 iso_pr_bacteria 2965197371 2965200614 340
83 iso_pr_bacteria 2970791725 2970794841 340
84 iso_pr_bacteria 2978161719 2978162148 340
85 iso_pr_bacteria 2996406003 2996407846 340
86 iso_pr_bacteria 2996467878 2996472321 340
87 iso_pr_bacteria 3001462594 3001465310 340
88 iso_pr_bacteria 3003869270 3003875285 340
89 iso_pr_bacteria 3003869270 3003875816 340
90 iso_pr_bacteria 3003878002 3003886268 340
91 iso_pr_bacteria 648276708 648769433 340
92 iso_pr_bacteria 8004285568 8004286615 340
93 iso_pr_bacteria 8004307473 8004309575 340
94 iso_pr_bacteria 8004541719 8004543749 340
95 iso_pr_bacteria 8004571736 8004573797 340
96 iso_pr_bacteria 8004582426 8004584153 340
97 iso_pr_bacteria 8024037630 8024044412 340
98 iso_pr_bacteria 8024044713 8024049108 340
99 iso_pr_bacteria 8065462725 8065465210 340
100 iso_pr_bacteria 8065466226 8065467955 340
101 iso_pr_bacteria 8065469765 8065472262 340
102 iso_pr_bacteria 8067483258 8067485408 340
103 iso_pr_bacteria 8074288691 8074290552 340
104 iso_pr_bacteria 8074292191 8074293307 340
105 iso_pr_bacteria 8102054868 8102060588 340
106 iso_pr_bacteria 8102067727 8102074218 340
107 iso_pr_bacteria 8102081745 8102087139 340
108 iso_pr_bacteria 8102102351 8102109123 340
109 iso_pr_bacteria 8102109360 8102116211 340
110 iso_pr_bacteria 8102117041 8102123568 340
111 iso_pr_bacteria 8102124461 8102130984 340
112 iso_pr_bacteria 8102138357 8102144795 340
113 iso_pr_bacteria 8102264549 8102271054 340
114 iso_pr_bacteria 8102271933 8102274265 340
115 iso_pr_bacteria 8102279326 8102285560 340
116 iso_pr_bacteria 8102982778 8102984705 340
117 iso_pr_bacteria 8118075156 8118081382 340
118 2035918003 DPOL_contig14439 DPOLB_584440 341
119 2065487013 FGTW_contig25759 FGTW_03257890 341
120 3300002464 Meta3P_1008852 Meta3P_10088523 341
121 3300003973 Ga0063521_1000032 Ga0063521_100003213 341
122 3300005318 Ga0074188_1000288 Ga0074188_100028819 341
123 3300007078 Ga0104051_1102961 Ga0104051_11029612 341
124 3300007085 Ga0104045_1002470 Ga0104045_10024701 341
125 3300009826 Ga0123355_10035632 Ga0123355_100356326 341
126 3300009826 Ga0123355_10036228 Ga0123355_100362285 341
127 3300009826 Ga0123355_10106937 Ga0123355_101069374 341
128 3300010049 Ga0123356_10004020 Ga0123356_1000402013 341
129 3300010049 Ga0123356_10032651 Ga0123356_100326516 341
130 3300010049 Ga0123356_10074150 Ga0123356_100741502 341
131 3300012803 Ga0160465_100002 Ga0160465_100002177 341
132 3300012812 Ga0160471_100020 Ga0160471_1000207 341
133 3300012813 Ga0160470_101895 Ga0160470_1018954 341
134 3300012815 Ga0160440_100657 Ga0160440_1006575 341
135 3300012819 Ga0160468_100172 Ga0160468_10017223 341
136 3300012825 Ga0160441_100119 Ga0160441_10011916 341
137 3300012829 Ga0160467_100823 Ga0160467_10082317 341
138 3300012837 Ga0160455_100028 Ga0160455_10002873 341
139 3300012839 Ga0160472_100052 Ga0160472_10005273 341
140 3300012839 Ga0160472_101056 Ga0160472_1010567 341
141 3300012845 Ga0160460_100023 Ga0160460_10002311 341
142 3300012845 Ga0160460_104572 Ga0160460_1045722 341
143 3300012846 Ga0160433_100127 Ga0160433_10012730 341
144 3300012846 Ga0160433_100310 Ga0160433_10031013 341
145 3300012847 Ga0160445_100643 Ga0160445_1006432 341
146 3300012848 Ga0160443_100006 Ga0160443_100006223 341
147 3300012850 Ga0160434_100161 Ga0160434_10016112 341
148 3300012850 Ga0160434_110108 Ga0160434_1101082 341
149 3300012858 Ga0160457_1001637 Ga0160457_10016376 341
150 3300012858 Ga0160457_1006584 Ga0160457_10065842 341
151 3300024582 Ga0265387_1000026 Ga0265387_100002624 341
152 3300030930 Ga0316159_10278 Ga0316159_102783 341
153 3300035363 Ga0247289_0187 Ga0247289_0187_9068_10093 341
154 3300042602 Ga0466713_120225 Ga0466713_120225_34851_35876 341
155 3300042625 Ga0466730_075830 Ga0466730_075830_373_1398 341
156 iso_pr_bacteria 2765235945 2766084326 341
157 iso_pr_bacteria 2835335304 2835338954 341
158 iso_pr_bacteria 2836973655 2836976434 341
