Protein Family IF08835
Metagenome
Isolate
140
Members
66
Samples
132
Scaffolds
206.75
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_190274|Ga0466735_190274_5883_6533
- Length
- 216 aa
- Sequence
- MELSVQKIDGKESGKKIVLDDTVFGIASNDHAIYLDVKQYLANQRQGTSKTKERNEVAYSTKKVVRQKGSGGARHGSIKTNIYVGGGRTFGPRPRDYSFKLNKKLKQLARRSALSLKAKDSAITVLEQFTLEVPKTSAFTSICKNLGFEGRAKVLLVLPENNDNIYLSSRNLQRVKVITSSELTTYDIMNATNLVLVDATVELLNKQLGQELKTIE
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.9%
Kalotermitidae
23.7%
Formicidae
8.5%
Unclassified
8.5%
Drosophilidae
6.8%
Rhinotermitidae
5.1%
Termopsidae
5.1%
Hodotermitidae
1.7%
Bombycidae
1.7%
Armadillidiidae
1.7%
Blattidae
1.7%
Passalidae
1.7%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 28 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 29 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 35 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 43 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 46 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 51 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 56 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 57 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 58 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 59 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 62 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 63 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_010540 | 3300042659 | Bacteria | 1600 |
| 2 | Ga0123356_10038853 | 3300010049 | Bacteria | 4435 |
| 3 | Ga0466712_044382 | 3300042614 | Bacteria | 1547 |
| 4 | Ga0466715_060059 | 3300042616 | Bacteria | 8464 |
| 5 | Ga0466723_215575 | 3300042618 | Bacteria | 14976 |
| 6 | Ga0466690_095939 | 3300042590 | Bacteria | 5717 |
| 7 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 8 | Ga0466693_402862 | 3300042592 | Bacteria | 1287 |
| 9 | Ga0466727_316709 | 3300042655 | Bacteria | 34486 |
| 10 | Ga0466707_417447 | 3300042601 | Bacteria | 2269 |
| 11 | Ga0466722_043304 | 3300042609 | Bacteria | 5441 |
| 12 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 13 | Ga0068305_10166497 | 3300005083 | Bacteria | 2845 |
| 14 | Ga0103263_102158 | 3300007042 | Bacteria | 2453 |
| 15 | Ga0466705_038128 | 3300042612 | Bacteria | 49408 |
| 16 | Ga0466732_073791 | 3300042656 | Bacteria | 2462 |
| 17 | Ga0466715_016723 | 3300042616 | Bacteria | 13247 |
| 18 | Ga0466690_168212 | 3300042590 | Bacteria | 11803 |
| 19 | Ga0466692_144683 | 3300042591 | Bacteria | 28602 |
| 20 | Ga0466691_003678 | 3300042593 | Bacteria | 14150 |
| 21 | Ga0466735_178317 | 3300042624 | Bacteria | 1043 |
| 22 | Ga0466708_012925 | 3300042652 | Bacteria | 7826 |
| 23 | Ga0466706_128949 | 3300042599 | Bacteria | 3593 |
| 24 | Ga0466707_335285 | 3300042601 | Bacteria | 3641 |
