Protein Family IF08913
Metagenome
Metatranscriptome
Isolate
151
Members
95
Samples
106
Scaffolds
205.84
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_023397|Ga0466730_023397_1021_1698
- Length
- 225 aa
- Sequence
- MERNTKGVLGTKLGMSQVFDDQGRIVPVTVVKAGPCVVTAVRTPERDGYAGVQLGYGEIDPRKVTKPVAGHFTAAGVTPRRYLAELRTSDASEYTLGQEVTAEVFAPGQLVDVTGKSKGKGTAGVVKRHGFRGLSASHGTQRKHRAPGSIGGCATPGRVFKGLRMAGRMGSERVTVQSLTVHAVDAERGLLLIKGAVPGSPGGLVLVRSAAKAPAGVATSAEGAG
Sample Types
Isolate
29.8%
Metagenome
68.9%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.8%
Unclassified
21.3%
Kalotermitidae
11.2%
Tenebrionidae
9.0%
Culicidae
5.6%
Formicidae
4.5%
Termopsidae
4.5%
Cambaridae
3.4%
Scarabaeidae
3.4%
Armadillidiidae
2.2%
Hydrophilidae
2.2%
Rhinotermitidae
2.2%
Pyralidae
1.1%
Hodotermitidae
1.1%
Siricidae
1.1%
Curculionidae
1.1%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 2 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 3 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 4 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 5 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 6 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 7 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 10 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 11 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 12 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 13 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 14 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 17 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 18 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 19 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 20 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 21 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 22 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 27 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 28 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 29 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 36 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 37 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 38 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 39 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 40 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 41 | 3300060774 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 42 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 43 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 44 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 45 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 49 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 50 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 51 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 52 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 53 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 54 | 2873603790 | Tessaracoccus coleopterorum HDW20 | Isolate | Hydrophilidae |
