Protein Family IF08820
Metagenome
Isolate
139
Members
61
Samples
108
Scaffolds
374.26
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_163203|Ga0466735_163203_24389_25558
- Length
- 389 aa
- Sequence
- VIECGSYQLIKKSSECMARRGKVYTVRGIIDTPVFMPVGTQGSVKGVATEFLKGSGAQIILANSYHLYLRPGTEVIKKAGGIQKFNSWNSPMLTDSXXXXMFSLSDIRKITEDGTEFQSYIDGSKHFFSPEKSMQVQKDIGADIIMCFDECTPYCSDYGYAKKSMELNLKWAKRCKEEFYKDDSYKTQSLFGIIQGSVYDDLRIKSAWEMLSVGFTGYAVGGLSVGEPKKSMHSVLENVLPIIPENKARYLMGVGMPEDLWECVERGIDMFDCVIPTRNGRNGQVFTSLGKINLRNAEFKKDFSSLDPDCACPACAGYSKAYLNHLIRSRETLYLSLLSLHNIYFMLGLMVKIRKSLEDDTFFKSKREFFEKYYLRNRSRFSKNLCSKK
Sample Types
Isolate
22.3%
Metagenome
77.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
23.0%
Unclassified
16.4%
Blaberidae
13.1%
Termitidae
9.8%
Termopsidae
6.6%
Blattellidae
4.9%
Anaplectidae
3.3%
Rhinotermitidae
3.3%
Blattidae
3.3%
Ectobiidae
3.3%
Corydiidae
3.3%
Nyctiboridae
3.3%
Ixodidae
1.6%
Hodotermitidae
1.6%
Tryonicidae
1.6%
Pseudophyllodromiidae
1.6%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 2 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 12 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 13 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 14 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 15 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 16 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 22 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 23 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 24 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 25 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 29 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 32 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 39 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 40 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 46 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 47 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 48 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 49 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 53 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 54 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 55 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_087286 | 3300042590 | Unclassified | 8871 |
| 2 | Ga0466690_180876 | 3300042590 | Bacteria | 31636 |
| 3 | Ga0466690_287104 | 3300042590 | Bacteria | 22096 |
| 4 | Ga0466696_202836 | 3300042596 | Unclassified | 25801 |
| 5 | Ga0466729_259773 | 3300042621 | Bacteria | 2808 |
| 6 | Ga0466735_019684 | 3300042624 | Bacteria | 12007 |
| 7 | Ga0466704_602570 | 3300042643 | Bacteria | 18095 |
| 8 | Ga0466707_357026 | 3300042601 | Bacteria | 7258 |
| 9 | Ga0466713_028532 | 3300042602 | Unclassified | 2811 |
| 10 | Ga0466716_175038 | 3300042605 | Unclassified | 7015 |
| 11 | Ga0466711_493807 | 3300042615 | Bacteria | 45943 |
