Protein Family IF08863
Metagenome
Isolate
230
Members
201
Samples
73
Scaffolds
288.06
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_006821|Ga0466730_006821_1073_2092
- Length
- 339 aa
- Sequence
- MLNISPVIRGLSLTIILTSPTLYYSPYQSLSIVGYDVVSALRALQKLTKEEYAVADSNQWHETLHDHFGQYFTVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFVYHEMMTHVPLLAHGQAKHVLIIGGGDGAMLREVSRHPHIDTITMVEIDAGVVSFCRQYLPKHNAGAYDDPRFTLVIDDGVNFVTQTSQTFDVIISDCTDPIGPGESLFTSAFYAGCKRCLNPGGVFVAQNGVSFLQQDEAVGSHRKLSHYFSDVSFYQAAVPTYYGGMMTFAWATDNEALRHLSTEIIQARFHSANLQCRYYNPAIHTAAFALPQYLLDALAAS
Sample Types
Isolate
68.3%
Metagenome
31.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Aphididae
17.4%
Unclassified
14.7%
Anthocoridae
11.1%
Drosophilidae
7.9%
Muscidae
6.8%
Curculionidae
5.8%
Tenebrionidae
4.7%
Culicidae
4.2%
Calliphoridae
3.7%
Apidae
2.6%
Elmidae
2.6%
Tephritidae
2.6%
Cerambycidae
1.6%
Sarcophagidae
1.1%
Pentatomidae
1.1%
Pteromalidae
1.1%
Armadillidiidae
1.1%
Termitidae
1.1%
Acrididae
0.5%
Scarabaeidae
0.5%
Trigoniulidae
0.5%
Plutellidae
0.5%
Reduviidae
0.5%
Glossinidae
0.5%
Carabidae
0.5%
Rhopalidae
0.5%
Siricidae
0.5%
Crambidae
0.5%
Gryllidae
0.5%
Thripidae
0.5%
Anthomyiidae
0.5%
Formicidae
0.5%
Aleyrodidae
0.5%
Daphniidae
0.5%
Aphrophoridae
0.5%
Taxonomy
Archaea
0
Bacteria
210
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 2 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 3 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 4 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 5 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 6 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 7 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 8 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 9 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 10 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 11 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 12 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 13 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 14 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 15 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 16 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 17 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 18 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 19 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 20 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 21 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 22 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 23 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 24 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 25 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 26 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 29 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 30 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 31 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 32 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 33 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 34 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 35 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 36 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 37 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 38 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 39 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 40 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 41 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 42 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 43 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 44 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 45 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 46 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 47 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 48 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 49 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 50 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 51 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 52 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 53 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 54 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 55 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 56 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 57 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 58 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 59 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 60 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 61 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 62 | 3300009473 | Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov | Metagenome | |
| 63 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 64 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 65 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 66 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 67 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 68 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 69 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 70 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 71 | 8076029720 | Erwinia haradaeae ErCisplendens/3004 | Isolate | Aphididae |
| 72 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 73 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 74 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 75 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 76 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 77 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 78 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 79 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 80 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 81 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 82 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 83 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 84 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 85 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 86 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 87 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 88 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 89 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 90 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 91 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 92 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 93 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 94 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 95 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 96 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 97 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 98 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 99 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 100 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 101 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 102 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 103 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 104 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 105 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 106 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 107 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 108 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 109 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 110 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 111 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 112 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 113 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 114 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 115 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 116 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 117 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 118 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 119 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 120 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 121 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 122 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 123 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 124 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 125 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 126 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 127 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 128 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 129 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 