Protein Family IF08826
Metagenome
Isolate
109
Members
56
Samples
98
Scaffolds
315.02
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_168459|Ga0466735_168459_259_1302
- Length
- 347 aa
- Sequence
- VGDDCGVVFADREGGSNDEKREINKNSVMDISVIVPLYNEEESLGKLLAWIEKVMVEHSFSYEVIFVDDGSRDKSWLVIEKAAGELPDNVKGVKFSRNYGKSAALNVGFEYAQGDVVITMDADLQDSPDEIPELYQMVMQGGYDLVSGWKKKRYDSKIMKNLPSKLYNATTRAITGIKLHDFNCGLKAYRNEVIKSIEVYGEMHRYIPVIAKGAGFINIGEKVVQHRKREFGESKFGMNRFVHGYLDLISIIFILKFGKKPMHFFGLWGSVMFIIGIALVIVMGVQKIVAGFEGMTMRLITNSPYFYIALATMIIGCQLFLAGFLGEMIGRNSSSRNSYLISKKKNL
Sample Types
Isolate
10.1%
Metagenome
89.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
23.6%
Termitidae
21.8%
Unclassified
14.5%
Formicidae
9.1%
Termopsidae
7.3%
Passalidae
5.5%
Blattidae
5.5%
Rhinotermitidae
5.5%
Armadillidiidae
3.6%
Hodotermitidae
1.8%
Daphniidae
1.8%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 2 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 3 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 11 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 12 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 13 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 38 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 39 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_426563 | 3300042656 | Bacteria | 3694 |
| 2 | Ga0466711_116726 | 3300042615 | Bacteria | 15236 |
| 3 | Ga0466690_109271 | 3300042590 | Bacteria | 10351 |
| 4 | IMNBL1DRAFT_c0030468 | 3300000062 | Bacteria | 1978 |
| 5 | Ga0068302_10062972 | 3300005071 | Bacteria | 3474 |
| 6 | Ga0466709_010586 | 3300042648 | Bacteria | 27999 |
| 7 | Ga0466706_083101 | 3300042599 | Bacteria | 1636 |
| 8 | Ga0466714_027154 | 3300042603 | Bacteria | 2325 |
| 9 | Ga0466714_158975 | 3300042603 | Bacteria | 3992 |
| 10 | Ga0466723_331676 | 3300042618 | Bacteria | 8777 |
| 11 | Ga0466690_360277 | 3300042590 | Bacteria | 13929 |
| 12 | Ga0466691_062187 | 3300042593 | Bacteria | 10482 |
| 13 | Ga0466709_230945 | 3300042648 | Bacteria | 1733 |
| 14 | Ga0466727_335979 | 3300042655 | Bacteria | 7516 |
| 15 | Ga0466700_181713 | 3300042600 | Bacteria | 63326 |
| 16 | Ga0466719_397928 | 3300042606 | Bacteria | 3874 |
| 17 | Ga0466690_323128 | 3300042590 | Bacteria | 11614 |
| 18 | Ga0466691_075701 | 3300042593 | Bacteria | 7488 |
| 19 | Ga0466691_212837 | 3300042593 | Bacteria | 1341 |
| 20 | IMNBL1DRAFT_c0014904 | 3300000062 | Bacteria | 3399 |
| 21 | Ga0068305_10054368 | 3300005083 | Bacteria | 20348 |
| 22 | Ga0102734_1000639 | 3300007129 | Bacteria | 9710 |
| 23 | Ga0466735_128172 | 3300042624 | Bacteria | 11853 |
| 24 | Ga0466727_133145 | 3300042655 | Bacteria | 1404 |
| 25 | Ga0466701_055361 | 3300042598 | Bacteria | 1178 |
| 26 | Ga0466722_054995 | 3300042609 | Bacteria | 2516 |
| 27 | Ga0466697_054163 | 3300042611 | Bacteria | 1301 |
| 28 | Ga0123357_10024567 | 3300009784 | Bacteria | 8114 |
| 29 | Ga0123356_10007378 | 3300010049 | Bacteria | 10970 |