| 55 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 56 | 3300060896 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 60 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 61 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 62 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 65 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 66 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 67 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 68 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 69 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 70 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 71 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 72 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 73 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 74 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 75 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 76 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 77 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 78 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 79 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 80 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 81 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 82 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 83 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 84 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 85 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 86 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 87 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 88 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 89 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 90 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 91 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 92 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 93 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 94 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 95 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562376_0002 | 3300056857 | Bacteria | 3502070 |
| 2 | Ga0562376_0281 | 3300056857 | Bacteria | 101378 |
| 3 | Ga0466718_152904 | 3300042617 | Bacteria | 12214 |
| 4 | Ga0466707_421729 | 3300042601 | Bacteria | 13878 |
| 5 | Ga0466703_325455 | 3300042636 | Bacteria | 14564 |
| 6 | Ga0466725_000130 | 3300042654 | Bacteria | 1478 |
| 7 | Ga0160430_119511 | 3300012852 | Bacteria | 953 |
| 8 | Ga0466691_012570 | 3300042593 | Bacteria | 32910 |
| 9 | Ga0068302_10010595 | 3300005071 | Unclassified | 1195 |
| 10 | Ga0562374_2901 | 3300057007 | Unclassified | 12325 |
| 11 | Ga0466711_253939 | 3300042615 | Bacteria | 18586 |
| 12 | Ga0466722_198999 | 3300042609 | Bacteria | 1238 |
| 13 | Ga0466730_023907 | 3300042625 | Unclassified | 12809 |
| 14 | Ga0466703_144605 | 3300042636 | Bacteria | 9715 |
| 15 | Ga0160447_106657 | 3300012849 | Bacteria | 3023 |
| 16 | Ga0123357_10275603 | 3300009784 | Bacteria | 1748 |
| 17 | Ga0123353_10265637 | 3300010167 | Unclassified | 2648 |
| 18 | Ga0562378_2407 | 3300056814 | Unclassified | 15648 |
| 19 | Ga0562375_0569 | 3300056856 | Bacteria | 72979 |
| 20 | Ga0562376_0007 | 3300056857 | Bacteria | 1429637 |
