Protein Family IF08842

Metagenome Isolate
147 Members
55 Samples
136 Scaffolds
273.67 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_207802|Ga0466735_207802_270_1250
Length
326 aa
Sequence
LSIENQDKFSVARIFRTPLMRSRLAKSFYGVIEYYRSLEDTKVRTKRIGGRRMSLEQSHEKLKQILTDLGSVAVAFSGGVDSTFLLKTAHDTLGSRAIAVTARSASFPKRELDEAIAFCKEENIEHILCDSEELDIEGFSSNPTNRCYLCKNELFTKIWDVAKAHGIAHIAEGSNLDDNGDYRPGLIAAKEQGAQSPLRQAGLTKQDIRTLSKELGLKTWDKPSFACLSSRFPYGETINQEKLSMVDQAEQYLMDMGIRQVRVRHHGDLARIEADPAGMELLLDDARRQETYTALKRIGFTYVALDLLGYRTGSMNESLGLVAGAL

📊 Sample Types

Isolate 7.5%
Metagenome 92.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.0%
Kalotermitidae 24.5%
Unclassified 17.0%
Blattidae 9.4%
Termopsidae 7.5%
Rhinotermitidae 5.7%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 2
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
8 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
15 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
25 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
32 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
33 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
49 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
50 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
51 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
52 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_250370 3300042614 Unclassified 6055
2 Ga0466711_308309 3300042615 Bacteria 3239
3 Ga0466726_142478 3300042619 Bacteria 1841
4 Ga0123353_10214522 3300010167 Bacteria 3016
5 Ga0466704_106551 3300042643 Bacteria 44290
6 Ga0466704_546462 3300042643 Bacteria 26528
7 Ga0466708_430525 3300042652 Bacteria 41341
8 Ga0466727_254449 3300042655 Bacteria 3106
9 Ga0466716_312933 3300042605 Bacteria 15166
10 Ga0466719_101894 3300042606 Bacteria 6333
11 Ga0466705_145863 3300042612 Bacteria 10136
12 Ga0466705_182930 3300042612 Bacteria 2533
13 Ga0466732_123581 3300042656 Bacteria 7587
14 Ga0466712_149563 3300042614 Bacteria 12473
15 Ga0466715_188592 3300042616 Bacteria 24903
16 Ga0466718_108141 3300042617 Bacteria 1590
17 Ga0466718_119409 3300042617 Bacteria 1979
18 Ga0466726_171928 3300042619 Bacteria 1373
19 Ga0466728_306322 3300042620 Bacteria 70422
20 Ga0123353_10020289 3300010167 Bacteria 9921
21 Ga0123353_10164436 3300010167 Bacteria 3529
22 JGI24698J34947_10000049 3300002449 Bacteria 34934
23 Ga0072941_1161875 3300005201 Bacteria 1964
24 Ga0466703_045765 3300042636 Archaea 62978
25 Ga0466704_427059 3300042643 Unclassified 2528
26 Ga0466706_197211 3300042599 Bacteria 1744
27 Ga0466707_162738 3300042601 Bacteria 20853
28 Ga0466707_303629 3300042601 Unclassified 3201
29 Ga0466707_328941 3300042601 Bacteria 7141
30 Ga0466705_011014 3300042612 Unclassified 6202
31 Ga0466712_162461 3300042614 Bacteria 25933
32 Ga0466715_133947 3300042616 Bacteria 1868
33 Ga0466715_247484 3300042616 Bacteria 26148
34 Ga0466718_044271 3300042617 Bacteria 20629
35 Ga0123357_10127538 3300009784 Bacteria 3181
36 Ga0123353_10004845 3300010167 Bacteria 17484
37 FAAS_10004372 3300001880 Bacteria 1819
38 Ga0068305_10001964 3300005083 Bacteria 66110
39 Ga0068305_10324972 3300005083 Bacteria 5936
40 Ga0466730_040144 3300042625 Bacteria 1003
41 Ga0466692_198979 3300042591 Bacteria 17823
42 Ga0466691_081085 3300042593 Bacteria 49973
43 Ga0466691_195459 3300042593 Bacteria 2955