| 30 | Ga0466733_188737 | 3300042659 | Bacteria | 4572 |
| 31 | 2227369690 | 2225789004 | Bacteria | 6035 |
| 32 | 2227425258 | 2225789004 | Unclassified | 5595 |
| 33 | CVPL010W_10009316 | 3300002931 | Bacteria | 8958 |
| 34 | Ga0102735_1003277 | 3300007080 | Bacteria | 2299 |
| 35 | Ga0102740_1000663 | 3300007140 | Bacteria | 9321 |
| 36 | Ga0123357_10000750 | 3300009784 | Bacteria | 32698 |
| 37 | Ga0466703_215363 | 3300042636 | Bacteria | 2871 |
| 38 | Ga0466708_352244 | 3300042652 | Bacteria | 8894 |
| 39 | Ga0466727_047667 | 3300042655 | Bacteria | 5418 |
| 40 | Ga0466713_127319 | 3300042602 | Bacteria | 7534 |
| 41 | Ga0466716_089579 | 3300042605 | Bacteria | 21981 |
| 42 | Ga0466715_306758 | 3300042616 | Bacteria | 3340 |
| 43 | Ga0160443_100086 | 3300012848 | Bacteria | 161520 |
| 44 | 2227008136 | 2225789003 | Bacteria | 27221 |
| 45 | 2227480167 | 2225789004 | Bacteria | 99470 |
| 46 | IMNBL1DRAFT_c0001930 | 3300000062 | Bacteria | 14978 |
| 47 | IMNBL1DRAFT_c0008853 | 3300000062 | Bacteria | 5068 |
| 48 | Ga0068305_10016657 | 3300005083 | Bacteria | 9579 |
| 49 | Ga0103263_100991 | 3300007042 | Bacteria | 3785 |
| 50 | Ga0123357_10001670 | 3300009784 | Bacteria | 23864 |
| 51 | Ga0466707_092514 | 3300042601 | Bacteria | 6707 |
| 52 | Ga0466713_021288 | 3300042602 | Bacteria | 7185 |
| 53 | Ga0123357_10015934 | 3300009784 | Bacteria | 9870 |
| 54 | Ga0123356_10000736 | 3300010049 | Bacteria | 36088 |
| 55 | Ga0466697_119380 | 3300042611 | Bacteria | 1261 |
| 56 | Ga0466715_153338 | 3300042616 | Bacteria | 101125 |
| 57 | Ga0466726_397992 | 3300042619 | Bacteria | 12688 |
| 58 | 2227502413 | 2225789004 | Bacteria | 19081 |
| 59 | IMNBL1DRAFT_c0006234 | 3300000062 | Bacteria | 6554 |
| 60 | JGI24705J35276_12231043 | 3300002504 | Bacteria | 3810 |
| 61 | Ga0466735_118070 | 3300042624 | Bacteria | 3965 |
| 62 | Ga0466703_229514 | 3300042636 | Bacteria | 9538 |
| 63 | Ga0466704_163778 | 3300042643 | Bacteria | 2200 |
| 64 | Ga0466704_166701 | 3300042643 | Bacteria | 29919 |
| 65 | Ga0466709_414452 | 3300042648 | Bacteria | 14122 |
| 66 | Ga0466707_358709 | 3300042601 | Bacteria | 12034 |
| 67 | Ga0466713_124356 | 3300042602 | Bacteria | 60440 |
| 68 | Ga0466719_055757 | 3300042606 | Bacteria | 33722 |
| 69 | Ga0466722_031037 | 3300042609 | Bacteria | 32845 |
| 70 | Ga0123353_10000490 | 3300010167 | Bacteria | 48867 |
| 71 | Ga0466697_227079 | 3300042611 | Bacteria | 2778 |
| 72 | Ga0466711_464836 | 3300042615 | Bacteria | 36759 |
| 73 | Ga0466711_507068 | 3300042615 | Bacteria | 2829 |
| 74 | Ga0160443_100068 | 3300012848 | Bacteria | 202672 |
| 75 | IMNBL1DRAFT_c0008451 | 3300000062 | Bacteria | 5236 |
| 76 | Ga0466709_156327 | 3300042648 | Unclassified | 3382 |
| 77 | Ga0466727_296930 | 3300042655 | Bacteria | 5628 |
| 78 | Ga0466706_123835 | 3300042599 | Bacteria | 1219 |
| 79 | Ga0466707_113751 | 3300042601 | Bacteria | 16969 |
| 80 | Ga0466707_126340 | 3300042601 | Bacteria | 1836 |