| 21 | Ga0562376_0418 | 3300056857 | Bacteria | 79667 |
| 22 | Ga0590798_01403 | 3300060774 | Unclassified | 1970 |
| 23 | Ga0466715_562604 | 3300042616 | Bacteria | 3932 |
| 24 | Ga0466713_156493 | 3300042602 | Bacteria | 2330 |
| 25 | Ga0466729_243078 | 3300042621 | Bacteria | 1508 |
| 26 | Ga0466734_086470 | 3300042623 | Bacteria | 2112 |
| 27 | Ga0466730_066804 | 3300042625 | Unclassified | 1042 |
| 28 | Ga0160435_1001144 | 3300012857 | Bacteria | 6896 |
| 29 | Ga0415639_095019 | 3300038395 | Bacteria | 3384 |
| 30 | Ga0466696_320011 | 3300042596 | Bacteria | 10233 |
| 31 | Ga0123354_10008932 | 3300010882 | Bacteria | 15296 |
| 32 | Ga0123354_10315889 | 3300010882 | Unclassified | 1450 |
| 33 | Ga0160442_100065 | 3300012806 | Bacteria | 144556 |
| 34 | Ga0072940_1253174 | 3300005200 | Bacteria | 852 |
| 35 | Ga0123357_10001625 | 3300009784 | Bacteria | 24088 |
| 36 | Ga0123357_10001723 | 3300009784 | Bacteria | 23593 |
| 37 | Ga0466705_343361 | 3300042612 | Bacteria | 14966 |
| 38 | Ga0590775_07978 | 3300060896 | Bacteria | 1525 |
| 39 | Ga0466710_208321 | 3300042613 | Bacteria | 11430 |
| 40 | Ga0466719_350968 | 3300042606 | Bacteria | 1496 |
| 41 | Ga0466722_155738 | 3300042609 | Bacteria | 28782 |
| 42 | Ga0466730_064112 | 3300042625 | Bacteria | 1156 |
| 43 | Ga0466727_280039 | 3300042655 | Bacteria | 1114 |
| 44 | Ga0160458_105346 | 3300012832 | Unclassified | 1528 |
| 45 | Ga0466696_350585 | 3300042596 | Bacteria | 3349 |
| 46 | Ga0123357_10475116 | 3300009784 | Unclassified | 1061 |
| 47 | Ga0123353_10000701 | 3300010167 | Bacteria | 40961 |
| 48 | Ga0123353_10917083 | 3300010167 | Bacteria | 1190 |
| 49 | Ga0123357_10001429 | 3300009784 | Bacteria | 25338 |
| 50 | Ga0562377_0161 | 3300056842 | Bacteria | 189060 |
| 51 | Ga0466715_134740 | 3300042616 | Bacteria | 2266 |
| 52 | Ga0466723_189940 | 3300042618 | Bacteria | 29161 |
| 53 | Ga0466706_185014 | 3300042599 | Bacteria | 3626 |
| 54 | Ga0466707_351878 | 3300042601 | Bacteria | 23367 |
| 55 | Ga0466735_162252 | 3300042624 | Bacteria | 2196 |
| 56 | Ga0466730_017240 | 3300042625 | Bacteria | 1175 |
| 57 | Ga0466730_055821 | 3300042625 | Bacteria | 8238 |
| 58 | Ga0466727_119340 | 3300042655 | Bacteria | 6208 |
| 59 | Ga0160447_112728 | 3300012849 | Bacteria | 1695 |
| 60 | Ga0123357_10066173 | 3300009784 | Unclassified | 4822 |
| 61 | Ga0123356_10026024 | 3300010049 | Bacteria | 5499 |
| 62 | Ga0123353_10192274 | 3300010167 | Bacteria | 3220 |
| 63 | Ga0562379_0191 | 3300056790 | Bacteria | 175707 |
| 64 | Ga0562377_2598 | 3300056842 | Bacteria | 12848 |
| 65 | Ga0466705_402140 | 3300042612 | Bacteria | 1008 |
| 66 | Ga0466710_175050 | 3300042613 | Bacteria | 1523 |
| 67 | Ga0466711_068649 | 3300042615 | Bacteria | 1206 |
| 68 | Ga0466707_086104 | 3300042601 | Bacteria | 138731 |
| 69 | Ga0466722_112981 | 3300042609 | Bacteria | 1519 |
| 70 | Ga0466730_023397 | 3300042625 | Bacteria | 2005 |
| 71 | Ga0123355_10490746 | 3300009826 | Bacteria | 1521 |
| 72 | Ga0123354_10022573 | 3300010882 | Bacteria | 9921 |
| 73 | Ga0123354_10118732 | 3300010882 | Unclassified | 3431 |