44 Ga0466691_205450 3300042593 Bacteria 2262
45 Ga0466707_258668 3300042601 Bacteria 1924
46 Ga0466705_075113 3300042612 Bacteria 5916
47 Ga0466723_069685 3300042618 Bacteria 37935
48 Ga0466729_165148 3300042621 Bacteria 26707
49 Ga0123356_10358875 3300010049 Bacteria 1584
50 Ga0123353_10482408 3300010167 Bacteria 1814
51 JGI24698J34947_10027921 3300002449 Bacteria 2993
52 JGI24702J35022_10055513 3300002462 Bacteria 2113
53 Ga0466735_030292 3300042624 Bacteria 1709
54 Ga0466735_056347 3300042624 Bacteria 5203
55 Ga0466703_064270 3300042636 Unclassified 10001
56 Ga0466703_320981 3300042636 Bacteria 3716
57 Ga0466704_540187 3300042643 Bacteria 4494
58 Ga0466727_233653 3300042655 Bacteria 18435
59 Ga0466691_097871 3300042593 Bacteria 10477
60 Ga0466695_354881 3300042595 Bacteria 2074
61 Ga0466707_193542 3300042601 Bacteria 18301
62 Ga0466713_122420 3300042602 Unclassified 4841
63 Ga0466722_240478 3300042609 Bacteria 27189
64 Ga0466715_269349 3300042616 Bacteria 1500
65 Ga0123355_10749248 3300009826 Bacteria 1105
66 Ga0123353_10000922 3300010167 Bacteria 35870
67 Ga0068302_10585361 3300005071 Bacteria 2095
68 Ga0466702_302802 3300042635 Bacteria 1625
69 Ga0466703_187158 3300042636 Bacteria 5125
70 Ga0466703_297849 3300042636 Bacteria 43169
71 Ga0466704_063233 3300042643 Bacteria 3689
72 Ga0466704_212682 3300042643 Bacteria 12588
73 Ga0466727_234251 3300042655 Bacteria 2506
74 Ga0466690_145387 3300042590 Bacteria 1841
75 Ga0466694_129771 3300042594 Bacteria 4863
76 Ga0466696_017333 3300042596 Bacteria 2575
77 Ga0466699_108879 3300042597 Bacteria 1250
78 Ga0466707_062874 3300042601 Bacteria 12202
79 Ga0466707_216566 3300042601 Bacteria 7585
80 Ga0466711_067687 3300042615 Bacteria 54166
81 Ga0466726_045169 3300042619 Bacteria 3233
82 Ga0466726_483813 3300042619 Bacteria 2319
83 Ga0123353_10015416 3300010167 Bacteria 11101
84 Ga0123353_10153923 3300010167 Bacteria 3668
85 Ga0123354_10285547 3300010882 Bacteria 1593
86 JGI24698J34947_10055725 3300002449 Unclassified 1968
87 JGI24702J35022_10104812 3300002462 Bacteria 1551
88 Ga0072940_1081957 3300005200 Bacteria 2403
89 Ga0072940_1081958 3300005200 Bacteria 7240
90 Ga0466735_123283 3300042624 Bacteria 1655
91 Ga0466702_234249 3300042635 Bacteria 1943
92 Ga0466708_444729 3300042652 Bacteria 5556
93 Ga0466727_015262 3300042655 Bacteria 10689
94 Ga0466691_221705 3300042593 Bacteria 3621
95 Ga0466713_014663 3300042602 Bacteria 7481
96 Ga0466713_086528 3300042602 Bacteria 28618
97 Ga0466713_130929 3300042602 Bacteria 6099
98 Ga0466722_090079 3300042609 Bacteria 3583
99 Ga0466705_205289 3300042612 Bacteria 20695
100 Ga0466705_256177 3300042612 Bacteria 11164
101 Ga0466733_153254 3300042659 Bacteria 6053
102 Ga0466723_322192 3300042618 Bacteria 41479
103 Ga0466726_310123 3300042619 Bacteria 2820
104 Ga0466729_176705 3300042621 Bacteria 4141
105 JGI24698J34947_10005646 3300002449 Bacteria 6859
106 Ga0466702_229391 3300042635 Bacteria 2569
107 Ga0466704_147711 3300042643 Bacteria 31590
108 Ga0466704_294287 3300042643 Bacteria 14489
109 Ga0466708_270038 3300042652 Bacteria 13224
110 Ga0466727_041865 3300042655 Bacteria 123201
111 Ga0466727_167800 3300042655 Bacteria 6202
112 Ga0466727_249059 3300042655 Bacteria 4335
113 Ga0466727_331590 3300042655 Bacteria 1165
114 Ga0466695_064730 3300042595 Bacteria 5576
115 Ga0466707_390192 3300042601 Bacteria 4088