| 25 | Ga0466716_483438 | 3300042605 | Bacteria | 16673 |
| 26 | Ga0466719_183617 | 3300042606 | Bacteria | 2905 |
| 27 | IMNBL1DRAFT_c0022789 | 3300000062 | Bacteria | 2469 |
| 28 | Ga0072941_1283555 | 3300005201 | Bacteria | 3614 |
| 29 | Ga0104048_1028562 | 3300007143 | Unclassified | 2985 |
| 30 | Ga0104019_1005093 | 3300007150 | Unclassified | 3724 |
| 31 | Ga0466697_168738 | 3300042611 | Unclassified | 1403 |
| 32 | Ga0466715_206964 | 3300042616 | Bacteria | 26549 |
| 33 | Ga0466726_064923 | 3300042619 | Bacteria | 35500 |
| 34 | Ga0160469_100054 | 3300012824 | Bacteria | 198457 |
| 35 | Ga0466692_159524 | 3300042591 | Bacteria | 46807 |
| 36 | Ga0466691_021672 | 3300042593 | Bacteria | 7154 |
| 37 | Ga0466699_295359 | 3300042597 | Bacteria | 1118 |
| 38 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 39 | Ga0466704_266068 | 3300042643 | Bacteria | 12383 |
| 40 | Ga0466700_256244 | 3300042600 | Bacteria | 8881 |
| 41 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 42 | Ga0072941_1232178 | 3300005201 | Bacteria | 1332 |
| 43 | Ga0102740_1000340 | 3300007140 | Bacteria | 13154 |
| 44 | Ga0123356_10196126 | 3300010049 | Bacteria | 2055 |
| 45 | Ga0123353_11111197 | 3300010167 | Bacteria | 1048 |
| 46 | Ga0466711_088926 | 3300042615 | Bacteria | 1129 |
| 47 | Ga0466718_002000 | 3300042617 | Bacteria | 1353 |
| 48 | Ga0466723_348988 | 3300042618 | Bacteria | 4071 |
| 49 | Ga0466692_185674 | 3300042591 | Bacteria | 4041 |
| 50 | Ga0466691_227279 | 3300042593 | Bacteria | 59500 |
| 51 | Ga0466696_236491 | 3300042596 | Bacteria | 25393 |
| 52 | Ga0466703_072637 | 3300042636 | Bacteria | 5578 |
| 53 | Ga0466709_121396 | 3300042648 | Bacteria | 3542 |
| 54 | Ga0466727_223128 | 3300042655 | Bacteria | 2314 |
| 55 | JGI24702J35022_10004653 | 3300002462 | Bacteria | 8123 |
| 56 | JGI24696J40584_12958524 | 3300002834 | Bacteria | 4212 |
| 57 | Ga0466732_403422 | 3300042656 | Bacteria | 3187 |
| 58 | Ga0466710_156018 | 3300042613 | Bacteria | 1154 |
| 59 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 60 | Ga0466726_284357 | 3300042619 | Bacteria | 4714 |
| 61 | Ga0466728_085697 | 3300042620 | Bacteria | 5860 |
| 62 | Ga0160432_100014 | 3300012818 | Bacteria | 330009 |
| 63 | Ga0466694_047356 | 3300042594 | Bacteria | 1628 |
| 64 | Ga0466703_200506 | 3300042636 | Bacteria | 3211 |
| 65 | Ga0466703_398293 | 3300042636 | Bacteria | 4367 |
| 66 | Ga0466709_060190 | 3300042648 | Bacteria | 23292 |
| 67 | Ga0466701_038225 | 3300042598 | Bacteria | 12164 |
| 68 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 69 | JGI24699J35502_11131743 | 3300002509 | Bacteria | 5983 |
| 70 | Ga0104043_1000559 | 3300007058 | Bacteria | 2646 |
| 71 | Ga0104045_1006380 | 3300007085 | Bacteria | 2020 |
| 72 | Ga0466705_097898 | 3300042612 | Bacteria | 6160 |