| 12 | Ga0466723_126625 | 3300042618 | Bacteria | 1263 |
| 13 | Ga0466726_337633 | 3300042619 | Bacteria | 39129 |
| 14 | Ga0466728_380833 | 3300042620 | Bacteria | 49387 |
| 15 | Ga0466729_127141 | 3300042621 | Bacteria | 5187 |
| 16 | Ga0068305_10000131 | 3300005083 | Bacteria | 190192 |
| 17 | Ga0466735_066774 | 3300042624 | Bacteria | 6964 |
| 18 | Ga0466703_151943 | 3300042636 | Bacteria | 39881 |
| 19 | Ga0466704_037607 | 3300042643 | Bacteria | 18658 |
| 20 | Ga0466704_230828 | 3300042643 | Unclassified | 5731 |
| 21 | Ga0466704_398472 | 3300042643 | Unclassified | 5076 |
| 22 | Ga0466708_328797 | 3300042652 | Unclassified | 1885 |
| 23 | Ga0466706_155209 | 3300042599 | Bacteria | 186431 |
| 24 | Ga0466707_013650 | 3300042601 | Bacteria | 197174 |
| 25 | Ga0466715_141394 | 3300042616 | Bacteria | 17581 |
| 26 | Ga0466723_076556 | 3300042618 | Unclassified | 18521 |
| 27 | Ga0466726_165686 | 3300042619 | Bacteria | 20812 |
| 28 | Ga0466728_413945 | 3300042620 | Bacteria | 40167 |
| 29 | Ga0466729_088442 | 3300042621 | Bacteria | 28252 |
| 30 | Ga0466705_032566 | 3300042612 | Bacteria | 19403 |
| 31 | Ga0123353_10000123 | 3300010167 | Bacteria | 92814 |
| 32 | Ga0466735_084835 | 3300042624 | Bacteria | 22781 |
| 33 | Ga0466735_163203 | 3300042624 | Bacteria | 32639 |
| 34 | Ga0466735_226629 | 3300042624 | Bacteria | 1963 |
| 35 | Ga0466709_403433 | 3300042648 | Unclassified | 20112 |
| 36 | Ga0466708_242671 | 3300042652 | Bacteria | 4566 |
| 37 | Ga0466706_072463 | 3300042599 | Bacteria | 8960 |
| 38 | Ga0466707_213151 | 3300042601 | Bacteria | 39169 |
| 39 | Ga0466713_062934 | 3300042602 | Bacteria | 13155 |
| 40 | Ga0466714_142214 | 3300042603 | Bacteria | 1987 |
| 41 | Ga0466726_065940 | 3300042619 | Bacteria | 154230 |
| 42 | JGI24702J35022_10000633 | 3300002462 | Unclassified | 21396 |
| 43 | Ga0466690_069955 | 3300042590 | Bacteria | 6484 |
| 44 | Ga0466735_116209 | 3300042624 | Bacteria | 6158 |
| 45 | Ga0466735_153444 | 3300042624 | Bacteria | 2878 |
| 46 | Ga0466703_373748 | 3300042636 | Bacteria | 99169 |
| 47 | Ga0466704_063191 | 3300042643 | Bacteria | 120263 |
| 48 | Ga0466713_051451 | 3300042602 | Bacteria | 53134 |
| 49 | Ga0466714_131668 | 3300042603 | Bacteria | 15567 |
| 50 | Ga0466715_571813 | 3300042616 | Bacteria | 4444 |
| 51 | Ga0466715_627388 | 3300042616 | Bacteria | 115089 |
| 52 | Ga0466723_090577 | 3300042618 | Bacteria | 13138 |
| 53 | JGI24705J35276_12238806 | 3300002504 | Bacteria | 109319 |
| 54 | Ga0068305_10001537 | 3300005083 | Bacteria | 36494 |
| 55 | Ga0466705_315083 | 3300042612 | Unclassified | 21789 |
| 56 | Ga0466690_055751 | 3300042590 | Bacteria | 148091 |
| 57 | Ga0466735_001236 | 3300042624 | Bacteria | 7588 |
| 58 | Ga0466704_017715 | 3300042643 | Unclassified | 114027 |
| 59 | Ga0466727_061975 | 3300042655 | Bacteria | 1411 |