| 74 | Ga0123357_10000640 | 3300009784 | Bacteria | 34769 |
| 75 | Ga0466697_143551 | 3300042611 | Bacteria | 2381 |
| 76 | Ga0562375_3766 | 3300056856 | Bacteria | 13275 |
| 77 | Ga0562376_0223 | 3300056857 | Bacteria | 114445 |
| 78 | Ga0466711_009545 | 3300042615 | Bacteria | 1231 |
| 79 | Ga0466726_207676 | 3300042619 | Bacteria | 2654 |
| 80 | Ga0466713_145633 | 3300042602 | Bacteria | 1791 |
| 81 | Ga0466730_007810 | 3300042625 | Bacteria | 11605 |
| 82 | Ga0466704_109485 | 3300042643 | Bacteria | 14274 |
| 83 | Ga0466704_582723 | 3300042643 | Bacteria | 43560 |
| 84 | Ga0466724_64838 | 3300042649 | Bacteria | 17323 |
| 85 | Ga0466708_171991 | 3300042652 | Bacteria | 11415 |
| 86 | Ga0160432_104610 | 3300012818 | Bacteria | 1502 |
| 87 | Ga0160446_100161 | 3300012835 | Bacteria | 52061 |
| 88 | Ga0160446_102520 | 3300012835 | Unclassified | 3184 |
| 89 | Ga0123353_10442229 | 3300010167 | Bacteria | 1917 |
| 90 | Ga0123357_10002532 | 3300009784 | Bacteria | 20451 |
| 91 | Ga0466705_371630 | 3300042612 | Bacteria | 1902 |
| 92 | Ga0562375_0042 | 3300056856 | Bacteria | 527811 |
| 93 | Ga0466723_043574 | 3300042618 | Bacteria | 14699 |
| 94 | Ga0466723_160743 | 3300042618 | Bacteria | 1276 |
| 95 | Ga0466723_319227 | 3300042618 | Bacteria | 1479 |
| 96 | Ga0466706_047001 | 3300042599 | Bacteria | 29829 |
| 97 | Ga0466707_046235 | 3300042601 | Bacteria | 2048 |
| 98 | Ga0466708_205008 | 3300042652 | Bacteria | 28180 |
| 99 | Ga0160455_103445 | 3300012837 | Bacteria | 2415 |
| 100 | Ga0160430_121492 | 3300012852 | Bacteria | 882 |
| 101 | Ga0160457_1000057 | 3300012858 | Bacteria | 180491 |
| 102 | Ga0123357_10297225 | 3300009784 | Bacteria | 1638 |
| 103 | Ga0123356_10025041 | 3300010049 | Bacteria | 5609 |
| 104 | Ga0123354_10002396 | 3300010882 | Bacteria | 24675 |
| 105 | Ga0123357_10000801 | 3300009784 | Bacteria | 31843 |
| 106 | Ga0123357_10003044 | 3300009784 | Bacteria | 19002 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005071 | Ga0068302_10010595 | Ga0068302_100105952 | 176 |
| 2 | 3300010049 | Ga0123356_10025041 | Ga0123356_100250412 | 180 |
| 3 | 3300009826 | Ga0123355_10490746 | Ga0123355_104907461 | 181 |
| 4 | 3300042636 | Ga0466703_325455 | Ga0466703_325455_6885_7535 | 181 |
| 5 | 3300010882 | Ga0123354_10315889 | Ga0123354_103158892 | 183 |
| 6 | 3300042654 | Ga0466725_000130 | Ga0466725_000130_43_648 | 183 |
| 7 | 3300056856 | Ga0562375_0042 | Ga0562375_0042_192921_193601 | 184 |
| 8 | 3300012849 | Ga0160447_106657 | Ga0160447_1066574 | 186 |
| 9 | 3300012852 | Ga0160430_119511 | Ga0160430_1195112 | 186 |
| 10 | 3300056857 | Ga0562376_0002 | Ga0562376_0002_3375063_3375743 | 186 |
| 11 | 3300009784 | Ga0123357_10002532 | Ga0123357_1000253215 | 188 |
| 12 | 3300010167 | Ga0123353_10442229 | Ga0123353_104422292 | 188 |
| 13 | 3300042612 | Ga0466705_371630 | Ga0466705_371630_590_1252 | 189 |
| 14 | 3300009784 | Ga0123357_10001429 | Ga0123357_1000142926 | 190 |
| 15 | 3300042599 | Ga0466706_185014 | Ga0466706_185014_1351_2010 | 190 |
| 16 | 3300042612 | Ga0466705_402140 | Ga0466705_402140_66_728 | 190 |