| 73 | Ga0123356_10042349 | 3300010049 | Bacteria | 4242 |
| 74 | Ga0123356_10062394 | 3300010049 | Bacteria | 3482 |
| 75 | Ga0123356_10511125 | 3300010049 | Bacteria | 1358 |
| 76 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 77 | Ga0466715_004946 | 3300042616 | Bacteria | 3473 |
| 78 | Ga0466715_266187 | 3300042616 | Bacteria | 25878 |
| 79 | Ga0466715_275548 | 3300042616 | Bacteria | 29682 |
| 80 | Ga0466728_190285 | 3300042620 | Bacteria | 2825 |
| 81 | Ga0466690_285786 | 3300042590 | Bacteria | 5108 |
| 82 | Ga0466691_049120 | 3300042593 | Bacteria | 1443 |
| 83 | Ga0466695_098130 | 3300042595 | Bacteria | 2069 |
| 84 | Ga0466699_171935 | 3300042597 | Bacteria | 1504 |
| 85 | Ga0466730_009837 | 3300042625 | Bacteria | 325641 |
| 86 | Ga0466704_195001 | 3300042643 | Bacteria | 4536 |
| 87 | Ga0466708_246063 | 3300042652 | Bacteria | 25365 |
| 88 | Ga0466727_247918 | 3300042655 | Bacteria | 10698 |
| 89 | Ga0466700_128887 | 3300042600 | Bacteria | 1758 |
| 90 | Ga0466719_025390 | 3300042606 | Bacteria | 13141 |
| 91 | Ga0466719_218070 | 3300042606 | Bacteria | 19356 |
| 92 | JGI24702J35022_10002287 | 3300002462 | Bacteria | 11755 |
| 93 | Ga0104045_1006984 | 3300007085 | Bacteria | 4943 |
| 94 | Ga0104045_1018397 | 3300007085 | Unclassified | 3655 |
| 95 | Ga0123353_10768464 | 3300010167 | Bacteria | 1337 |
| 96 | Ga0123353_11326599 | 3300010167 | Bacteria | 932 |
| 97 | Ga0466710_099184 | 3300042613 | Bacteria | 2632 |
| 98 | Ga0466711_306949 | 3300042615 | Bacteria | 7933 |
| 99 | Ga0466715_485900 | 3300042616 | Bacteria | 1894 |
| 100 | Ga0466728_160501 | 3300042620 | Bacteria | 4129 |
| 101 | Ga0466728_183323 | 3300042620 | Bacteria | 3927 |
| 102 | Ga0466690_037685 | 3300042590 | Bacteria | 26615 |
| 103 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 104 | Ga0466691_212240 | 3300042593 | Bacteria | 8980 |
| 105 | Ga0466696_388615 | 3300042596 | Bacteria | 11058 |
| 106 | Ga0466701_009234 | 3300042598 | Bacteria | 3233 |
| 107 | Ga0466727_016158 | 3300042655 | Bacteria | 3925 |
| 108 | Ga0466713_026981 | 3300042602 | Bacteria | 6138 |
| 109 | Ga0466716_011029 | 3300042605 | Bacteria | 3761 |
| 110 | Ga0466719_385682 | 3300042606 | Bacteria | 3334 |
| 111 | IMNBL1DRAFT_c0004898 | 3300000062 | Bacteria | 7855 |
| 112 | JGI24702J35022_10004749 | 3300002462 | Bacteria | 8038 |
| 113 | Ga0104019_1193736 | 3300007150 | Bacteria | 1410 |
| 114 | Ga0466697_159159 | 3300042611 | Bacteria | 1046 |
| 115 | Ga0123356_10358657 | 3300010049 | Bacteria | 1584 |
| 116 | Ga0160466_100006 | 3300012809 | Bacteria | 498369 |
| 117 | Ga0466729_117874 | 3300042621 | Bacteria | 2916 |
| 118 | Ga0466696_057464 | 3300042596 | Bacteria | 6383 |
| 119 | Ga0466735_006238 | 3300042624 | Bacteria | 1563 |
