Protein Family IF08827
Metagenome
Isolate
151
Members
61
Samples
147
Scaffolds
193.6
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_168555|Ga0466735_168555_41_745
- Length
- 234 aa
- Sequence
- VIVPCRECIQTHARKIKHLSDSSPQESAEVKFETRLSPVAGTEESCDIILAGVGGQGILSIAAVIGEAALEDGLFMKQSEVHGMSQRGGDVQSHLRISSKPVASDLIPLGSADIIISLEPMEALRYLQYLKKDGWIVTNSKPFENIPNYPEIEKIMVEYDNLSNKLVLNVEEIAKDLGAPRSGNVVLLGAASPHIGIDFSKLENGIRRIFGRKGDAVVETNLNALRAGKTVAEK
Sample Types
Isolate
2.6%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
23.3%
Unclassified
10.0%
Termopsidae
6.7%
Rhinotermitidae
5.0%
Passalidae
3.3%
Blattidae
1.7%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 2 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 3 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 43 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 54 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 57 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 58 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 59 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 60 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 61 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_193873 | 3300042659 | Bacteria | 3569 |
| 2 | Ga0466710_411020 | 3300042613 | Bacteria | 1826 |
| 3 | Ga0466715_089318 | 3300042616 | Bacteria | 11673 |
| 4 | Ga0123354_10000296 | 3300010882 | Bacteria | 45682 |
| 5 | Ga0123354_10059022 | 3300010882 | Bacteria | 5693 |
| 6 | Ga0264413_115023 | 3300024493 | Bacteria | 4442 |
| 7 | Ga0466694_228170 | 3300042594 | Bacteria | 1668 |
| 8 | Ga0466697_248379 | 3300042611 | Bacteria | 1370 |
| 9 | Ga0466733_097127 | 3300042659 | Bacteria | 2156 |
| 10 | Ga0466715_086618 | 3300042616 | Bacteria | 7495 |
| 11 | Ga0466715_332133 | 3300042616 | Bacteria | 83480 |
| 12 | Ga0466723_155547 | 3300042618 | Bacteria | 2398 |
| 13 | Ga0466728_253007 | 3300042620 | Bacteria | 5307 |
| 14 | Ga0466713_073291 | 3300042602 | Bacteria | 42324 |
| 15 | Ga0123357_10043436 | 3300009784 | Bacteria | 6109 |
| 16 | Ga0123357_10218852 | 3300009784 | Bacteria | 2118 |
| 17 | Ga0123356_10498496 | 3300010049 | Bacteria | 1373 |
| 18 | Ga0123354_10003728 | 3300010882 | Bacteria | 21207 |
| 19 | Ga0466692_202586 | 3300042591 | Unclassified | 1108 |
| 20 | Ga0466696_198319 | 3300042596 | Bacteria | 3206 |
| 21 | Ga0466729_228955 | 3300042621 | Bacteria | 3111 |
| 22 | Ga0466734_086501 | 3300042623 | Bacteria | 1761 |
| 23 | Ga0466735_003846 | 3300042624 | Bacteria | 3822 |
| 24 | Ga0466735_228626 | 3300042624 | Bacteria | 1393 |
| 25 | Ga0466703_146869 | 3300042636 | Bacteria | 11356 |
| 26 | Ga0466709_393588 | 3300042648 | Bacteria | 46239 |
| 27 | Ga0466727_033824 | 3300042655 | Bacteria | 1901 |
| 28 | IMNBL1DRAFT_c0002509 | 3300000062 | Bacteria | 12722 |
| 29 | IMNBL1DRAFT_c0010865 | 3300000062 | Bacteria | 4307 |
| 30 | JGI24702J35022_10017113 | 3300002462 | Bacteria | 3966 |
| 31 | JGI24699J35502_11134168 | 3300002509 | Bacteria | 43545 |
| 32 | Ga0068302_10673596 | 3300005071 | Unclassified | 697 |