116 Ga0466719_259921 3300042606 Bacteria 4780
117 Ga0466732_239201 3300042656 Bacteria 1238
118 Ga0466705_484617 3300042612 Bacteria 3161
119 Ga0466711_158948 3300042615 Bacteria 7158
120 Ga0466723_051470 3300042618 Bacteria 7015
121 Ga0123356_10165493 3300010049 Bacteria 2215
122 Ga0123353_10446636 3300010167 Archaea 1905
123 JGI24698J34947_10024764 3300002449 Bacteria 3200
124 JGI24698J34947_10053449 3300002449 Bacteria 2021
125 Ga0068305_10000004 3300005083 Bacteria 52322
126 Ga0072940_1592750 3300005200 Unclassified 971
127 Ga0072941_1748505 3300005201 Bacteria 1632
128 Ga0466735_207802 3300042624 Bacteria 2002
129 Ga0466702_088838 3300042635 Bacteria 1957
130 Ga0466708_095493 3300042652 Bacteria 22161
131 Ga0466708_169080 3300042652 Bacteria 4042
132 Ga0466725_134742 3300042654 Bacteria 3413
133 Ga0466727_074714 3300042655 Bacteria 15477
134 Ga0466690_338573 3300042590 Unclassified 4756
135 Ga0466699_016707 3300042597 Bacteria 1106
136 Ga0466713_016475 3300042602 Bacteria 22989

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1592750 Ga0072940_15927501 262
2 3300009826 Ga0123355_10749248 Ga0123355_107492481 262
3 iso_pr_bacteria 2820464928 2820465964 263
4 3300005201 Ga0072941_1748505 Ga0072941_17485051 265
5 3300042601 Ga0466707_162738 Ga0466707_162738_11084_11881 265
6 3300042601 Ga0466707_193542 Ga0466707_193542_10800_11597 265
7 3300042601 Ga0466707_303629 Ga0466707_303629_245_1042 265
8 3300002462 JGI24702J35022_10104812 JGI24702J35022_101048122 266
9 3300010167 Ga0123353_10020289 Ga0123353_100202892 266
10 3300042617 Ga0466718_044271 Ga0466718_044271_1738_2538 266
11 3300042590 Ga0466690_338573 Ga0466690_338573_858_1661 267
12 3300042593 Ga0466691_195459 Ga0466691_195459_282_1085 267
13 3300042593 Ga0466691_221705 Ga0466691_221705_228_1031 267
14 3300042597 Ga0466699_016707 Ga0466699_016707_147_950 267
15 3300042601 Ga0466707_062874 Ga0466707_062874_10424_11227 267
16 3300042601 Ga0466707_328941 Ga0466707_328941_3445_4248 267
17 3300042609 Ga0466722_090079 Ga0466722_090079_2597_3400 267
18 3300042618 Ga0466723_322192 Ga0466723_322192_34587_35390 267
19 3300042643 Ga0466704_427059 Ga0466704_427059_1320_2123 267
20 3300042655 Ga0466727_041865 Ga0466727_041865_39195_39998 267
21 iso_pr_bacteria 2781125694 2781437044 267
22 3300002449 JGI24698J34947_10005646 JGI24698J34947_100056466 268
23 3300005200 Ga0072940_1081957 Ga0072940_10819572 268
24 3300005200 Ga0072940_1081958 Ga0072940_10819588 268
25 3300005201 Ga0072941_1161875 Ga0072941_11618752 268
26 3300010167 Ga0123353_10164436 Ga0123353_101644363 268
27 3300042596 Ga0466696_017333 Ga0466696_017333_1280_2086 268
28 3300042599 Ga0466706_197211 Ga0466706_197211_35_841 268
29 3300042655 Ga0466727_234251 Ga0466727_234251_1107_1913 268
30 3300010167 Ga0123353_10015416 Ga0123353_100154169 269
31 3300042590 Ga0466690_145387 Ga0466690_145387_900_1709 269
32 3300042591 Ga0466692_198979 Ga0466692_198979_1259_2068 269
33 3300042593 Ga0466691_097871 Ga0466691_097871_8640_9449 269
34 3300042605 Ga0466716_312933 Ga0466716_312933_424_1233 269
35 3300042609 Ga0466722_240478 Ga0466722_240478_8895_9704 269
36 3300042612 Ga0466705_011014 Ga0466705_011014_5139_5948 269
37 3300042615 Ga0466711_308309 Ga0466711_308309_2412_3221 269
38 3300042620 Ga0466728_306322 Ga0466728_306322_15957_16766 269