159 iso_pr_bacteria 2837204985 2837205158 341
160 iso_pr_bacteria 2856068565 2856072759 341
161 iso_pr_bacteria 2876334352 2876336841 341
162 iso_pr_bacteria 2876358570 2876360144 341
163 iso_pr_bacteria 2898991528 2898996465 341
164 iso_pr_bacteria 2921816052 2921818831 341
165 iso_pr_bacteria 2921842437 2921843882 341
166 iso_pr_bacteria 2937387794 2937391283 341
167 iso_pr_bacteria 2937427229 2937430340 341
168 iso_pr_bacteria 2957730672 2957735059 341
169 iso_pr_bacteria 2964846109 2964846927 341
170 iso_pr_bacteria 2964859436 2964860657 341
171 iso_pr_bacteria 2967915117 2967917484 341
172 iso_pr_bacteria 2967924226 2967925157 341
173 iso_pr_bacteria 2970322301 2970326526 341
174 iso_pr_bacteria 2970335472 2970338346 341
175 iso_pr_bacteria 2977691992 2977693492 341
176 iso_pr_bacteria 2977727922 2977731368 341
177 iso_pr_bacteria 2977745872 2977748225 341
178 iso_pr_bacteria 2979682021 2979684523 341
179 iso_pr_bacteria 3004364956 3004365044 341
180 iso_pr_bacteria 8018312681 8018312758 341
181 iso_pr_bacteria 8028002147 8028003706 341
182 iso_pr_bacteria 8099192374 8099194645 341
183 iso_pr_bacteria 8100171289 8100171386 341
184 iso_pr_bacteria 8100176769 8100180726 341
185 iso_pr_bacteria 8100181737 8100185826 341
186 iso_pr_bacteria 8103002986 8103006335 341
187 iso_pr_bacteria 8103008710 8103012438 341
188 3300002932 CVPL010L_1000006 CVPL010L_100000620 342
189 3300003973 Ga0063521_1001353 Ga0063521_10013537 342
190 3300042613 Ga0466710_302047 Ga0466710_302047_2354_3382 342
191 3300056814 Ga0562378_0014 Ga0562378_0014_352560_353588 342
192 3300056856 Ga0562375_1015 Ga0562375_1015_33324_34352 342
193 iso_pr_bacteria 2822856742 2822859255 342
194 iso_pr_bacteria 2883683260 2883684658 342
195 iso_pr_bacteria 3004010258 3004011163 342
196 iso_pr_bacteria 8021535516 8021539827 342
197 2065487013 FGTW_contig31427 FGTW_00460290 343
198 3300042601 Ga0466707_422806 Ga0466707_422806_274_1305 343
199 3300042625 Ga0466730_041094 Ga0466730_041094_386_1417 343
200 3300042654 Ga0466725_019120 Ga0466725_019120_684_1715 343
201 3300056814 Ga0562378_3801 Ga0562378_3801_5381_6412 343
202 3300056857 Ga0562376_1567 Ga0562376_1567_5560_6591 343
203 3300030930 Ga0316159_10343 Ga0316159_103436 344
204 iso_pr_bacteria 2547132185 2547712181 344
205 iso_pr_bacteria 2551306516 2553380047 344
206 iso_pr_bacteria 2551306531 2553452502 344
207 iso_pr_bacteria 2874880541 2874881730 344
208 iso_pr_bacteria 8069511479 8069515620 344
209 3300002932 CVPL010L_1002744 CVPL010L_10027443 345
210 3300009826 Ga0123355_10020226 Ga0123355_100202262 345
211 3300010049 Ga0123356_10000321 Ga0123356_1000032126 345
212 3300012849 Ga0160447_103027 Ga0160447_1030272 345
213 3300012857 Ga0160435_1000470 Ga0160435_100047011 345
214 3300012818 Ga0160432_100229 Ga0160432_10022919 346
215 iso_pr_bacteria 2909412500 2909413283 346
216 iso_pr_bacteria 8062637095 8062639091 346
217 iso_pr_bacteria 8062747827 8062749733 346
218 3300009826 Ga0123355_10020087 Ga0123355_100200872 347
219 3300012861 Ga0160436_1000138 Ga0160436_100013814 348
220 iso_pr_bacteria 2772190761 2772881776 348
221 iso_pr_bacteria 8073544309 8073550143 349
222 3300012812 Ga0160471_100257 Ga0160471_1002573 352
223 3300012839 Ga0160472_100081 Ga0160472_10008130 352
224 3300042625 Ga0466730_091986 Ga0466730_091986_471_1532 353
225 iso_pr_bacteria 2841168549 2841169760 353
226 3300012837 Ga0160455_104790 Ga0160455_1047902 356
227 3300012848 Ga0160443_100184 Ga0160443_10018440 362
228 iso_pr_bacteria 2545824723 2546570568 364
229 3300007224 Ga0104147_1012250 Ga0104147_10122509 366
230 iso_pr_bacteria 8102094248 8102096718 376
231 3300042625 Ga0466730_061587 Ga0466730_061587_749_1897 382

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00296 Bac_luciferase Luciferase-like monooxygenase 48 291 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00296 GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.