| 60 | Ga0466706_032922 | 3300042599 | Bacteria | 8772 |
| 61 | Ga0466706_048336 | 3300042599 | Bacteria | 23602 |
| 62 | Ga0466713_054647 | 3300042602 | Bacteria | 35906 |
| 63 | Ga0466713_139066 | 3300042602 | Bacteria | 109882 |
| 64 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 65 | Ga0466719_274100 | 3300042606 | Bacteria | 3253 |
| 66 | Ga0466711_097740 | 3300042615 | Bacteria | 4261 |
| 67 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 68 | Ga0123353_10576093 | 3300010167 | Bacteria | 1616 |
| 69 | Ga0466735_228503 | 3300042624 | Bacteria | 2589 |
| 70 | Ga0466727_004981 | 3300042655 | Bacteria | 59194 |
| 71 | Ga0466706_031300 | 3300042599 | Bacteria | 209681 |
| 72 | Ga0466706_094374 | 3300042599 | Bacteria | 3160 |
| 73 | Ga0466722_163351 | 3300042609 | Bacteria | 1898 |
| 74 | Ga0466711_258288 | 3300042615 | Bacteria | 35671 |
| 75 | Ga0466715_012803 | 3300042616 | Bacteria | 41762 |
| 76 | Ga0466723_262020 | 3300042618 | Bacteria | 13662 |
| 77 | Ga0466726_458639 | 3300042619 | Bacteria | 4380 |
| 78 | Ga0466728_176015 | 3300042620 | Bacteria | 3627 |
| 79 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 80 | Ga0466691_091893 | 3300042593 | Unclassified | 10711 |
| 81 | Ga0123357_10008349 | 3300009784 | Bacteria | 12930 |
| 82 | Ga0466735_004820 | 3300042624 | Bacteria | 7391 |
| 83 | Ga0466727_219994 | 3300042655 | Bacteria | 4667 |
| 84 | Ga0466716_297797 | 3300042605 | Unclassified | 9605 |
| 85 | Ga0466719_112385 | 3300042606 | Unclassified | 15442 |
| 86 | Ga0466719_294508 | 3300042606 | Bacteria | 20658 |
| 87 | Ga0466719_345713 | 3300042606 | Bacteria | 3977 |
| 88 | Ga0466711_012686 | 3300042615 | Bacteria | 31029 |
| 89 | Ga0466723_141698 | 3300042618 | Bacteria | 266684 |
| 90 | Ga0466723_271557 | 3300042618 | Bacteria | 31425 |
| 91 | Ga0466726_145651 | 3300042619 | Bacteria | 3622 |
| 92 | Ga0466690_151275 | 3300042590 | Bacteria | 5383 |
| 93 | Ga0123355_10271678 | 3300009826 | Unclassified | 2354 |
| 94 | Ga0123353_10247852 | 3300010167 | Bacteria | 2762 |
| 95 | Ga0466729_198612 | 3300042621 | Bacteria | 122910 |
| 96 | Ga0466735_014157 | 3300042624 | Bacteria | 27897 |
| 97 | Ga0466707_226860 | 3300042601 | Bacteria | 13140 |
| 98 | Ga0466716_320138 | 3300042605 | Bacteria | 17236 |
| 99 | Ga0466715_058388 | 3300042616 | Bacteria | 6526 |
| 100 | Ga0466715_066605 | 3300042616 | Bacteria | 23054 |
| 101 | Ga0466723_322312 | 3300042618 | Unclassified | 14259 |
| 102 | Ga0466726_038484 | 3300042619 | Unclassified | 16690 |
| 103 | Ga0466726_405165 | 3300042619 | Unclassified | 4080 |
| 104 | Ga0466726_460664 | 3300042619 | Bacteria | 14519 |
| 105 | Ga0466728_017387 | 3300042620 | Bacteria | 16225 |
| 106 | Ga0466728_040984 | 3300042620 | Bacteria | 27093 |
| 107 | Ga0068302_10046259 | 3300005071 | Unclassified | 4062 |