| 81 | Ga0466713_147564 | 3300042602 | Bacteria | 35409 |
| 82 | Ga0123355_10000975 | 3300009826 | Bacteria | 39660 |
| 83 | Ga0123353_10558763 | 3300010167 | Bacteria | 1648 |
| 84 | Ga0466728_236626 | 3300042620 | Bacteria | 13401 |
| 85 | Ga0160455_100069 | 3300012837 | Bacteria | 184978 |
| 86 | Ga0466657_085859 | 3300042582 | Bacteria | 7933 |
| 87 | Ga0466696_060152 | 3300042596 | Bacteria | 5299 |
| 88 | IMNBL1DRAFT_c0002422 | 3300000062 | Bacteria | 12986 |
| 89 | Ga0466729_213317 | 3300042621 | Bacteria | 2060 |
| 90 | Ga0466735_024530 | 3300042624 | Bacteria | 4498 |
| 91 | Ga0466735_168459 | 3300042624 | Bacteria | 1756 |
| 92 | Ga0466703_101739 | 3300042636 | Bacteria | 5493 |
| 93 | Ga0466703_166136 | 3300042636 | Bacteria | 7920 |
| 94 | Ga0466709_047534 | 3300042648 | Unclassified | 2616 |
| 95 | Ga0466708_303744 | 3300042652 | Bacteria | 19652 |
| 96 | Ga0466706_014102 | 3300042599 | Bacteria | 29927 |
| 97 | Ga0466713_080967 | 3300042602 | Bacteria | 10571 |
| 98 | Ga0123353_10440847 | 3300010167 | Bacteria | 1921 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042624 | Ga0466735_118070 | Ga0466735_118070_1105_2055 | 291 |
| 2 | 3300009826 | Ga0123355_10000975 | Ga0123355_100009753 | 292 |
| 3 | 3300042659 | Ga0466733_188737 | Ga0466733_188737_1508_2458 | 294 |
| 4 | 3300000062 | IMNBL1DRAFT_c0006234 | IMNBL1DRAFT_00062345 | 295 |
| 5 | 3300042611 | Ga0466697_119380 | Ga0466697_119380_356_1243 | 295 |
| 6 | 3300042636 | Ga0466703_166136 | Ga0466703_166136_2759_3706 | 295 |
| 7 | 3300042643 | Ga0466704_166701 | Ga0466704_166701_3445_4395 | 296 |
| 8 | 3300042601 | Ga0466707_092514 | Ga0466707_092514_1566_2516 | 301 |
| 9 | 3300009784 | Ga0123357_10024567 | Ga0123357_100245678 | 302 |
| 10 | 3300042605 | Ga0466716_089579 | Ga0466716_089579_18409_19362 | 303 |
| 11 | 3300042619 | Ga0466726_397992 | Ga0466726_397992_7825_8775 | 303 |
| 12 | 3300042620 | Ga0466728_236626 | Ga0466728_236626_11284_12237 | 304 |
| 13 | 3300042648 | Ga0466709_047534 | Ga0466709_047534_1582_2532 | 304 |
| 14 | 3300042648 | Ga0466709_156327 | Ga0466709_156327_1809_2759 | 304 |
| 15 | 3300042648 | Ga0466709_230945 | Ga0466709_230945_730_1680 | 304 |
| 16 | 3300042652 | Ga0466708_303744 | Ga0466708_303744_870_1820 | 304 |
| 17 | 2225789004 | 2227425258 | 2227865748 | 306 |
| 18 | 3300042636 | Ga0466703_229514 | Ga0466703_229514_5668_6615 | 306 |
| 19 | 3300000062 | IMNBL1DRAFT_c0002422 | IMNBL1DRAFT_00024223 | 307 |
| 20 | 3300042600 | Ga0466700_181713 | Ga0466700_181713_7739_8662 | 307 |
| 21 | 3300042643 | Ga0466704_163778 | Ga0466704_163778_667_1590 | 307 |
| 22 | 3300042599 | Ga0466706_123835 | Ga0466706_123835_11_937 | 308 |
| 23 | 3300042602 | Ga0466713_021288 | Ga0466713_021288_1291_2217 | 308 |
| 24 | 3300009784 | Ga0123357_10000750 | Ga0123357_1000075014 | 310 |
| 25 | 3300042593 | Ga0466691_212837 | Ga0466691_212837_291_1223 | 310 |
| 26 | iso_pr_bacteria | 2882250448 | 2882252400 | 313 |
