Protein Family IF08913

Metagenome Metatranscriptome Isolate
151 Members
95 Samples
106 Scaffolds
205.84 Avg Length

🧬 Representative Sequence

ID
3300042625|Ga0466730_023397|Ga0466730_023397_1021_1698
Length
225 aa
Sequence
MERNTKGVLGTKLGMSQVFDDQGRIVPVTVVKAGPCVVTAVRTPERDGYAGVQLGYGEIDPRKVTKPVAGHFTAAGVTPRRYLAELRTSDASEYTLGQEVTAEVFAPGQLVDVTGKSKGKGTAGVVKRHGFRGLSASHGTQRKHRAPGSIGGCATPGRVFKGLRMAGRMGSERVTVQSLTVHAVDAERGLLLIKGAVPGSPGGLVLVRSAAKAPAGVATSAEGAG

πŸ“Š Sample Types

Isolate 29.8%
Metagenome 68.9%
MAG 0.0%
Metatranscriptome 1.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 25.8%
Unclassified 21.3%
Kalotermitidae 11.2%
Tenebrionidae 9.0%
Culicidae 5.6%
Formicidae 4.5%
Termopsidae 4.5%
Cambaridae 3.4%
Scarabaeidae 3.4%
Armadillidiidae 2.2%
Hydrophilidae 2.2%
Rhinotermitidae 2.2%
Pyralidae 1.1%
Hodotermitidae 1.1%
Siricidae 1.1%
Curculionidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 13