| 33 | Ga0068305_11070244 | 3300005083 | Bacteria | 2780 |
| 34 | Ga0123357_10003270 | 3300009784 | Bacteria | 18489 |
| 35 | Ga0466697_204946 | 3300042611 | Bacteria | 1178 |
| 36 | Ga0466715_033953 | 3300042616 | Bacteria | 34236 |
| 37 | Ga0466700_003037 | 3300042600 | Bacteria | 30141 |
| 38 | Ga0466700_033238 | 3300042600 | Bacteria | 8542 |
| 39 | Ga0466707_060703 | 3300042601 | Bacteria | 27082 |
| 40 | Ga0466714_020399 | 3300042603 | Bacteria | 1735 |
| 41 | Ga0466720_109557 | 3300042607 | Bacteria | 15930 |
| 42 | Ga0123357_10074032 | 3300009784 | Bacteria | 4507 |
| 43 | Ga0123355_10000037 | 3300009826 | Bacteria | 130470 |
| 44 | Ga0123356_10007741 | 3300010049 | Bacteria | 10699 |
| 45 | Ga0123354_10016842 | 3300010882 | Bacteria | 11447 |
| 46 | Ga0466704_328936 | 3300042643 | Bacteria | 9826 |
| 47 | Ga0466709_008379 | 3300042648 | Bacteria | 52460 |
| 48 | Ga0466708_086861 | 3300042652 | Bacteria | 7567 |
| 49 | 2227536057 | 2225789004 | Unclassified | 3067 |
| 50 | Ga0068302_10110626 | 3300005071 | Unclassified | 4102 |
| 51 | Ga0123357_10002727 | 3300009784 | Bacteria | 19892 |
| 52 | Ga0466705_062364 | 3300042612 | Bacteria | 2046 |
| 53 | Ga0466711_152562 | 3300042615 | Bacteria | 15259 |
| 54 | Ga0466711_502078 | 3300042615 | Bacteria | 4007 |
| 55 | Ga0466726_150075 | 3300042619 | Bacteria | 7663 |
| 56 | Ga0466716_038569 | 3300042605 | Bacteria | 11326 |
| 57 | Ga0466719_322312 | 3300042606 | Bacteria | 2790 |
| 58 | Ga0466719_488098 | 3300042606 | Bacteria | 1177 |
| 59 | Ga0264413_110474 | 3300024493 | Bacteria | 19165 |
| 60 | Ga0466656_374057 | 3300042550 | Bacteria | 1070 |
| 61 | Ga0466690_068446 | 3300042590 | Bacteria | 5232 |
| 62 | Ga0466692_113028 | 3300042591 | Bacteria | 49094 |
| 63 | Ga0466692_171946 | 3300042591 | Bacteria | 2272 |
| 64 | Ga0466696_197960 | 3300042596 | Bacteria | 3779 |
| 65 | Ga0466735_119304 | 3300042624 | Bacteria | 4126 |
| 66 | 2227488518 | 2225789004 | Bacteria | 21013 |
| 67 | IMNBL1DRAFT_c0020316 | 3300000062 | Bacteria | 2693 |
| 68 | AustNasuHG_c1045121 | 3300000089 | Bacteria | 1012 |
| 69 | JGI24695J34938_10091250 | 3300002450 | Bacteria | 1249 |
| 70 | JGI24702J35022_10016038 | 3300002462 | Bacteria | 4113 |
| 71 | JGI24705J35276_12235768 | 3300002504 | Bacteria | 6959 |
| 72 | Ga0466711_410951 | 3300042615 | Bacteria | 1287 |
| 73 | Ga0466726_131705 | 3300042619 | Bacteria | 3953 |
| 74 | Ga0466728_094263 | 3300042620 | Bacteria | 2805 |
| 75 | Ga0466713_049834 | 3300042602 | Bacteria | 2548 |
| 76 | Ga0466713_130167 | 3300042602 | Bacteria | 5106 |
| 77 | Ga0466714_088229 | 3300042603 | Bacteria | 1838 |
| 78 | Ga0466717_088313 | 3300042604 | Bacteria | 4649 |
| 79 | Ga0466716_249398 | 3300042605 | Bacteria | 5920 |
| 80 | Ga0466698_365287 | 3300042610 | Bacteria | 4851 |
| 81 | Ga0123357_10058048 | 3300009784 | Bacteria | 5198 |
| 82 | Ga0123357_10077467 | 3300009784 | Bacteria | 4385 |
| 83 | Ga0123356_10110304 | 3300010049 | Unclassified | 2657 |
| 84 | Ga0123354_10024763 | 3300010882 | Bacteria | 9469 |