| 27 | 3300010049 | Ga0123356_10007378 | Ga0123356_100073785 | 314 |
| 28 | 2225789003 | 2227008136 | 2227365055 | 315 |
| 29 | 3300042590 | Ga0466690_323128 | Ga0466690_323128_8825_9772 | 315 |
| 30 | 3300042593 | Ga0466691_075701 | Ga0466691_075701_3192_4139 | 315 |
| 31 | 3300042606 | Ga0466719_055757 | Ga0466719_055757_31485_32432 | 315 |
| 32 | 3300042618 | Ga0466723_331676 | Ga0466723_331676_3698_4645 | 315 |
| 33 | 3300042655 | Ga0466727_296930 | Ga0466727_296930_2125_3072 | 315 |
| 34 | 2225789004 | 2227369690 | 2227816417 | 316 |
| 35 | 2225789004 | 2227502413 | 2227986667 | 316 |
| 36 | 3300000062 | IMNBL1DRAFT_c0008451 | IMNBL1DRAFT_00084511 | 316 |
| 37 | 3300000062 | IMNBL1DRAFT_c0008853 | IMNBL1DRAFT_00088532 | 316 |
| 38 | 3300005083 | Ga0068305_10016657 | Ga0068305_100166573 | 316 |
| 39 | 3300005083 | Ga0068305_10054368 | Ga0068305_100543682 | 316 |
| 40 | 3300042590 | Ga0466690_109271 | Ga0466690_109271_1548_2498 | 316 |
| 41 | 3300042593 | Ga0466691_062187 | Ga0466691_062187_1427_2377 | 316 |
| 42 | 3300042596 | Ga0466696_060152 | Ga0466696_060152_3277_4227 | 316 |
| 43 | 3300042601 | Ga0466707_113751 | Ga0466707_113751_1222_2172 | 316 |
| 44 | 3300042609 | Ga0466722_031037 | Ga0466722_031037_3364_4314 | 316 |
| 45 | 3300042609 | Ga0466722_054995 | Ga0466722_054995_353_1303 | 316 |
| 46 | 3300042615 | Ga0466711_464836 | Ga0466711_464836_34602_35552 | 316 |
| 47 | 3300042616 | Ga0466715_153338 | Ga0466715_153338_13736_14686 | 316 |
| 48 | 3300042636 | Ga0466703_215363 | Ga0466703_215363_1814_2764 | 316 |
| 49 | 3300042648 | Ga0466709_010586 | Ga0466709_010586_7052_8002 | 316 |
| 50 | 3300042648 | Ga0466709_414452 | Ga0466709_414452_9886_10836 | 316 |
| 51 | 3300042652 | Ga0466708_352244 | Ga0466708_352244_2925_3875 | 316 |
| 52 | 3300042655 | Ga0466727_047667 | Ga0466727_047667_1361_2311 | 316 |
| 53 | 3300042655 | Ga0466727_133145 | Ga0466727_133145_295_1245 | 316 |
| 54 | iso_pr_bacteria | 2609459943 | 2610743388 | 316 |
| 55 | iso_pr_bacteria | 2830041218 | 2830041782 | 316 |
| 56 | iso_pr_bacteria | 3004672520 | 3004675174 | 316 |
| 57 | iso_pr_bacteria | 3004677695 | 3004679261 | 316 |
| 58 | 2225789004 | 2227480167 | 2227937598 | 317 |
| 59 | 3300000062 | IMNBL1DRAFT_c0001930 | IMNBL1DRAFT_00019303 | 317 |
| 60 | 3300009784 | Ga0123357_10015934 | Ga0123357_100159348 | 317 |
| 61 | 3300012837 | Ga0160455_100069 | Ga0160455_100069105 | 317 |
| 62 | 3300012848 | Ga0160443_100068 | Ga0160443_100068122 | 317 |
| 63 | 3300012848 | Ga0160443_100086 | Ga0160443_10008632 | 317 |
| 64 | 3300042582 | Ga0466657_085859 | Ga0466657_085859_4800_5753 | 317 |
| 65 | 3300042599 | Ga0466706_014102 | Ga0466706_014102_4486_5439 | 317 |
| 66 | 3300042601 | Ga0466707_126340 | Ga0466707_126340_785_1738 | 317 |
| 67 | 3300042602 | Ga0466713_080967 | Ga0466713_080967_5827_6780 | 317 |
| 68 | 3300042603 | Ga0466714_027154 | Ga0466714_027154_1162_2115 | 317 |