| 17 | 3300042613 | Ga0466710_175050 | Ga0466710_175050_98_742 | 191 |
| 18 | 3300056856 | Ga0562375_3766 | Ga0562375_3766_8994_9674 | 191 |
| 19 | 3300042601 | Ga0466707_086104 | Ga0466707_086104_27311_27973 | 192 |
| 20 | 3300042615 | Ga0466711_009545 | Ga0466711_009545_187_816 | 192 |
| 21 | 3300042615 | Ga0466711_068649 | Ga0466711_068649_522_1184 | 192 |
| 22 | 3300042623 | Ga0466734_086470 | Ga0466734_086470_530_1180 | 192 |
| 23 | 3300042643 | Ga0466704_109485 | Ga0466704_109485_1587_2249 | 192 |
| 24 | 3300057007 | Ga0562374_2901 | Ga0562374_2901_34_702 | 192 |
| 25 | 3300009784 | Ga0123357_10066173 | Ga0123357_100661734 | 193 |
| 26 | 3300009784 | Ga0123357_10275603 | Ga0123357_102756032 | 194 |
| 27 | 3300009784 | Ga0123357_10297225 | Ga0123357_102972252 | 194 |
| 28 | 3300010882 | Ga0123354_10022573 | Ga0123354_100225739 | 194 |
| 29 | 3300010882 | Ga0123354_10118732 | Ga0123354_101187322 | 194 |
| 30 | 3300005200 | Ga0072940_1253174 | Ga0072940_12531741 | 195 |
| 31 | 3300042616 | Ga0466715_134740 | Ga0466715_134740_557_1219 | 195 |
| 32 | 3300042616 | Ga0466715_562604 | Ga0466715_562604_2876_3538 | 195 |
| 33 | 3300042619 | Ga0466726_207676 | Ga0466726_207676_1576_2196 | 195 |
| 34 | 3300009784 | Ga0123357_10001723 | Ga0123357_100017237 | 196 |
| 35 | 3300042602 | Ga0466713_156493 | Ga0466713_156493_237_905 | 196 |
| 36 | 3300056857 | Ga0562376_0223 | Ga0562376_0223_16795_17475 | 196 |
| 37 | 3300012857 | Ga0160435_1001144 | Ga0160435_10011445 | 197 |
| 38 | 3300042596 | Ga0466696_320011 | Ga0466696_320011_7877_8539 | 197 |
| 39 | 3300042612 | Ga0466705_343361 | Ga0466705_343361_7683_8333 | 197 |
| 40 | 3300042655 | Ga0466727_119340 | Ga0466727_119340_113_763 | 197 |
| 41 | 3300010049 | Ga0123356_10026024 | Ga0123356_100260246 | 198 |
| 42 | 3300010167 | Ga0123353_10000701 | Ga0123353_100007012 | 198 |
| 43 | 3300042609 | Ga0466722_155738 | Ga0466722_155738_16948_17604 | 198 |
| 44 | 3300042618 | Ga0466723_043574 | Ga0466723_043574_5180_5857 | 198 |
| 45 | 3300042618 | Ga0466723_160743 | Ga0466723_160743_278_955 | 198 |
| 46 | 3300042643 | Ga0466704_582723 | Ga0466704_582723_35909_36559 | 198 |
| 47 | 3300042606 | Ga0466719_350968 | Ga0466719_350968_576_1232 | 200 |
| 48 | 3300042617 | Ga0466718_152904 | Ga0466718_152904_2341_2991 | 200 |
| 49 | 3300042625 | Ga0466730_017240 | Ga0466730_017240_303_947 | 200 |
| 50 | 3300010167 | Ga0123353_10192274 | Ga0123353_101922742 | 201 |
| 51 | 3300010167 | Ga0123353_10917083 | Ga0123353_109170832 | 201 |
| 52 | 3300012806 | Ga0160442_100065 | Ga0160442_100065135 | 201 |
| 53 | 3300012818 | Ga0160432_104610 | Ga0160432_1046102 | 201 |
| 54 | 3300012835 | Ga0160446_102520 | Ga0160446_1025203 | 201 |
| 55 | 3300012852 | Ga0160430_121492 | Ga0160430_1214922 | 201 |
| 56 | 3300042599 | Ga0466706_047001 | Ga0466706_047001_20237_20896 | 201 |
| 57 | 3300042601 | Ga0466707_046235 | Ga0466707_046235_713_1372 | 201 |
| 58 | 3300042609 | Ga0466722_198999 | Ga0466722_198999_535_1191 | 201 |
| 59 | 3300042615 | Ga0466711_253939 | Ga0466711_253939_2015_2671 | 201 |