| 85 | Ga0123354_10172587 | 3300010882 | Bacteria | 2508 |
| 86 | Ga0466691_176345 | 3300042593 | Bacteria | 5224 |
| 87 | Ga0466729_208291 | 3300042621 | Bacteria | 9574 |
| 88 | Ga0466704_389641 | 3300042643 | Bacteria | 3625 |
| 89 | Ga0466727_127832 | 3300042655 | Bacteria | 43534 |
| 90 | JGI24702J35022_10080557 | 3300002462 | Bacteria | 1763 |
| 91 | JGI24696J40584_12749414 | 3300002834 | Unclassified | 792 |
| 92 | Ga0123357_10000769 | 3300009784 | Bacteria | 32386 |
| 93 | Ga0466705_204211 | 3300042612 | Bacteria | 2715 |
| 94 | Ga0466732_149862 | 3300042656 | Bacteria | 25512 |
| 95 | Ga0466723_122680 | 3300042618 | Bacteria | 21397 |
| 96 | Ga0466701_079898 | 3300042598 | Bacteria | 6285 |
| 97 | Ga0466719_113182 | 3300042606 | Bacteria | 8914 |
| 98 | Ga0466720_209892 | 3300042607 | Bacteria | 6078 |
| 99 | Ga0123357_10236048 | 3300009784 | Bacteria | 1992 |
| 100 | Ga0466657_349492 | 3300042582 | Bacteria | 3423 |
| 101 | Ga0466693_356542 | 3300042592 | Bacteria | 1573 |
| 102 | Ga0466693_381128 | 3300042592 | Bacteria | 1187 |
| 103 | Ga0466696_112045 | 3300042596 | Bacteria | 5023 |
| 104 | Ga0466696_460984 | 3300042596 | Bacteria | 5098 |
| 105 | Ga0466703_014537 | 3300042636 | Bacteria | 2729 |
| 106 | JGI24705J35276_12208430 | 3300002504 | Bacteria | 1772 |
| 107 | Ga0466723_009860 | 3300042618 | Bacteria | 2244 |
| 108 | Ga0466723_207564 | 3300042618 | Bacteria | 5580 |
| 109 | Ga0466729_010637 | 3300042621 | Bacteria | 8747 |
| 110 | Ga0466722_178165 | 3300042609 | Bacteria | 29947 |
| 111 | Ga0466698_289511 | 3300042610 | Bacteria | 1664 |
| 112 | Ga0123354_10059564 | 3300010882 | Bacteria | 5660 |
| 113 | Ga0466656_300123 | 3300042550 | Bacteria | 1145 |
| 114 | Ga0466692_083917 | 3300042591 | Bacteria | 16599 |
| 115 | Ga0466734_052911 | 3300042623 | Bacteria | 1519 |
| 116 | Ga0466735_168555 | 3300042624 | Bacteria | 4975 |
| 117 | Ga0466703_060139 | 3300042636 | Bacteria | 10724 |
| 118 | Ga0466727_101467 | 3300042655 | Bacteria | 2977 |
| 119 | IMNBL1DRAFT_c0003796 | 3300000062 | Bacteria | 9431 |
| 120 | JGI24699J35502_11134179 | 3300002509 | Bacteria | 45584 |
| 121 | Ga0068305_10171204 | 3300005083 | Unclassified | 1252 |
| 122 | Ga0123357_10000560 | 3300009784 | Bacteria | 36706 |
| 123 | Ga0466705_003681 | 3300042612 | Unclassified | 1353 |
| 124 | Ga0466705_105175 | 3300042612 | Bacteria | 17219 |
| 125 | Ga0466718_108092 | 3300042617 | Bacteria | 5741 |
| 126 | Ga0466723_277709 | 3300042618 | Bacteria | 6875 |
| 127 | Ga0466726_347391 | 3300042619 | Bacteria | 9460 |
| 128 | Ga0466700_216232 | 3300042600 | Bacteria | 10595 |
| 129 | Ga0466700_270932 | 3300042600 | Bacteria | 5696 |
| 130 | Ga0466720_196511 | 3300042607 | Unclassified | 6231 |
| 131 | Ga0466722_099494 | 3300042609 | Bacteria | 2099 |
| 132 | Ga0123357_10328888 | 3300009784 | Bacteria | 1497 |
| 133 | Ga0123357_10401825 | 3300009784 | Unclassified | 1245 |
| 134 | Ga0123353_10080877 | 3300010167 | Bacteria | 5224 |