| 108 | Ga0068305_10000019 | 3300005083 | Bacteria | 30002 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042602 | Ga0466713_028532 | Ga0466713_028532_22_1050 | 342 |
| 2 | 3300042643 | Ga0466704_602570 | Ga0466704_602570_1472_2500 | 342 |
| 3 | 3300042590 | Ga0466690_087286 | Ga0466690_087286_2585_3619 | 344 |
| 4 | 3300042596 | Ga0466696_202836 | Ga0466696_202836_11514_12548 | 344 |
| 5 | 3300042605 | Ga0466716_175038 | Ga0466716_175038_4460_5494 | 344 |
| 6 | 3300042605 | Ga0466716_320138 | Ga0466716_320138_4455_5489 | 344 |
| 7 | 3300042615 | Ga0466711_493807 | Ga0466711_493807_24481_25515 | 344 |
| 8 | 3300042618 | Ga0466723_076556 | Ga0466723_076556_13585_14619 | 344 |
| 9 | 3300042618 | Ga0466723_126625 | Ga0466723_126625_158_1192 | 344 |
| 10 | 3300042619 | Ga0466726_458639 | Ga0466726_458639_3285_4319 | 344 |
| 11 | 3300042619 | Ga0466726_038484 | Ga0466726_038484_13916_14956 | 346 |
| 12 | 3300042643 | Ga0466704_398472 | Ga0466704_398472_498_1538 | 346 |
| 13 | 3300042590 | Ga0466690_287104 | Ga0466690_287104_20024_21100 | 358 |
| 14 | 3300042624 | Ga0466735_019684 | Ga0466735_019684_6027_7175 | 358 |
| 15 | 3300009826 | Ga0123355_10271678 | Ga0123355_102716782 | 360 |
| 16 | 3300042624 | Ga0466735_084835 | Ga0466735_084835_20782_21870 | 362 |
| 17 | 3300042621 | Ga0466729_259773 | Ga0466729_259773_387_1523 | 363 |
| 18 | 3300042624 | Ga0466735_004820 | Ga0466735_004820_2092_3252 | 363 |
| 19 | 3300042624 | Ga0466735_014157 | Ga0466735_014157_26306_27466 | 363 |
| 20 | iso_pr_bacteria | 2561511170 | 2562331682 | 367 |
| 21 | 3300042624 | Ga0466735_066774 | Ga0466735_066774_5580_6725 | 370 |
| 22 | 3300042606 | Ga0466719_040767 | Ga0466719_040767_217449_218585 | 372 |
| 23 | 3300042621 | Ga0466729_088442 | Ga0466729_088442_25982_27118 | 372 |
| 24 | iso_pr_bacteria | 2599185121 | 2599225210 | 373 |
| 25 | iso_pr_bacteria | 2518645548 | 2518801712 | 374 |
| 26 | iso_pr_bacteria | 3002005847 | 3002006093 | 374 |
| 27 | iso_pr_bacteria | 3002006476 | 3002006724 | 374 |
| 28 | iso_pr_bacteria | 3002007740 | 3002007987 | 374 |
| 29 | iso_pr_bacteria | 3002023256 | 3002023505 | 374 |
| 30 | iso_pr_bacteria | 3002023891 | 3002024138 | 374 |
| 31 | iso_pr_bacteria | 3002024525 | 3002024775 | 374 |
| 32 | iso_pr_bacteria | 3002026852 | 3002027099 | 374 |
| 33 | iso_pr_bacteria | 3002027480 | 3002027732 | 374 |
| 34 | iso_pr_bacteria | 3002029927 | 3002030171 | 374 |
| 35 | iso_pr_bacteria | 3002031185 | 3002031434 | 374 |
| 36 | iso_pr_bacteria | 3002033046 | 3002033294 | 374 |
| 37 | iso_pr_bacteria | 650716011 | 650720162 | 374 |
| 38 | iso_pr_bacteria | 8071415077 | 8071415327 | 374 |
| 39 | iso_pr_bacteria | 3002005207 | 3002005457 | 375 |
| 40 | iso_pr_bacteria | 3002007112 | 3002007359 | 375 |
| 41 | iso_pr_bacteria | 3002022645 | 3002022882 | 375 |
| 42 | iso_pr_bacteria | 646311912 | 646377470 | 375 |