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
2 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
3 2900368070 Nocardia aurantia RB56 Isolate Termitidae
4 2912749649 Streptomyces sp. GS7 Isolate Termitidae
5 8062747827 Yimella sp. cx-51 Isolate Cambaridae
6 3006461590 Streptomyces sp. RB5 Isolate Termitidae
7 3006667155 Streptomyces sp. SID9727 Isolate
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
10 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
11 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
12 2547132081 Streptomyces sp. S4 Isolate Formicidae
13 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
14 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
17 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
18 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
19 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
20 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
21 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
22 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
23 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
26 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
27 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
28 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
29 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
36 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
37 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
38 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
39 2909412500 Yimella sp. cx-573 Isolate Cambaridae
40 2931430189 Tessaracoccus palaemonis J1M15 Isolate
41 3300060774 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
42 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
43 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
44 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
45 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
49 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
50 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
51 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
52 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
53 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
54 2873603790 Tessaracoccus coleopterorum HDW20 Isolate Hydrophilidae
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
61 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
62 2896955351 Streptomyces sp. GF20 Isolate Termitidae
63 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
64 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
65 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
66 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
67 8073544309 Actinomadura sp. RB99 Isolate Termitidae
68 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
69 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
70 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
71 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
72 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
73 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
74 2908241010 Streptomyces sp. HF10 Isolate Termitidae
75 2912817845 Streptomyces griseus SID164 Isolate
76 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
77 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
78 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
79 3006468911 Streptomyces sp. RB17 Isolate Termitidae
80 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
81 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
82 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
83 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
84 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
85 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
86 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
87 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
88 8062637095 Yimella sp. cx-51 Isolate Cambaridae
89 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
90 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
91 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
92 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
93 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
94 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
95 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562376_0002 3300056857 Bacteria 3502070
2 Ga0562376_0281 3300056857 Bacteria 101378
3 Ga0466718_152904 3300042617 Bacteria 12214
4 Ga0466707_421729 3300042601 Bacteria 13878
5 Ga0466703_325455 3300042636 Bacteria 14564
6 Ga0466725_000130 3300042654 Bacteria 1478
7 Ga0160430_119511 3300012852 Bacteria 953