| 135 | Ga0123353_10677396 | 3300010167 | Bacteria | 1453 |
| 136 | Ga0466692_034067 | 3300042591 | Bacteria | 24284 |
| 137 | Ga0466692_079338 | 3300042591 | Bacteria | 6676 |
| 138 | Ga0466695_230880 | 3300042595 | Bacteria | 1466 |
| 139 | Ga0466702_017493 | 3300042635 | Bacteria | 1398 |
| 140 | Ga0466703_355603 | 3300042636 | Bacteria | 2866 |
| 141 | Ga0466703_396789 | 3300042636 | Bacteria | 7232 |
| 142 | Ga0466708_439514 | 3300042652 | Bacteria | 9450 |
| 143 | Ga0466727_302475 | 3300042655 | Bacteria | 3306 |
| 144 | JGI24702J35022_10028547 | 3300002462 | Bacteria | 2997 |
| 145 | JGI24699J35502_11134038 | 3300002509 | Bacteria | 26004 |
| 146 | Ga0068302_10086160 | 3300005071 | Bacteria | 1671 |
| 147 | Ga0072940_1009297 | 3300005200 | Bacteria | 10038 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010882 | Ga0123354_10003728 | Ga0123354_100037283 | 188 |
| 2 | 3300042591 | Ga0466692_034067 | Ga0466692_034067_2614_3180 | 188 |
| 3 | 3300042596 | Ga0466696_112045 | Ga0466696_112045_3813_4379 | 188 |
| 4 | 3300042600 | Ga0466700_216232 | Ga0466700_216232_2740_3306 | 188 |
| 5 | 3300042602 | Ga0466713_130167 | Ga0466713_130167_447_1013 | 188 |
| 6 | 3300042616 | Ga0466715_089318 | Ga0466715_089318_6644_7210 | 188 |
| 7 | 3300042623 | Ga0466734_086501 | Ga0466734_086501_331_897 | 188 |
| 8 | 3300009784 | Ga0123357_10328888 | Ga0123357_103288882 | 189 |
| 9 | 3300009784 | Ga0123357_10401825 | Ga0123357_104018252 | 189 |
| 10 | 3300010882 | Ga0123354_10024763 | Ga0123354_100247632 | 189 |
| 11 | 3300042582 | Ga0466657_349492 | Ga0466657_349492_1361_1930 | 189 |
| 12 | 3300042591 | Ga0466692_171946 | Ga0466692_171946_1447_2016 | 189 |
| 13 | 3300042592 | Ga0466693_381128 | Ga0466693_381128_560_1129 | 189 |
| 14 | 3300042600 | Ga0466700_003037 | Ga0466700_003037_11282_11851 | 189 |
| 15 | 3300042602 | Ga0466713_073291 | Ga0466713_073291_39020_39589 | 189 |
| 16 | 3300042606 | Ga0466719_322312 | Ga0466719_322312_2134_2703 | 189 |
| 17 | 3300042611 | Ga0466697_248379 | Ga0466697_248379_780_1349 | 189 |
| 18 | 3300042616 | Ga0466715_086618 | Ga0466715_086618_5229_5798 | 189 |
| 19 | 3300042619 | Ga0466726_150075 | Ga0466726_150075_4267_4836 | 189 |
| 20 | 3300042624 | Ga0466735_119304 | Ga0466735_119304_1960_2529 | 189 |
| 21 | 3300042635 | Ga0466702_017493 | Ga0466702_017493_384_953 | 189 |
| 22 | 3300042655 | Ga0466727_127832 | Ga0466727_127832_2064_2633 | 189 |
| 23 | 3300042655 | Ga0466727_302475 | Ga0466727_302475_698_1267 | 189 |
| 24 | 3300000062 | IMNBL1DRAFT_c0020316 | IMNBL1DRAFT_00203162 | 190 |
| 25 | 3300002450 | JGI24695J34938_10091250 | JGI24695J34938_100912501 | 190 |
| 26 | 3300002462 | JGI24702J35022_10017113 | JGI24702J35022_100171133 | 190 |
| 27 | 3300002462 | JGI24702J35022_10028547 | JGI24702J35022_100285472 | 190 |
| 28 | 3300002462 | JGI24702J35022_10080557 | JGI24702J35022_100805572 | 190 |
| 29 | 3300002504 | JGI24705J35276_12208430 | JGI24705J35276_122084302 | 190 |
| 30 | 3300005071 | Ga0068302_10673596 | Ga0068302_106735961 | 190 |