| 69 | 3300042603 | Ga0466714_158975 | Ga0466714_158975_1759_2712 | 317 |
| 70 | 3300042611 | Ga0466697_054163 | Ga0466697_054163_129_1082 | 317 |
| 71 | 3300042616 | Ga0466715_306758 | Ga0466715_306758_1127_2080 | 317 |
| 72 | 3300042624 | Ga0466735_024530 | Ga0466735_024530_2362_3315 | 317 |
| 73 | 3300042624 | Ga0466735_128172 | Ga0466735_128172_853_1806 | 317 |
| 74 | 3300042636 | Ga0466703_101739 | Ga0466703_101739_136_1089 | 317 |
| 75 | 3300042656 | Ga0466732_426563 | Ga0466732_426563_471_1424 | 317 |
| 76 | iso_pr_bacteria | 2590828803 | 2592926883 | 317 |
| 77 | iso_pr_bacteria | 2820748953 | 2820749205 | 317 |
| 78 | iso_pr_bacteria | 2820751898 | 2820752708 | 317 |
| 79 | iso_pr_bacteria | 2820776227 | 2820777092 | 317 |
| 80 | iso_pr_bacteria | 2820781750 | 2820781842 | 317 |
| 81 | iso_pr_bacteria | 2920168565 | 2920169780 | 317 |
| 82 | 3300000062 | IMNBL1DRAFT_c0014904 | IMNBL1DRAFT_00149044 | 318 |
| 83 | 3300000062 | IMNBL1DRAFT_c0030468 | IMNBL1DRAFT_00304683 | 318 |
| 84 | 3300002504 | JGI24705J35276_12231043 | JGI24705J35276_122310433 | 318 |
| 85 | 3300009784 | Ga0123357_10001670 | Ga0123357_100016706 | 318 |
| 86 | 3300010049 | Ga0123356_10000736 | Ga0123356_100007362 | 318 |
| 87 | 3300010167 | Ga0123353_10000490 | Ga0123353_1000049031 | 318 |
| 88 | 3300010167 | Ga0123353_10440847 | Ga0123353_104408472 | 318 |
| 89 | 3300042590 | Ga0466690_360277 | Ga0466690_360277_12301_13257 | 318 |
| 90 | 3300005071 | Ga0068302_10062972 | Ga0068302_100629724 | 319 |
| 91 | 3300042601 | Ga0466707_358709 | Ga0466707_358709_6767_7726 | 319 |
| 92 | 3300042602 | Ga0466713_124356 | Ga0466713_124356_50237_51196 | 319 |
| 93 | 3300042606 | Ga0466719_397928 | Ga0466719_397928_2081_3040 | 319 |
| 94 | 3300042611 | Ga0466697_227079 | Ga0466697_227079_317_1276 | 319 |
| 95 | 3300042621 | Ga0466729_213317 | Ga0466729_213317_632_1591 | 319 |
| 96 | 3300010167 | Ga0123353_10558763 | Ga0123353_105587632 | 320 |
| 97 | 3300042598 | Ga0466701_055361 | Ga0466701_055361_93_1055 | 320 |
| 98 | 3300042615 | Ga0466711_116726 | Ga0466711_116726_1372_2367 | 320 |
| 99 | 3300042602 | Ga0466713_147564 | Ga0466713_147564_4233_5198 | 321 |
| 100 | 3300042615 | Ga0466711_507068 | Ga0466711_507068_520_1488 | 322 |
| 101 | 3300042655 | Ga0466727_335979 | Ga0466727_335979_4198_5166 | 322 |
| 102 | 3300042599 | Ga0466706_083101 | Ga0466706_083101_122_1099 | 325 |
| 103 | 3300002931 | CVPL010W_10009316 | CVPL010W_100093167 | 327 |
| 104 | 3300007129 | Ga0102734_1000639 | Ga0102734_10006395 | 327 |
| 105 | 3300007140 | Ga0102740_1000663 | Ga0102740_10006632 | 327 |
| 106 | 3300007080 | Ga0102735_1003277 | Ga0102735_10032772 | 340 |
| 107 | 3300007042 | Ga0103263_100991 | Ga0103263_1009914 | 344 |
| 108 | 3300042624 | Ga0466735_168459 | Ga0466735_168459_259_1302 | 347 |
| 109 | 3300042602 | Ga0466713_127319 | Ga0466713_127319_177_1235 | 352 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.72 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.