8 Ga0466691_012570 3300042593 Bacteria 32910
9 Ga0068302_10010595 3300005071 Unclassified 1195
10 Ga0562374_2901 3300057007 Unclassified 12325
11 Ga0466711_253939 3300042615 Bacteria 18586
12 Ga0466722_198999 3300042609 Bacteria 1238
13 Ga0466730_023907 3300042625 Unclassified 12809
14 Ga0466703_144605 3300042636 Bacteria 9715
15 Ga0160447_106657 3300012849 Bacteria 3023
16 Ga0123357_10275603 3300009784 Bacteria 1748
17 Ga0123353_10265637 3300010167 Unclassified 2648
18 Ga0562378_2407 3300056814 Unclassified 15648
19 Ga0562375_0569 3300056856 Bacteria 72979
20 Ga0562376_0007 3300056857 Bacteria 1429637
21 Ga0562376_0418 3300056857 Bacteria 79667
22 Ga0590798_01403 3300060774 Unclassified 1970
23 Ga0466715_562604 3300042616 Bacteria 3932
24 Ga0466713_156493 3300042602 Bacteria 2330
25 Ga0466729_243078 3300042621 Bacteria 1508
26 Ga0466734_086470 3300042623 Bacteria 2112
27 Ga0466730_066804 3300042625 Unclassified 1042
28 Ga0160435_1001144 3300012857 Bacteria 6896
29 Ga0415639_095019 3300038395 Bacteria 3384
30 Ga0466696_320011 3300042596 Bacteria 10233
31 Ga0123354_10008932 3300010882 Bacteria 15296
32 Ga0123354_10315889 3300010882 Unclassified 1450
33 Ga0160442_100065 3300012806 Bacteria 144556
34 Ga0072940_1253174 3300005200 Bacteria 852
35 Ga0123357_10001625 3300009784 Bacteria 24088
36 Ga0123357_10001723 3300009784 Bacteria 23593
37 Ga0466705_343361 3300042612 Bacteria 14966
38 Ga0590775_07978 3300060896 Bacteria 1525
39 Ga0466710_208321 3300042613 Bacteria 11430
40 Ga0466719_350968 3300042606 Bacteria 1496
41 Ga0466722_155738 3300042609 Bacteria 28782
42 Ga0466730_064112 3300042625 Bacteria 1156
43 Ga0466727_280039 3300042655 Bacteria 1114
44 Ga0160458_105346 3300012832 Unclassified 1528
45 Ga0466696_350585 3300042596 Bacteria 3349
46 Ga0123357_10475116 3300009784 Unclassified 1061
47 Ga0123353_10000701 3300010167 Bacteria 40961
48 Ga0123353_10917083 3300010167 Bacteria 1190
49 Ga0123357_10001429 3300009784 Bacteria 25338
50 Ga0562377_0161 3300056842 Bacteria 189060
51 Ga0466715_134740 3300042616 Bacteria 2266
52 Ga0466723_189940 3300042618 Bacteria 29161
53 Ga0466706_185014 3300042599 Bacteria 3626
54 Ga0466707_351878 3300042601 Bacteria 23367
55 Ga0466735_162252 3300042624 Bacteria 2196
56 Ga0466730_017240 3300042625 Bacteria 1175
57 Ga0466730_055821 3300042625 Bacteria 8238
58 Ga0466727_119340 3300042655 Bacteria 6208
59 Ga0160447_112728 3300012849 Bacteria 1695
60 Ga0123357_10066173 3300009784 Unclassified 4822
61 Ga0123356_10026024 3300010049 Bacteria 5499
62 Ga0123353_10192274 3300010167 Bacteria 3220
63 Ga0562379_0191 3300056790 Bacteria 175707
64 Ga0562377_2598 3300056842 Bacteria 12848
65 Ga0466705_402140 3300042612 Bacteria 1008
66 Ga0466710_175050 3300042613 Bacteria 1523
67 Ga0466711_068649 3300042615 Bacteria 1206
68 Ga0466707_086104 3300042601 Bacteria 138731
69 Ga0466722_112981 3300042609 Bacteria 1519
70 Ga0466730_023397 3300042625 Bacteria 2005
71 Ga0123355_10490746 3300009826 Bacteria 1521
72 Ga0123354_10022573 3300010882 Bacteria 9921
73 Ga0123354_10118732 3300010882 Unclassified 3431
74 Ga0123357_10000640 3300009784 Bacteria 34769
75 Ga0466697_143551 3300042611 Bacteria 2381
76 Ga0562375_3766 3300056856 Bacteria 13275
77 Ga0562376_0223 3300056857 Bacteria 114445
78 Ga0466711_009545 3300042615 Bacteria 1231
79 Ga0466726_207676 3300042619 Bacteria 2654
80 Ga0466713_145633 3300042602 Bacteria 1791
81 Ga0466730_007810 3300042625 Bacteria 11605
82 Ga0466704_109485 3300042643 Bacteria 14274
83 Ga0466704_582723 3300042643 Bacteria 43560
84 Ga0466724_64838 3300042649 Bacteria 17323
85 Ga0466708_171991 3300042652 Bacteria 11415
86 Ga0160432_104610 3300012818 Bacteria 1502
87 Ga0160446_100161 3300012835 Bacteria 52061
88 Ga0160446_102520 3300012835 Unclassified 3184
89 Ga0123353_10442229 3300010167 Bacteria 1917
90 Ga0123357_10002532 3300009784 Bacteria 20451
91 Ga0466705_371630 3300042612 Bacteria 1902
92 Ga0562375_0042 3300056856 Bacteria 527811
93 Ga0466723_043574 3300042618 Bacteria 14699
94 Ga0466723_160743 3300042618 Bacteria 1276
95 Ga0466723_319227 3300042618 Bacteria 1479
96 Ga0466706_047001 3300042599 Bacteria 29829
97 Ga0466707_046235 3300042601 Bacteria 2048
98 Ga0466708_205008 3300042652 Bacteria 28180
99 Ga0160455_103445 3300012837 Bacteria 2415
100 Ga0160430_121492 3300012852 Bacteria 882
101 Ga0160457_1000057 3300012858 Bacteria 180491
102 Ga0123357_10297225 3300009784 Bacteria 1638
103 Ga0123356_10025041 3300010049 Bacteria 5609
104 Ga0123354_10002396 3300010882 Bacteria 24675
105 Ga0123357_10000801 3300009784 Bacteria 31843
106 Ga0123357_10003044 3300009784 Bacteria 19002