| 31 | 3300005083 | Ga0068305_11070244 | Ga0068305_110702442 | 190 |
| 32 | 3300009784 | Ga0123357_10000769 | Ga0123357_1000076922 | 190 |
| 33 | 3300009784 | Ga0123357_10002727 | Ga0123357_100027279 | 190 |
| 34 | 3300009784 | Ga0123357_10003270 | Ga0123357_100032704 | 190 |
| 35 | 3300009784 | Ga0123357_10074032 | Ga0123357_100740321 | 190 |
| 36 | 3300010049 | Ga0123356_10498496 | Ga0123356_104984962 | 190 |
| 37 | 3300010882 | Ga0123354_10016842 | Ga0123354_100168429 | 190 |
| 38 | 3300010882 | Ga0123354_10059022 | Ga0123354_100590223 | 190 |
| 39 | 3300042591 | Ga0466692_079338 | Ga0466692_079338_3983_4555 | 190 |
| 40 | 3300042592 | Ga0466693_356542 | Ga0466693_356542_533_1105 | 190 |
| 41 | 3300042593 | Ga0466691_176345 | Ga0466691_176345_3518_4090 | 190 |
| 42 | 3300042595 | Ga0466695_230880 | Ga0466695_230880_858_1430 | 190 |
| 43 | 3300042600 | Ga0466700_033238 | Ga0466700_033238_5611_6183 | 190 |
| 44 | 3300042605 | Ga0466716_249398 | Ga0466716_249398_2061_2633 | 190 |
| 45 | 3300042612 | Ga0466705_003681 | Ga0466705_003681_270_842 | 190 |
| 46 | 3300042618 | Ga0466723_207564 | Ga0466723_207564_1903_2475 | 190 |
| 47 | 3300042624 | Ga0466735_003846 | Ga0466735_003846_434_1006 | 190 |
| 48 | 3300042636 | Ga0466703_014537 | Ga0466703_014537_445_1017 | 190 |
| 49 | 3300042636 | Ga0466703_146869 | Ga0466703_146869_4877_5449 | 190 |
| 50 | 3300042643 | Ga0466704_328936 | Ga0466704_328936_2466_3038 | 190 |
| 51 | 3300042643 | Ga0466704_389641 | Ga0466704_389641_1763_2335 | 190 |
| 52 | 3300042655 | Ga0466727_101467 | Ga0466727_101467_2230_2802 | 190 |
| 53 | iso_pr_bacteria | 2820759988 | 2820761540 | 190 |
| 54 | 3300002509 | JGI24699J35502_11134038 | JGI24699J35502_111340383 | 191 |
| 55 | 3300002509 | JGI24699J35502_11134179 | JGI24699J35502_1113417922 | 191 |
| 56 | 3300005071 | Ga0068302_10086160 | Ga0068302_100861602 | 191 |
| 57 | 3300009784 | Ga0123357_10043436 | Ga0123357_100434362 | 191 |
| 58 | 3300010882 | Ga0123354_10172587 | Ga0123354_101725875 | 191 |
| 59 | 3300024493 | Ga0264413_110474 | Ga0264413_11047415 | 191 |
| 60 | 3300024493 | Ga0264413_115023 | Ga0264413_1150234 | 191 |
| 61 | 3300042550 | Ga0466656_300123 | Ga0466656_300123_364_939 | 191 |
| 62 | 3300042591 | Ga0466692_113028 | Ga0466692_113028_7422_7997 | 191 |
| 63 | 3300042591 | Ga0466692_202586 | Ga0466692_202586_85_660 | 191 |
| 64 | 3300042596 | Ga0466696_197960 | Ga0466696_197960_3057_3632 | 191 |
| 65 | 3300042602 | Ga0466713_049834 | Ga0466713_049834_1928_2503 | 191 |
| 66 | 3300042605 | Ga0466716_038569 | Ga0466716_038569_7055_7630 | 191 |
| 67 | 3300042606 | Ga0466719_113182 | Ga0466719_113182_1962_2537 | 191 |
| 68 | 3300042609 | Ga0466722_099494 | Ga0466722_099494_117_692 | 191 |
| 69 | 3300042609 | Ga0466722_178165 | Ga0466722_178165_19386_19961 | 191 |
| 70 | 3300042613 | Ga0466710_411020 | Ga0466710_411020_660_1235 | 191 |
| 71 | 3300042617 | Ga0466718_108092 | Ga0466718_108092_957_1532 | 191 |
| 72 | 3300042623 | Ga0466734_052911 | Ga0466734_052911_209_784 | 191 |