| 120 | Ga0466735_028127 | 3300042624 | Bacteria | 2418 |
| 121 | Ga0466735_171724 | 3300042624 | Bacteria | 1341 |
| 122 | Ga0466735_190274 | 3300042624 | Bacteria | 11739 |
| 123 | Ga0466735_228652 | 3300042624 | Bacteria | 1197 |
| 124 | Ga0466730_098534 | 3300042625 | Bacteria | 2323 |
| 125 | Ga0466703_184001 | 3300042636 | Bacteria | 6232 |
| 126 | Ga0466717_257765 | 3300042604 | Bacteria | 1519 |
| 127 | Ga0466716_421670 | 3300042605 | Bacteria | 3858 |
| 128 | Ga0466719_554685 | 3300042606 | Bacteria | 12056 |
| 129 | Ga0466722_088416 | 3300042609 | Bacteria | 9449 |
| 130 | CVPL010W_10000676 | 3300002931 | Bacteria | 64066 |
| 131 | Ga0102735_1006385 | 3300007080 | Bacteria | 1497 |
| 132 | Ga0102734_1000653 | 3300007129 | Bacteria | 9616 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042605 | Ga0466716_483438 | Ga0466716_483438_14988_15620 | 177 |
| 2 | 3300007143 | Ga0104048_1028562 | Ga0104048_10285624 | 181 |
| 3 | 3300042612 | Ga0466705_038128 | Ga0466705_038128_28984_29616 | 183 |
| 4 | 3300042648 | Ga0466709_060190 | Ga0466709_060190_8813_9445 | 189 |
| 5 | 3300042596 | Ga0466696_236491 | Ga0466696_236491_15532_16164 | 191 |
| 6 | 3300042620 | Ga0466728_183323 | Ga0466728_183323_2127_2759 | 193 |
| 7 | 3300007085 | Ga0104045_1006984 | Ga0104045_10069842 | 194 |
| 8 | 3300042636 | Ga0466703_184001 | Ga0466703_184001_3351_3983 | 195 |
| 9 | 3300042600 | Ga0466700_021305 | Ga0466700_021305_10698_11318 | 197 |
| 10 | 3300042606 | Ga0466719_218070 | Ga0466719_218070_4909_5541 | 198 |
| 11 | 3300042616 | Ga0466715_275548 | Ga0466715_275548_6239_6871 | 198 |
| 12 | 3300042624 | Ga0466735_171724 | Ga0466735_171724_56_676 | 198 |
| 13 | 3300007150 | Ga0104019_1005093 | Ga0104019_10050933 | 204 |
| 14 | 3300005201 | Ga0072941_1232178 | Ga0072941_12321781 | 205 |
| 15 | 3300042590 | Ga0466690_373916 | Ga0466690_373916_7429_8046 | 205 |
| 16 | 3300042591 | Ga0466692_159524 | Ga0466692_159524_21107_21724 | 205 |
| 17 | 3300042594 | Ga0466694_047356 | Ga0466694_047356_150_767 | 205 |
| 18 | 3300042595 | Ga0466695_098130 | Ga0466695_098130_493_1110 | 205 |
| 19 | 3300042597 | Ga0466699_295359 | Ga0466699_295359_457_1074 | 205 |
| 20 | 3300042599 | Ga0466706_128949 | Ga0466706_128949_275_892 | 205 |
| 21 | 3300042604 | Ga0466717_257765 | Ga0466717_257765_363_980 | 205 |
| 22 | 3300042605 | Ga0466716_421670 | Ga0466716_421670_10_627 | 205 |
| 23 | 3300042606 | Ga0466719_183617 | Ga0466719_183617_2002_2619 | 205 |
| 24 | 3300042612 | Ga0466705_097898 | Ga0466705_097898_2898_3515 | 205 |
| 25 | 3300042616 | Ga0466715_266187 | Ga0466715_266187_997_1614 | 205 |
| 26 | 3300042616 | Ga0466715_485900 | Ga0466715_485900_693_1310 | 205 |
| 27 | 3300042625 | Ga0466730_098534 | Ga0466730_098534_384_1001 | 205 |