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005071 Ga0068302_10010595 Ga0068302_100105952 176
2 3300010049 Ga0123356_10025041 Ga0123356_100250412 180
3 3300009826 Ga0123355_10490746 Ga0123355_104907461 181
4 3300042636 Ga0466703_325455 Ga0466703_325455_6885_7535 181
5 3300010882 Ga0123354_10315889 Ga0123354_103158892 183
6 3300042654 Ga0466725_000130 Ga0466725_000130_43_648 183
7 3300056856 Ga0562375_0042 Ga0562375_0042_192921_193601 184
8 3300012849 Ga0160447_106657 Ga0160447_1066574 186
9 3300012852 Ga0160430_119511 Ga0160430_1195112 186
10 3300056857 Ga0562376_0002 Ga0562376_0002_3375063_3375743 186
11 3300009784 Ga0123357_10002532 Ga0123357_1000253215 188
12 3300010167 Ga0123353_10442229 Ga0123353_104422292 188
13 3300042612 Ga0466705_371630 Ga0466705_371630_590_1252 189
14 3300009784 Ga0123357_10001429 Ga0123357_1000142926 190
15 3300042599 Ga0466706_185014 Ga0466706_185014_1351_2010 190
16 3300042612 Ga0466705_402140 Ga0466705_402140_66_728 190
17 3300042613 Ga0466710_175050 Ga0466710_175050_98_742 191
18 3300056856 Ga0562375_3766 Ga0562375_3766_8994_9674 191
19 3300042601 Ga0466707_086104 Ga0466707_086104_27311_27973 192
20 3300042615 Ga0466711_009545 Ga0466711_009545_187_816 192
21 3300042615 Ga0466711_068649 Ga0466711_068649_522_1184 192
22 3300042623 Ga0466734_086470 Ga0466734_086470_530_1180 192
23 3300042643 Ga0466704_109485 Ga0466704_109485_1587_2249 192
24 3300057007 Ga0562374_2901 Ga0562374_2901_34_702 192
25 3300009784 Ga0123357_10066173 Ga0123357_100661734 193
26 3300009784 Ga0123357_10275603 Ga0123357_102756032 194
27 3300009784 Ga0123357_10297225 Ga0123357_102972252 194
28 3300010882 Ga0123354_10022573 Ga0123354_100225739 194
29 3300010882 Ga0123354_10118732 Ga0123354_101187322 194
30 3300005200 Ga0072940_1253174 Ga0072940_12531741 195
31 3300042616 Ga0466715_134740 Ga0466715_134740_557_1219 195
32 3300042616 Ga0466715_562604 Ga0466715_562604_2876_3538 195
33 3300042619 Ga0466726_207676 Ga0466726_207676_1576_2196 195
34 3300009784 Ga0123357_10001723 Ga0123357_100017237 196
35 3300042602 Ga0466713_156493 Ga0466713_156493_237_905 196
36 3300056857 Ga0562376_0223 Ga0562376_0223_16795_17475 196
37 3300012857 Ga0160435_1001144 Ga0160435_10011445 197
38 3300042596 Ga0466696_320011 Ga0466696_320011_7877_8539 197
39 3300042612 Ga0466705_343361 Ga0466705_343361_7683_8333 197
40 3300042655 Ga0466727_119340 Ga0466727_119340_113_763 197
41 3300010049 Ga0123356_10026024 Ga0123356_100260246 198
42 3300010167 Ga0123353_10000701 Ga0123353_100007012 198
43 3300042609 Ga0466722_155738 Ga0466722_155738_16948_17604 198
44 3300042618 Ga0466723_043574 Ga0466723_043574_5180_5857 198
45 3300042618 Ga0466723_160743 Ga0466723_160743_278_955 198
46 3300042643 Ga0466704_582723 Ga0466704_582723_35909_36559 198
47 3300042606 Ga0466719_350968 Ga0466719_350968_576_1232 200
48 3300042617 Ga0466718_152904 Ga0466718_152904_2341_2991 200
49 3300042625 Ga0466730_017240 Ga0466730_017240_303_947 200
50 3300010167 Ga0123353_10192274 Ga0123353_101922742 201
51 3300010167 Ga0123353_10917083 Ga0123353_109170832 201
52 3300012806 Ga0160442_100065 Ga0160442_100065135 201
53 3300012818 Ga0160432_104610 Ga0160432_1046102 201
54 3300012835 Ga0160446_102520 Ga0160446_1025203 201
55 3300012852 Ga0160430_121492 Ga0160430_1214922 201
56 3300042599 Ga0466706_047001 Ga0466706_047001_20237_20896 201
57 3300042601 Ga0466707_046235 Ga0466707_046235_713_1372 201
58 3300042609 Ga0466722_198999 Ga0466722_198999_535_1191 201
59 3300042615 Ga0466711_253939 Ga0466711_253939_2015_2671 201
60 3300042624 Ga0466735_162252 Ga0466735_162252_895_1551 201
61 3300010882 Ga0123354_10002396 Ga0123354_100023963 202
62 3300042609 Ga0466722_112981 Ga0466722_112981_357_1016 202
63 3300042618 Ga0466723_319227 Ga0466723_319227_729_1337 202
64 3300042621 Ga0466729_243078 Ga0466729_243078_395_1003 202
65 3300056857 Ga0562376_0007 Ga0562376_0007_1198048_1198704 202
66 3300060896 Ga0590775_07978 Ga0590775_07978_572_1228 202
67 3300009784 Ga0123357_10000640 Ga0123357_1000064025 203
68 3300009784 Ga0123357_10001625 Ga0123357_1000162522 203
69 3300009784 Ga0123357_10475116 Ga0123357_104751162 203
70 3300010882 Ga0123354_10008932 Ga0123354_100089322 203
71 3300038395 Ga0415639_095019 Ga0415639_095019_2459_3109 203
72 3300012858 Ga0160457_1000057 Ga0160457_10000579 204