| 73 | 3300042636 | Ga0466703_060139 | Ga0466703_060139_183_758 | 191 |
| 74 | 3300042652 | Ga0466708_086861 | Ga0466708_086861_3877_4452 | 191 |
| 75 | 3300042656 | Ga0466732_149862 | Ga0466732_149862_4775_5350 | 191 |
| 76 | iso_pr_bacteria | 2820788205 | 2820788352 | 191 |
| 77 | 2225789004 | 2227488518 | 2227957441 | 192 |
| 78 | 2225789004 | 2227536057 | 2228053880 | 192 |
| 79 | 3300002834 | JGI24696J40584_12749414 | JGI24696J40584_127494142 | 192 |
| 80 | 3300009826 | Ga0123355_10000037 | Ga0123355_1000003734 | 192 |
| 81 | 3300010167 | Ga0123353_10677396 | Ga0123353_106773962 | 192 |
| 82 | 3300010882 | Ga0123354_10000296 | Ga0123354_1000029610 | 192 |
| 83 | 3300010882 | Ga0123354_10059564 | Ga0123354_100595643 | 192 |
| 84 | 3300042607 | Ga0466720_109557 | Ga0466720_109557_4566_5144 | 192 |
| 85 | 3300042607 | Ga0466720_196511 | Ga0466720_196511_1102_1680 | 192 |
| 86 | 3300042607 | Ga0466720_209892 | Ga0466720_209892_4412_4990 | 192 |
| 87 | 3300042610 | Ga0466698_365287 | Ga0466698_365287_547_1125 | 192 |
| 88 | 3300042620 | Ga0466728_253007 | Ga0466728_253007_2191_2769 | 192 |
| 89 | 3300042621 | Ga0466729_228955 | Ga0466729_228955_1365_1943 | 192 |
| 90 | 3300042648 | Ga0466709_008379 | Ga0466709_008379_37050_37628 | 192 |
| 91 | 3300005200 | Ga0072940_1009297 | Ga0072940_10092976 | 193 |
| 92 | 3300042590 | Ga0466690_068446 | Ga0466690_068446_4327_4908 | 193 |
| 93 | 3300042596 | Ga0466696_198319 | Ga0466696_198319_2243_2824 | 193 |
| 94 | 3300042598 | Ga0466701_079898 | Ga0466701_079898_4287_4868 | 193 |
| 95 | 3300042604 | Ga0466717_088313 | Ga0466717_088313_3146_3727 | 193 |
| 96 | 3300042611 | Ga0466697_204946 | Ga0466697_204946_554_1135 | 193 |
| 97 | 3300042612 | Ga0466705_105175 | Ga0466705_105175_11404_11985 | 193 |
| 98 | 3300042615 | Ga0466711_152562 | Ga0466711_152562_6123_6704 | 193 |
| 99 | 3300042615 | Ga0466711_502078 | Ga0466711_502078_2433_3014 | 193 |
| 100 | 3300042618 | Ga0466723_277709 | Ga0466723_277709_3451_4032 | 193 |
| 101 | 3300042619 | Ga0466726_347391 | Ga0466726_347391_1939_2520 | 193 |
| 102 | 3300042620 | Ga0466728_094263 | Ga0466728_094263_2118_2699 | 193 |
| 103 | 3300042636 | Ga0466703_396789 | Ga0466703_396789_5168_5749 | 193 |
| 104 | 3300042648 | Ga0466709_393588 | Ga0466709_393588_5614_6195 | 193 |
| 105 | 3300042655 | Ga0466727_033824 | Ga0466727_033824_1024_1605 | 193 |
| 106 | iso_pr_bacteria | 2940195863 | 2940196070 | 193 |
| 107 | 3300000062 | IMNBL1DRAFT_c0003796 | IMNBL1DRAFT_00037966 | 194 |
| 108 | 3300005071 | Ga0068302_10110626 | Ga0068302_101106263 | 194 |
| 109 | 3300009784 | Ga0123357_10000560 | Ga0123357_100005606 | 194 |
| 110 | 3300009784 | Ga0123357_10077467 | Ga0123357_100774675 | 194 |
| 111 | 3300010049 | Ga0123356_10007741 | Ga0123356_100077414 | 194 |
| 112 | 3300042594 | Ga0466694_228170 | Ga0466694_228170_965_1549 | 194 |
| 113 | 3300042624 | Ga0466735_228626 | Ga0466735_228626_53_637 | 194 |
| 114 | 3300042636 | Ga0466703_355603 | Ga0466703_355603_496_1080 | 194 |