| 28 | 3300042636 | Ga0466703_398293 | Ga0466703_398293_2434_3051 | 205 |
| 29 | 3300042643 | Ga0466704_266068 | Ga0466704_266068_7786_8403 | 205 |
| 30 | 3300042656 | Ga0466732_073791 | Ga0466732_073791_954_1571 | 205 |
| 31 | 3300042659 | Ga0466733_010540 | Ga0466733_010540_920_1537 | 205 |
| 32 | 3300002834 | JGI24696J40584_12958524 | JGI24696J40584_129585247 | 206 |
| 33 | 3300042590 | Ga0466690_168212 | Ga0466690_168212_8335_8955 | 206 |
| 34 | 3300042590 | Ga0466690_287618 | Ga0466690_287618_7452_8072 | 206 |
| 35 | 3300042591 | Ga0466692_144683 | Ga0466692_144683_19982_20602 | 206 |
| 36 | 3300042591 | Ga0466692_185674 | Ga0466692_185674_1407_2027 | 206 |
| 37 | 3300042592 | Ga0466693_402862 | Ga0466693_402862_44_664 | 206 |
| 38 | 3300042593 | Ga0466691_003678 | Ga0466691_003678_12290_12910 | 206 |
| 39 | 3300042593 | Ga0466691_212240 | Ga0466691_212240_5249_5869 | 206 |
| 40 | 3300042596 | Ga0466696_057464 | Ga0466696_057464_2888_3508 | 206 |
| 41 | 3300042598 | Ga0466701_038225 | Ga0466701_038225_7276_7896 | 206 |
| 42 | 3300042600 | Ga0466700_128887 | Ga0466700_128887_978_1598 | 206 |
| 43 | 3300042600 | Ga0466700_256244 | Ga0466700_256244_2778_3398 | 206 |
| 44 | 3300042601 | Ga0466707_335285 | Ga0466707_335285_110_730 | 206 |
| 45 | 3300042601 | Ga0466707_417447 | Ga0466707_417447_168_788 | 206 |
| 46 | 3300042602 | Ga0466713_026981 | Ga0466713_026981_4038_4658 | 206 |
| 47 | 3300042606 | Ga0466719_025390 | Ga0466719_025390_4814_5434 | 206 |
| 48 | 3300042606 | Ga0466719_385682 | Ga0466719_385682_772_1392 | 206 |
| 49 | 3300042606 | Ga0466719_554685 | Ga0466719_554685_6584_7204 | 206 |
| 50 | 3300042609 | Ga0466722_043304 | Ga0466722_043304_2839_3459 | 206 |
| 51 | 3300042609 | Ga0466722_088416 | Ga0466722_088416_6835_7455 | 206 |
| 52 | 3300042613 | Ga0466710_099184 | Ga0466710_099184_1897_2517 | 206 |
| 53 | 3300042613 | Ga0466710_156018 | Ga0466710_156018_260_880 | 206 |
| 54 | 3300042615 | Ga0466711_088926 | Ga0466711_088926_441_1061 | 206 |
| 55 | 3300042615 | Ga0466711_306949 | Ga0466711_306949_6714_7334 | 206 |
| 56 | 3300042616 | Ga0466715_060059 | Ga0466715_060059_5398_6018 | 206 |
| 57 | 3300042616 | Ga0466715_206964 | Ga0466715_206964_2447_3067 | 206 |
| 58 | 3300042618 | Ga0466723_348988 | Ga0466723_348988_2170_2790 | 206 |
| 59 | 3300042619 | Ga0466726_024142 | Ga0466726_024142_3255_3875 | 206 |
| 60 | 3300042619 | Ga0466726_064923 | Ga0466726_064923_974_1594 | 206 |
| 61 | 3300042620 | Ga0466728_085697 | Ga0466728_085697_4807_5427 | 206 |
| 62 | 3300042624 | Ga0466735_028127 | Ga0466735_028127_1670_2290 | 206 |
| 63 | 3300042624 | Ga0466735_178317 | Ga0466735_178317_85_705 | 206 |
| 64 | 3300042636 | Ga0466703_200506 | Ga0466703_200506_1723_2343 | 206 |
| 65 | 3300042636 | Ga0466703_348714 | Ga0466703_348714_8266_8886 | 206 |