73 3300042596 Ga0466696_350585 Ga0466696_350585_944_1612 204
74 3300042625 Ga0466730_064112 Ga0466730_064112_252_866 204
75 3300042636 Ga0466703_144605 Ga0466703_144605_976_1644 204
76 3300042652 Ga0466708_205008 Ga0466708_205008_5763_6431 204
77 3300012835 Ga0160446_100161 Ga0160446_1001614 205
78 3300042601 Ga0466707_421729 Ga0466707_421729_10528_11199 205
79 3300042618 Ga0466723_189940 Ga0466723_189940_6325_7002 205
80 3300042601 Ga0466707_351878 Ga0466707_351878_13528_14205 206
81 3300042602 Ga0466713_145633 Ga0466713_145633_193_861 206
82 3300042652 Ga0466708_171991 Ga0466708_171991_8896_9516 206
83 3300042655 Ga0466727_280039 Ga0466727_280039_29_649 206
84 3300056842 Ga0562377_2598 Ga0562377_2598_550_1218 206
85 3300009784 Ga0123357_10000801 Ga0123357_1000080128 210
86 3300042625 Ga0466730_007810 Ga0466730_007810_2875_3519 214
87 3300042625 Ga0466730_023907 Ga0466730_023907_457_1101 214
88 3300042625 Ga0466730_066804 Ga0466730_066804_131_775 214
89 iso_pr_bacteria 2515154100 2515556411 214
90 iso_pr_bacteria 2515154104 2515585762 214
91 iso_pr_bacteria 2515154106 2515606574 214
92 iso_pr_bacteria 2523533511 2523591826 214
93 iso_pr_bacteria 2547132081 2547292702 214
94 iso_pr_bacteria 2648501322 2649445435 214
95 iso_pr_bacteria 2820903739 2820904303 214
96 iso_pr_bacteria 2873196663 2873203589 214
97 iso_pr_bacteria 2896955351 2896957748 214
98 iso_pr_bacteria 2908241010 2908245369 214
99 iso_pr_bacteria 2912749649 2912750151 214
100 iso_pr_bacteria 2912817845 2912825146 214
101 iso_pr_bacteria 3006461590 3006462669 214
102 iso_pr_bacteria 3006468911 3006474028 214
103 iso_pr_bacteria 3006667155 3006674468 214
104 iso_pr_bacteria 647000328 647324275 214
105 iso_pr_bacteria 8046957834 8046958465 214
106 iso_pr_bacteria 8053361298 8053362080 214
107 iso_pr_bacteria 8077783556 8077785846 214
108 3300009784 Ga0123357_10003044 Ga0123357_100030445 215
109 3300010167 Ga0123353_10265637 Ga0123353_102656372 215
110 3300012832 Ga0160458_105346 Ga0160458_1053462 215
111 3300042625 Ga0466730_055821 Ga0466730_055821_3850_4542 215
112 iso_pr_bacteria 2772190761 2772887924 216
113 iso_pr_bacteria 2820863028 2820864679 216
114 iso_pr_bacteria 2820889385 2820890649 216
115 iso_pr_bacteria 2837204985 2837205863 216
116 iso_pr_bacteria 2856652821 2856656930 216
117 iso_pr_bacteria 2883683260 2883684068 216
118 iso_pr_bacteria 2898589227 2898595051 216
119 iso_pr_bacteria 2918390780 2918394332 216
120 iso_pr_bacteria 8073544309 8073550421 216
121 iso_pr_bacteria 8118075156 8118076906 216
122 3300042613 Ga0466710_208321 Ga0466710_208321_1767_2420 217
123 iso_pr_bacteria 2820825283 2820826971 217
124 iso_pr_bacteria 2873589062 2873589292 218
125 iso_pr_bacteria 2873603790 2873605081 218
126 iso_pr_bacteria 2931430189 2931432287 218
127 iso_pr_bacteria 8067071256 8067077398 218
128 3300042649 Ga0466724_64838 Ga0466724_64838_13093_13752 219
129 iso_pr_bacteria 2820899690 2820900466 219
130 iso_pr_bacteria 2821314491 2821316546 219
131 iso_pr_bacteria 2847305884 2847306483 219
132 iso_pr_bacteria 2861945162 2861945184 219
133 3300012837 Ga0160455_103445 Ga0160455_1034454 220
134 3300012849 Ga0160447_112728 Ga0160447_1127282 220
135 3300042611 Ga0466697_143551 Ga0466697_143551_1261_1923 220
136 iso_pr_bacteria 2884351759 2884355138 220
137 iso_pr_bacteria 2900354037 2900356575 221
138 iso_pr_bacteria 2900368070 2900368530 221
139 iso_pr_bacteria 2909412500 2909412859 222
140 iso_pr_bacteria 8062637095 8062639512 222
141 iso_pr_bacteria 8062747827 8062748399 222
142 3300056790 Ga0562379_0191 Ga0562379_0191_142082_142756 224
143 3300056814 Ga0562378_2407 Ga0562378_2407_12984_13658 224
144 3300056842 Ga0562377_0161 Ga0562377_0161_58874_59548 224
145 3300056856 Ga0562375_0569 Ga0562375_0569_60924_61598 224
146 3300056857 Ga0562376_0281 Ga0562376_0281_48255_48929 224
147 3300056857 Ga0562376_0418 Ga0562376_0418_15320_15994 224
148 3300060774 Ga0590798_01403 Ga0590798_01403_711_1385 224
149 iso_pr_bacteria 8012935351 8012938325 224
150 3300042625 Ga0466730_023397 Ga0466730_023397_1021_1698 225
151 3300042593 Ga0466691_012570 Ga0466691_012570_3862_4545 227

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00297 Ribosomal_L3 Ribosomal protein L3 98 184 0.84

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.