| 60 | 3300042624 | Ga0466735_162252 | Ga0466735_162252_895_1551 | 201 |
| 61 | 3300010882 | Ga0123354_10002396 | Ga0123354_100023963 | 202 |
| 62 | 3300042609 | Ga0466722_112981 | Ga0466722_112981_357_1016 | 202 |
| 63 | 3300042618 | Ga0466723_319227 | Ga0466723_319227_729_1337 | 202 |
| 64 | 3300042621 | Ga0466729_243078 | Ga0466729_243078_395_1003 | 202 |
| 65 | 3300056857 | Ga0562376_0007 | Ga0562376_0007_1198048_1198704 | 202 |
| 66 | 3300060896 | Ga0590775_07978 | Ga0590775_07978_572_1228 | 202 |
| 67 | 3300009784 | Ga0123357_10000640 | Ga0123357_1000064025 | 203 |
| 68 | 3300009784 | Ga0123357_10001625 | Ga0123357_1000162522 | 203 |
| 69 | 3300009784 | Ga0123357_10475116 | Ga0123357_104751162 | 203 |
| 70 | 3300010882 | Ga0123354_10008932 | Ga0123354_100089322 | 203 |
| 71 | 3300038395 | Ga0415639_095019 | Ga0415639_095019_2459_3109 | 203 |
| 72 | 3300012858 | Ga0160457_1000057 | Ga0160457_10000579 | 204 |
| 73 | 3300042596 | Ga0466696_350585 | Ga0466696_350585_944_1612 | 204 |
| 74 | 3300042625 | Ga0466730_064112 | Ga0466730_064112_252_866 | 204 |
| 75 | 3300042636 | Ga0466703_144605 | Ga0466703_144605_976_1644 | 204 |
| 76 | 3300042652 | Ga0466708_205008 | Ga0466708_205008_5763_6431 | 204 |
| 77 | 3300012835 | Ga0160446_100161 | Ga0160446_1001614 | 205 |
| 78 | 3300042601 | Ga0466707_421729 | Ga0466707_421729_10528_11199 | 205 |
| 79 | 3300042618 | Ga0466723_189940 | Ga0466723_189940_6325_7002 | 205 |
| 80 | 3300042601 | Ga0466707_351878 | Ga0466707_351878_13528_14205 | 206 |
| 81 | 3300042602 | Ga0466713_145633 | Ga0466713_145633_193_861 | 206 |
| 82 | 3300042652 | Ga0466708_171991 | Ga0466708_171991_8896_9516 | 206 |
| 83 | 3300042655 | Ga0466727_280039 | Ga0466727_280039_29_649 | 206 |
| 84 | 3300056842 | Ga0562377_2598 | Ga0562377_2598_550_1218 | 206 |
| 85 | 3300009784 | Ga0123357_10000801 | Ga0123357_1000080128 | 210 |
| 86 | 3300042625 | Ga0466730_007810 | Ga0466730_007810_2875_3519 | 214 |
| 87 | 3300042625 | Ga0466730_023907 | Ga0466730_023907_457_1101 | 214 |
| 88 | 3300042625 | Ga0466730_066804 | Ga0466730_066804_131_775 | 214 |
| 89 | iso_pr_bacteria | 2515154100 | 2515556411 | 214 |
| 90 | iso_pr_bacteria | 2515154104 | 2515585762 | 214 |
| 91 | iso_pr_bacteria | 2515154106 | 2515606574 | 214 |
| 92 | iso_pr_bacteria | 2523533511 | 2523591826 | 214 |
| 93 | iso_pr_bacteria | 2547132081 | 2547292702 | 214 |
| 94 | iso_pr_bacteria | 2648501322 | 2649445435 | 214 |
| 95 | iso_pr_bacteria | 2820903739 | 2820904303 | 214 |
| 96 | iso_pr_bacteria | 2873196663 | 2873203589 | 214 |
| 97 | iso_pr_bacteria | 2896955351 | 2896957748 | 214 |
| 98 | iso_pr_bacteria | 2908241010 | 2908245369 | 214 |
| 99 | iso_pr_bacteria | 2912749649 | 2912750151 | 214 |
| 100 | iso_pr_bacteria | 2912817845 | 2912825146 | 214 |
| 101 | iso_pr_bacteria | 3006461590 | 3006462669 | 214 |
| 102 | iso_pr_bacteria | 3006468911 | 3006474028 | 214 |
| 103 | iso_pr_bacteria | 3006667155 | 3006674468 | 214 |
| 104 | iso_pr_bacteria | 647000328 | 647324275 | 214 |
| 105 | iso_pr_bacteria | 8046957834 | 8046958465 | 214 |
| 106 | iso_pr_bacteria | 8053361298 | 8053362080 | 214 |