| 66 | 3300042655 | Ga0466727_016158 | Ga0466727_016158_882_1502 | 206 |
| 67 | 3300042655 | Ga0466727_223128 | Ga0466727_223128_1257_1877 | 206 |
| 68 | 3300042655 | Ga0466727_247918 | Ga0466727_247918_2038_2658 | 206 |
| 69 | iso_pr_bacteria | 2820759988 | 2820760197 | 206 |
| 70 | iso_pr_bacteria | 2940216256 | 2940217616 | 206 |
| 71 | 3300000062 | IMNBL1DRAFT_c0000119 | IMNBL1DRAFT_000011910 | 207 |
| 72 | 3300000062 | IMNBL1DRAFT_c0004898 | IMNBL1DRAFT_00048985 | 207 |
| 73 | 3300000062 | IMNBL1DRAFT_c0022789 | IMNBL1DRAFT_00227893 | 207 |
| 74 | 3300002462 | JGI24702J35022_10004653 | JGI24702J35022_100046536 | 207 |
| 75 | 3300002462 | JGI24702J35022_10004749 | JGI24702J35022_100047497 | 207 |
| 76 | 3300002509 | JGI24699J35502_11131743 | JGI24699J35502_111317436 | 207 |
| 77 | 3300005083 | Ga0068305_10166497 | Ga0068305_101664975 | 207 |
| 78 | 3300010049 | Ga0123356_10196126 | Ga0123356_101961262 | 207 |
| 79 | 3300010049 | Ga0123356_10358657 | Ga0123356_103586572 | 207 |
| 80 | 3300010049 | Ga0123356_10511125 | Ga0123356_105111252 | 207 |
| 81 | 3300010167 | Ga0123353_10768464 | Ga0123353_107684642 | 207 |
| 82 | 3300010167 | Ga0123353_11111197 | Ga0123353_111111972 | 207 |
| 83 | 3300010167 | Ga0123353_11326599 | Ga0123353_113265992 | 207 |
| 84 | 3300010882 | Ga0123354_10000498 | Ga0123354_100004987 | 207 |
| 85 | 3300042616 | Ga0466715_016723 | Ga0466715_016723_6481_7104 | 207 |
| 86 | 3300010049 | Ga0123356_10042349 | Ga0123356_100423497 | 209 |
| 87 | 3300042621 | Ga0466729_117874 | Ga0466729_117874_1710_2339 | 209 |
| 88 | 3300042625 | Ga0466730_009837 | Ga0466730_009837_320259_320888 | 209 |
| 89 | iso_pr_bacteria | 2579779088 | 2582239280 | 209 |
| 90 | iso_pr_bacteria | 2896321640 | 2896323947 | 209 |
| 91 | iso_pr_bacteria | 2896330536 | 2896332516 | 209 |
| 92 | iso_pr_bacteria | 2896350215 | 2896352328 | 209 |
| 93 | iso_pr_bacteria | 2898741527 | 2898744270 | 209 |
| 94 | 3300002931 | CVPL010W_10000676 | CVPL010W_1000067615 | 210 |
| 95 | 3300005083 | Ga0068305_10026156 | Ga0068305_100261565 | 210 |
| 96 | 3300007042 | Ga0103263_102158 | Ga0103263_1021582 | 210 |
| 97 | 3300007058 | Ga0104043_1000559 | Ga0104043_10005593 | 210 |
| 98 | 3300007080 | Ga0102735_1006385 | Ga0102735_10063853 | 210 |
| 99 | 3300007085 | Ga0104045_1006380 | Ga0104045_10063802 | 210 |
| 100 | 3300007085 | Ga0104045_1018397 | Ga0104045_10183973 | 210 |
| 101 | 3300007129 | Ga0102734_1000653 | Ga0102734_10006533 | 210 |
| 102 | 3300007140 | Ga0102740_1000340 | Ga0102740_100034022 | 210 |
| 103 | 3300007150 | Ga0104019_1193736 | Ga0104019_11937362 | 210 |
| 104 | 3300010049 | Ga0123356_10062394 | Ga0123356_100623946 | 210 |
| 105 | 3300012809 | Ga0160466_100006 | Ga0160466_100006349 | 210 |