39 3300042621 Ga0466729_176705 Ga0466729_176705_2843_3652 269
40 3300042625 Ga0466730_040144 Ga0466730_040144_48_857 269
41 3300042636 Ga0466703_064270 Ga0466703_064270_5673_6482 269
42 3300042636 Ga0466703_297849 Ga0466703_297849_38403_39212 269
43 3300042643 Ga0466704_212682 Ga0466704_212682_980_1789 269
44 iso_pr_bacteria 2781125693 2781434174 269
45 3300042619 Ga0466726_142478 Ga0466726_142478_68_880 270
46 3300042643 Ga0466704_147711 Ga0466704_147711_28273_29085 270
47 3300042652 Ga0466708_270038 Ga0466708_270038_264_1076 270
48 3300042655 Ga0466727_249059 Ga0466727_249059_3182_3994 270
49 3300009784 Ga0123357_10127538 Ga0123357_101275382 271
50 3300010167 Ga0123353_10153923 Ga0123353_101539233 271
51 3300010167 Ga0123353_10446636 Ga0123353_104466363 271
52 3300042593 Ga0466691_081085 Ga0466691_081085_18974_19789 271
53 3300042601 Ga0466707_216566 Ga0466707_216566_3722_4537 271
54 3300042601 Ga0466707_258668 Ga0466707_258668_218_1033 271
55 3300042601 Ga0466707_390192 Ga0466707_390192_2292_3107 271
56 3300042619 Ga0466726_483813 Ga0466726_483813_632_1447 271
57 3300042636 Ga0466703_320981 Ga0466703_320981_557_1372 271
58 3300042652 Ga0466708_169080 Ga0466708_169080_916_1731 271
59 3300042652 Ga0466708_444729 Ga0466708_444729_2319_3134 271
60 3300042659 Ga0466733_153254 Ga0466733_153254_4579_5394 271
61 3300002449 JGI24698J34947_10027921 JGI24698J34947_100279212 272
62 3300002449 JGI24698J34947_10053449 JGI24698J34947_100534493 272
63 3300042595 Ga0466695_354881 Ga0466695_354881_401_1219 272
64 3300042635 Ga0466702_229391 Ga0466702_229391_295_1113 272
65 3300042636 Ga0466703_045765 Ga0466703_045765_1990_2808 272
66 3300042643 Ga0466704_546462 Ga0466704_546462_20267_21085 272
67 3300042654 Ga0466725_134742 Ga0466725_134742_2184_3002 272
68 3300042655 Ga0466727_167800 Ga0466727_167800_696_1514 272
69 iso_pr_bacteria 2820324456 2820325079 272
70 iso_pr_bacteria 2820831444 2820832900 272
71 3300002462 JGI24702J35022_10055513 JGI24702J35022_100555132 273
72 3300010167 Ga0123353_10000922 Ga0123353_1000092224 273
73 3300010882 Ga0123354_10285547 Ga0123354_102855472 273
74 3300042595 Ga0466695_064730 Ga0466695_064730_2521_3342 273
75 3300042597 Ga0466699_108879 Ga0466699_108879_293_1114 273
76 3300042616 Ga0466715_133947 Ga0466715_133947_673_1494 273
77 3300042616 Ga0466715_188592 Ga0466715_188592_11003_11824 273
78 3300042616 Ga0466715_247484 Ga0466715_247484_6509_7363 273
79 3300042618 Ga0466723_069685 Ga0466723_069685_14368_15189 273
80 3300042655 Ga0466727_254449 Ga0466727_254449_879_1700 273
81 3300042656 Ga0466732_123581 Ga0466732_123581_5929_6750 273
82 3300001880 FAAS_10004372 FAAS_100043722 274
83 3300010167 Ga0123353_10214522 Ga0123353_102145223 274
84 3300042594 Ga0466694_129771 Ga0466694_129771_3763_4587 274
85 3300042602 Ga0466713_016475 Ga0466713_016475_6557_7381 274
86 3300042606 Ga0466719_101894 Ga0466719_101894_2176_3000 274
87 3300042612 Ga0466705_256177 Ga0466705_256177_8236_9060 274
88 3300042614 Ga0466712_149563 Ga0466712_149563_2128_2952 274
89 3300042614 Ga0466712_162461 Ga0466712_162461_18603_19427 274
90 3300042614 Ga0466712_250370 Ga0466712_250370_4500_5324 274
91 3300042624 Ga0466735_030292 Ga0466735_030292_762_1586 274
92 3300042624 Ga0466735_056347 Ga0466735_056347_1141_1965 274
93 3300042635 Ga0466702_088838 Ga0466702_088838_241_1065 274