| 115 | 3300042659 | Ga0466733_097127 | Ga0466733_097127_540_1124 | 194 |
| 116 | iso_pr_bacteria | 2820762746 | 2820764449 | 194 |
| 117 | 3300000089 | AustNasuHG_c1045121 | AustNasuHG_10451212 | 195 |
| 118 | 3300002509 | JGI24699J35502_11134168 | JGI24699J35502_1113416823 | 195 |
| 119 | 3300010049 | Ga0123356_10110304 | Ga0123356_101103043 | 195 |
| 120 | 3300042550 | Ga0466656_374057 | Ga0466656_374057_219_806 | 195 |
| 121 | 3300042596 | Ga0466696_460984 | Ga0466696_460984_4265_4852 | 195 |
| 122 | 3300042616 | Ga0466715_033953 | Ga0466715_033953_24815_25402 | 195 |
| 123 | 3300042652 | Ga0466708_439514 | Ga0466708_439514_798_1385 | 195 |
| 124 | 3300000062 | IMNBL1DRAFT_c0002509 | IMNBL1DRAFT_00025099 | 196 |
| 125 | 3300042618 | Ga0466723_009860 | Ga0466723_009860_1295_1885 | 196 |
| 126 | 3300042618 | Ga0466723_122680 | Ga0466723_122680_8658_9248 | 196 |
| 127 | 3300009784 | Ga0123357_10058048 | Ga0123357_100580484 | 197 |
| 128 | 3300010167 | Ga0123353_10080877 | Ga0123353_100808774 | 197 |
| 129 | 3300042603 | Ga0466714_020399 | Ga0466714_020399_558_1151 | 197 |
| 130 | 3300042603 | Ga0466714_088229 | Ga0466714_088229_809_1402 | 197 |
| 131 | 3300042606 | Ga0466719_488098 | Ga0466719_488098_172_765 | 197 |
| 132 | 3300009784 | Ga0123357_10236048 | Ga0123357_102360482 | 198 |
| 133 | 3300002462 | JGI24702J35022_10016038 | JGI24702J35022_100160386 | 199 |
| 134 | 3300002504 | JGI24705J35276_12235768 | JGI24705J35276_122357687 | 199 |
| 135 | 3300009784 | Ga0123357_10218852 | Ga0123357_102188524 | 199 |
| 136 | 3300042591 | Ga0466692_083917 | Ga0466692_083917_10458_11066 | 202 |
| 137 | 3300000062 | IMNBL1DRAFT_c0010865 | IMNBL1DRAFT_00108653 | 203 |
| 138 | 3300042600 | Ga0466700_270932 | Ga0466700_270932_5022_5633 | 203 |
| 139 | 3300042601 | Ga0466707_060703 | Ga0466707_060703_19728_20339 | 203 |
| 140 | 3300042610 | Ga0466698_289511 | Ga0466698_289511_90_701 | 203 |
| 141 | 3300005083 | Ga0068305_10171204 | Ga0068305_101712042 | 205 |
| 142 | 3300042616 | Ga0466715_332133 | Ga0466715_332133_16898_17515 | 205 |
| 143 | 3300042612 | Ga0466705_204211 | Ga0466705_204211_1430_2050 | 206 |
| 144 | 3300042618 | Ga0466723_155547 | Ga0466723_155547_305_925 | 206 |
| 145 | 3300042621 | Ga0466729_010637 | Ga0466729_010637_2854_3501 | 207 |
| 146 | 3300042659 | Ga0466733_193873 | Ga0466733_193873_389_1018 | 209 |
| 147 | 3300042619 | Ga0466726_131705 | Ga0466726_131705_911_1543 | 210 |
| 148 | 3300042615 | Ga0466711_410951 | Ga0466711_410951_98_733 | 211 |
| 149 | 3300042612 | Ga0466705_062364 | Ga0466705_062364_1107_1748 | 213 |
| 150 | 3300042621 | Ga0466729_208291 | Ga0466729_208291_2157_2852 | 231 |
| 151 | 3300042624 | Ga0466735_168555 | Ga0466735_168555_41_745 | 234 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01558 | POR | Pyruvate ferredoxin/flavodoxin oxidoreductase | 54 | 228 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01558 | GO:0016903 | oxidoreductase activity, acting on the aldehyde or oxo group of donors | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.