| 106 | 3300012818 | Ga0160432_100014 | Ga0160432_100014176 | 210 |
| 107 | 3300042590 | Ga0466690_037685 | Ga0466690_037685_15469_16101 | 210 |
| 108 | 3300042611 | Ga0466697_168738 | Ga0466697_168738_508_1140 | 210 |
| 109 | 3300042590 | Ga0466690_095939 | Ga0466690_095939_2640_3275 | 211 |
| 110 | 3300042593 | Ga0466691_049120 | Ga0466691_049120_511_1146 | 211 |
| 111 | 3300042593 | Ga0466691_227279 | Ga0466691_227279_11427_12062 | 211 |
| 112 | 3300042597 | Ga0466699_171935 | Ga0466699_171935_645_1280 | 211 |
| 113 | 3300042598 | Ga0466701_009234 | Ga0466701_009234_161_796 | 211 |
| 114 | 3300042611 | Ga0466697_159159 | Ga0466697_159159_54_689 | 211 |
| 115 | 3300042614 | Ga0466712_044382 | Ga0466712_044382_206_841 | 211 |
| 116 | 3300042617 | Ga0466718_002000 | Ga0466718_002000_74_709 | 211 |
| 117 | 3300042618 | Ga0466723_215575 | Ga0466723_215575_9772_10407 | 211 |
| 118 | 3300042636 | Ga0466703_072637 | Ga0466703_072637_4590_5225 | 211 |
| 119 | 3300042643 | Ga0466704_195001 | Ga0466704_195001_3126_3761 | 211 |
| 120 | 3300042648 | Ga0466709_121396 | Ga0466709_121396_2165_2800 | 211 |
| 121 | 3300042656 | Ga0466732_403422 | Ga0466732_403422_1742_2377 | 211 |
| 122 | iso_pr_bacteria | 2820740053 | 2820741688 | 211 |
| 123 | 3300002462 | JGI24702J35022_10002287 | JGI24702J35022_1000228713 | 212 |
| 124 | 3300005201 | Ga0072941_1283555 | Ga0072941_12835552 | 212 |
| 125 | 3300010049 | Ga0123356_10038853 | Ga0123356_100388533 | 212 |
| 126 | 3300042590 | Ga0466690_285786 | Ga0466690_285786_1420_2058 | 212 |
| 127 | 3300042596 | Ga0466696_388615 | Ga0466696_388615_4639_5277 | 212 |
| 128 | 3300042619 | Ga0466726_284357 | Ga0466726_284357_2640_3278 | 212 |
| 129 | 3300042655 | Ga0466727_316709 | Ga0466727_316709_4511_5149 | 212 |
| 130 | 3300042624 | Ga0466735_006238 | Ga0466735_006238_708_1349 | 213 |
| 131 | 3300042593 | Ga0466691_021672 | Ga0466691_021672_3969_4613 | 214 |
| 132 | 3300042605 | Ga0466716_011029 | Ga0466716_011029_536_1180 | 214 |
| 133 | 3300042616 | Ga0466715_004946 | Ga0466715_004946_2271_2915 | 214 |
| 134 | 3300042620 | Ga0466728_160501 | Ga0466728_160501_2361_3005 | 214 |
| 135 | 3300042620 | Ga0466728_190285 | Ga0466728_190285_1609_2253 | 214 |
| 136 | 3300042624 | Ga0466735_228652 | Ga0466735_228652_207_851 | 214 |
| 137 | 3300042652 | Ga0466708_012925 | Ga0466708_012925_743_1387 | 214 |
| 138 | 3300012824 | Ga0160469_100054 | Ga0160469_10005421 | 215 |
| 139 | 3300042624 | Ga0466735_190274 | Ga0466735_190274_5883_6533 | 216 |
| 140 | 3300042652 | Ga0466708_246063 | Ga0466708_246063_10426_11076 | 216 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00573 | Ribosomal_L4 | Ribosomal protein L4/L1 family | 18 | 206 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.72 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.