| 107 | iso_pr_bacteria | 8077783556 | 8077785846 | 214 |
| 108 | 3300009784 | Ga0123357_10003044 | Ga0123357_100030445 | 215 |
| 109 | 3300010167 | Ga0123353_10265637 | Ga0123353_102656372 | 215 |
| 110 | 3300012832 | Ga0160458_105346 | Ga0160458_1053462 | 215 |
| 111 | 3300042625 | Ga0466730_055821 | Ga0466730_055821_3850_4542 | 215 |
| 112 | iso_pr_bacteria | 2772190761 | 2772887924 | 216 |
| 113 | iso_pr_bacteria | 2820863028 | 2820864679 | 216 |
| 114 | iso_pr_bacteria | 2820889385 | 2820890649 | 216 |
| 115 | iso_pr_bacteria | 2837204985 | 2837205863 | 216 |
| 116 | iso_pr_bacteria | 2856652821 | 2856656930 | 216 |
| 117 | iso_pr_bacteria | 2883683260 | 2883684068 | 216 |
| 118 | iso_pr_bacteria | 2898589227 | 2898595051 | 216 |
| 119 | iso_pr_bacteria | 2918390780 | 2918394332 | 216 |
| 120 | iso_pr_bacteria | 8073544309 | 8073550421 | 216 |
| 121 | iso_pr_bacteria | 8118075156 | 8118076906 | 216 |
| 122 | 3300042613 | Ga0466710_208321 | Ga0466710_208321_1767_2420 | 217 |
| 123 | iso_pr_bacteria | 2820825283 | 2820826971 | 217 |
| 124 | iso_pr_bacteria | 2873589062 | 2873589292 | 218 |
| 125 | iso_pr_bacteria | 2873603790 | 2873605081 | 218 |
| 126 | iso_pr_bacteria | 2931430189 | 2931432287 | 218 |
| 127 | iso_pr_bacteria | 8067071256 | 8067077398 | 218 |
| 128 | 3300042649 | Ga0466724_64838 | Ga0466724_64838_13093_13752 | 219 |
| 129 | iso_pr_bacteria | 2820899690 | 2820900466 | 219 |
| 130 | iso_pr_bacteria | 2821314491 | 2821316546 | 219 |
| 131 | iso_pr_bacteria | 2847305884 | 2847306483 | 219 |
| 132 | iso_pr_bacteria | 2861945162 | 2861945184 | 219 |
| 133 | 3300012837 | Ga0160455_103445 | Ga0160455_1034454 | 220 |
| 134 | 3300012849 | Ga0160447_112728 | Ga0160447_1127282 | 220 |
| 135 | 3300042611 | Ga0466697_143551 | Ga0466697_143551_1261_1923 | 220 |
| 136 | iso_pr_bacteria | 2884351759 | 2884355138 | 220 |
| 137 | iso_pr_bacteria | 2900354037 | 2900356575 | 221 |
| 138 | iso_pr_bacteria | 2900368070 | 2900368530 | 221 |
| 139 | iso_pr_bacteria | 2909412500 | 2909412859 | 222 |
| 140 | iso_pr_bacteria | 8062637095 | 8062639512 | 222 |
| 141 | iso_pr_bacteria | 8062747827 | 8062748399 | 222 |
| 142 | 3300056790 | Ga0562379_0191 | Ga0562379_0191_142082_142756 | 224 |
| 143 | 3300056814 | Ga0562378_2407 | Ga0562378_2407_12984_13658 | 224 |
| 144 | 3300056842 | Ga0562377_0161 | Ga0562377_0161_58874_59548 | 224 |
| 145 | 3300056856 | Ga0562375_0569 | Ga0562375_0569_60924_61598 | 224 |
| 146 | 3300056857 | Ga0562376_0281 | Ga0562376_0281_48255_48929 | 224 |
| 147 | 3300056857 | Ga0562376_0418 | Ga0562376_0418_15320_15994 | 224 |
| 148 | 3300060774 | Ga0590798_01403 | Ga0590798_01403_711_1385 | 224 |
| 149 | iso_pr_bacteria | 8012935351 | 8012938325 | 224 |
| 150 | 3300042625 | Ga0466730_023397 | Ga0466730_023397_1021_1698 | 225 |
| 151 | 3300042593 | Ga0466691_012570 | Ga0466691_012570_3862_4545 | 227 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00297 | Ribosomal_L3 | Ribosomal protein L3 | 98 | 184 | 0.84 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.72 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.