94 3300042656 Ga0466732_239201 Ga0466732_239201_399_1223 274
95 3300002449 JGI24698J34947_10000049 JGI24698J34947_1000004922 275
96 3300002449 JGI24698J34947_10024764 JGI24698J34947_100247642 275
97 3300002449 JGI24698J34947_10055725 JGI24698J34947_100557252 275
98 3300042612 Ga0466705_075113 Ga0466705_075113_1181_2008 275
99 3300042612 Ga0466705_484617 Ga0466705_484617_532_1359 275
100 3300042617 Ga0466718_108141 Ga0466718_108141_461_1288 275
101 3300042617 Ga0466718_119409 Ga0466718_119409_847_1674 275
102 3300042619 Ga0466726_310123 Ga0466726_310123_718_1545 275
103 3300042635 Ga0466702_302802 Ga0466702_302802_104_931 275
104 3300042655 Ga0466727_233653 Ga0466727_233653_1858_2685 275
105 3300005071 Ga0068302_10585361 Ga0068302_105853612 276
106 3300042602 Ga0466713_122420 Ga0466713_122420_1372_2202 276
107 3300042652 Ga0466708_095493 Ga0466708_095493_15361_16191 276
108 3300042655 Ga0466727_074714 Ga0466727_074714_6092_6922 276
109 iso_pr_bacteria 2940380068 2940385301 276
110 iso_pr_bacteria 2940386776 2940391983 276
111 iso_pr_bacteria 2940393498 2940398707 276
112 iso_pr_bacteria 2940400224 2940405424 276
113 iso_pr_bacteria 2940406939 2940411976 276
114 3300005083 Ga0068305_10000004 Ga0068305_1000000434 277
115 3300005083 Ga0068305_10001964 Ga0068305_1000196434 277
116 3300010049 Ga0123356_10165493 Ga0123356_101654932 277
117 3300042615 Ga0466711_158948 Ga0466711_158948_1034_1867 277
118 3300042619 Ga0466726_171928 Ga0466726_171928_198_1031 277
119 3300042624 Ga0466735_123283 Ga0466735_123283_565_1398 277
120 3300042635 Ga0466702_234249 Ga0466702_234249_249_1082 277
121 3300010167 Ga0123353_10004845 Ga0123353_100048452 278
122 3300010167 Ga0123353_10482408 Ga0123353_104824082 278
123 3300042643 Ga0466704_540187 Ga0466704_540187_1710_2546 278
124 3300005083 Ga0068305_10324972 Ga0068305_103249724 279
125 3300010049 Ga0123356_10358875 Ga0123356_103588751 279
126 3300042602 Ga0466713_014663 Ga0466713_014663_800_1639 279
127 3300042612 Ga0466705_145863 Ga0466705_145863_5241_6080 279
128 3300042643 Ga0466704_063233 Ga0466704_063233_2429_3268 279
129 3300042655 Ga0466727_331590 Ga0466727_331590_279_1118 279
130 3300042606 Ga0466719_259921 Ga0466719_259921_1397_2239 280
131 3300042655 Ga0466727_015262 Ga0466727_015262_7576_8418 280
132 3300042593 Ga0466691_205450 Ga0466691_205450_1207_2052 281
133 3300042616 Ga0466715_269349 Ga0466715_269349_551_1396 281
134 3300042612 Ga0466705_182930 Ga0466705_182930_872_1720 282
135 3300042612 Ga0466705_205289 Ga0466705_205289_7761_8609 282
136 3300042621 Ga0466729_165148 Ga0466729_165148_6839_7687 282
137 3300042643 Ga0466704_106551 Ga0466704_106551_21909_22760 283
138 iso_pr_bacteria 2820234266 2820234681 283
139 3300042636 Ga0466703_187158 Ga0466703_187158_2650_3507 285
140 3300042602 Ga0466713_130929 Ga0466713_130929_4459_5319 286
141 3300042619 Ga0466726_045169 Ga0466726_045169_158_1018 286
142 3300042615 Ga0466711_067687 Ga0466711_067687_45953_46816 287
143 3300042652 Ga0466708_430525 Ga0466708_430525_28624_29487 287
144 3300042618 Ga0466723_051470 Ga0466723_051470_325_1197 290
145 3300042643 Ga0466704_294287 Ga0466704_294287_5372_6247 291
146 3300042602 Ga0466713_086528 Ga0466713_086528_6799_7695 298
147 3300042624 Ga0466735_207802 Ga0466735_207802_270_1250 326

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.