130 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 131 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 132 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 133 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 134 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 135 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 136 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 137 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 138 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 139 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 140 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 141 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 142 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 143 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 144 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 145 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 146 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 147 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 148 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 149 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 150 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 151 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 152 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 153 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 154 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 155 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 156 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 157 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 158 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 159 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 160 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 161 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 162 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 163 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 164 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 165 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 166 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 167 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 168 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 169 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 170 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 171 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 172 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 173 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 174 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 175 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 176 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 177 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 178 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 179 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 180 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 181 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 182 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 183 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 184 | 3300009535 | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov | Metagenome | Aphididae |
| 185 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 186 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 187 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 188 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 189 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 190 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 191 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 192 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 193 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 194 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 195 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 196 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 197 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 198 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 199 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 200 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 201 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_057070 | 3300042625 | Unclassified | 1112 |
| 2 | Ga0466724_08494 | 3300042649 | Unclassified | 75134 |
| 3 | Ga0466724_62885 | 3300042649 | Bacteria | 30963 |
| 4 | Ga0160433_103442 | 3300012846 | Bacteria | 2857 |
| 5 | GhopperDRAF_NODE_179956_len_2014_cov_9_268620 | 2035265001 | Unclassified | 2044 |
| 6 | HBC_ctgsDRAFT_1000020 | 3300000333 | Bacteria | 41152 |
| 7 | Ga0105005_1039508 | 3300007505 | Unclassified | 5826 |
| 8 | Ga0127649_143847 | 3300009460 | Unclassified | 2202 |
| 9 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 10 | Ga0466724_02257 | 3300042649 | Bacteria | 23804 |
| 11 | Ga0160433_101111 | 3300012846 | Bacteria | 8234 |
| 12 | Ga0247289_1334 | 3300035363 | Bacteria | 2363 |
| 13 | Ga0466713_022509 | 3300042602 | Bacteria | 91675 |
| 14 | Ga0466713_065405 | 3300042602 | Bacteria | 109397 |
| 15 | SPBB_contig11533 | 2044078006 | Bacteria | 58956 |
| 16 | SWWA_contig05513__length_9787___numreads_191 | 2100351016 | Unclassified | 9787 |
| 17 | Meta3P_1000402 | 3300002464 | Bacteria | 34913 |
| 18 | Meta3P_1001794 | 3300002464 | Unclassified | 8222 |
| 19 | CVPL010L_1001445 | 3300002932 | Unclassified | 5933 |
| 20 | Ga0104051_1103475 | 3300007078 | Unclassified | 1532 |
| 21 | Ga0104147_1020743 | 3300007224 | Bacteria | 10075 |
| 22 | Ga0530661_000216 | 3300056564 | Bacteria | 47873 |
| 23 | Ga0562375_0487 | 3300056856 | Bacteria | 82467 |
| 24 | Ga0466713_031655 | 3300042602 | Unclassified | 2268 |
| 25 | FGTW_contig04970 | 2065487013 | Unclassified | 1204 |
| 26 | WW0001_100329 | 3300002732 | Bacteria | 124152 |
| 27 | Ga0104041_1002422 | 3300007106 | Bacteria | 14193 |
| 28 | Ga0105553_1034740 | 3300007767 | Bacteria | 8406 |
| 29 | Ga0127520_1000008 | 3300009473 | Bacteria | 642906 |
| 30 | Ga0466730_030701 | 3300042625 | Unclassified | 1515 |
| 31 | Ga0160448_114707 | 3300012854 | Bacteria | 1440 |
| 32 | Ga0466707_004354 | 3300042601 | Bacteria | 82691 |
| 33 | Ga0136160_1000084 | 3300010225 | Bacteria | 222661 |
| 34 | HBC_ctgsDRAFT_1000384 | 3300000333 | Bacteria | 10172 |
| 35 | Ga0105005_1004030 | 3300007505 | Bacteria | 2385 |
| 36 | Ga0127648_100010 | 3300009534 | Bacteria | 473475 |
| 37 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 38 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 39 | Ga0466730_011389 | 3300042625 | Bacteria | 8501 |
| 40 | Ga0160435_1000703 | 3300012857 | Bacteria | 9559 |
| 41 | Ga0265387_1000051 | 3300024582 | Bacteria | 38557 |
| 42 | FGTW_contig32039 | 2065487013 | Unclassified | 2879 |
| 43 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 44 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 45 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
| 46 | Ga0466730_089111 | 3300042625 | Unclassified | 1650 |
| 47 | Ga0466730_095522 | 3300042625 | Bacteria | 3691 |
| 48 | Ga0160433_102325 | 3300012846 | Unclassified | 4173 |
| 49 | Ga0247289_2862 | 3300035363 | Unclassified | 1045 |
| 50 | FGTW_contig08226 | 2065487013 | Unclassified | 4968 |
| 51 | CVPL010L_1000287 | 3300002932 | Bacteria | 29554 |
| 52 | CVPL010L_1002542 | 3300002932 | Bacteria | 2941 |
| 53 | Ga0063521_1000460 | 3300003973 | Bacteria | 20298 |
| 54 | Ga0105008_1092261 | 3300007507 | Bacteria | 6369 |
| 55 | Ga0466730_006821 | 3300042625 | Bacteria | 2390 |
| 56 | FGTW_contig30406 | 2065487013 | Bacteria | 104687 |
| 57 | SWWA_contig32545__length_1413___numreads_16 | 2100351016 | Bacteria | 1413 |
| 58 | CVPL010L_1001793 | 3300002932 | Unclassified | 6177 |
| 59 | Ga0063521_1000141 | 3300003973 | Bacteria | 54099 |
| 60 | Ga0127646_100579 | 3300009458 | Bacteria | 62797 |
| 61 | Ga0127526_1000110 | 3300009535 | Bacteria | 643549 |
| 62 | Ga0466730_016652 | 3300042625 | Bacteria | 24148 |
| 63 | Ga0466730_094411 | 3300042625 | Bacteria | 2179 |
| 64 | Ga0160460_100368 | 3300012845 | Unclassified | 30222 |
| 65 | Ga0160445_100197 | 3300012847 | Bacteria | 46617 |
| 66 | Ga0160436_1011395 | 3300012861 | Bacteria | 1907 |
| 67 | Ga0265387_1000893 | 3300024582 | Bacteria | 4515 |
| 68 | Ga0120204_000016 | 3300038942 | Bacteria | 8825 |
| 69 | FGTW_contig32614 | 2065487013 | Unclassified | 2368 |
| 70 | Ga0063521_1000243 | 3300003973 | Bacteria | 36894 |
| 71 | Ga0074188_1000438 | 3300005318 | Bacteria | 3358 |
| 72 | Ga0104040_1041374 | 3300007149 | Bacteria | 4426 |
| 73 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.