| 43 | 3300005083 | Ga0068305_10000087 | Ga0068305_10000087410 | 376 |
| 44 | 3300042590 | Ga0466690_151275 | Ga0466690_151275_281_1411 | 376 |
| 45 | 3300042599 | Ga0466706_031300 | Ga0466706_031300_161981_163111 | 376 |
| 46 | 3300042599 | Ga0466706_072463 | Ga0466706_072463_1787_2917 | 376 |
| 47 | 3300042599 | Ga0466706_094374 | Ga0466706_094374_1254_2384 | 376 |
| 48 | 3300042601 | Ga0466707_357026 | Ga0466707_357026_1132_2262 | 376 |
| 49 | 3300042602 | Ga0466713_062934 | Ga0466713_062934_6785_7915 | 376 |
| 50 | 3300042616 | Ga0466715_141394 | Ga0466715_141394_12941_14071 | 376 |
| 51 | 3300042616 | Ga0466715_571813 | Ga0466715_571813_1783_2913 | 376 |
| 52 | 3300042618 | Ga0466723_322312 | Ga0466723_322312_8589_9719 | 376 |
| 53 | 3300042619 | Ga0466726_065940 | Ga0466726_065940_51330_52460 | 376 |
| 54 | 3300042619 | Ga0466726_337633 | Ga0466726_337633_2032_3162 | 376 |
| 55 | 3300042619 | Ga0466726_405165 | Ga0466726_405165_2027_3157 | 376 |
| 56 | 3300042620 | Ga0466728_176015 | Ga0466728_176015_1628_2758 | 376 |
| 57 | 3300042636 | Ga0466703_151943 | Ga0466703_151943_13387_14517 | 376 |
| 58 | 3300042636 | Ga0466703_373748 | Ga0466703_373748_43444_44574 | 376 |
| 59 | 3300042655 | Ga0466727_061975 | Ga0466727_061975_243_1373 | 376 |
| 60 | 3300042655 | Ga0466727_219994 | Ga0466727_219994_975_2105 | 376 |
| 61 | iso_pr_bacteria | 2772190894 | 2773439439 | 376 |
| 62 | iso_pr_bacteria | 3001995955 | 3001996179 | 376 |
| 63 | iso_pr_bacteria | 3002004002 | 3002004242 | 376 |
| 64 | iso_pr_bacteria | 3002004631 | 3002004862 | 376 |
| 65 | iso_pr_bacteria | 3002030550 | 3002030799 | 376 |
| 66 | iso_pr_bacteria | 3002032411 | 3002032660 | 376 |
| 67 | 3300002462 | JGI24702J35022_10000633 | JGI24702J35022_100006335 | 377 |
| 68 | 3300005083 | Ga0068305_10000019 | Ga0068305_100000197 | 377 |
| 69 | 3300042590 | Ga0466690_055751 | Ga0466690_055751_116371_117504 | 377 |
| 70 | 3300042603 | Ga0466714_131668 | Ga0466714_131668_1417_2550 | 377 |
| 71 | 3300042603 | Ga0466714_142214 | Ga0466714_142214_334_1467 | 377 |
| 72 | 3300042615 | Ga0466711_258288 | Ga0466711_258288_9642_10775 | 377 |
| 73 | 3300042618 | Ga0466723_141698 | Ga0466723_141698_216103_217236 | 377 |
| 74 | 3300042643 | Ga0466704_063191 | Ga0466704_063191_87191_88324 | 377 |
| 75 | iso_pr_bacteria | 2772190892 | 2773435508 | 377 |
| 76 | iso_pr_bacteria | 3002002099 | 3002002342 | 377 |
| 77 | 3300010167 | Ga0123353_10000123 | Ga0123353_1000012367 | 378 |
| 78 | 3300042601 | Ga0466707_226860 | Ga0466707_226860_11762_12898 | 378 |
| 79 | 3300042605 | Ga0466716_297797 | Ga0466716_297797_1423_2559 | 378 |
| 80 | 3300042612 | Ga0466705_032566 | Ga0466705_032566_1879_3015 | 378 |
| 81 | 3300042612 | Ga0466705_315083 | Ga0466705_315083_10408_11544 | 378 |
| 82 | 3300042615 | Ga0466711_012686 | Ga0466711_012686_15392_16528 | 378 |
| 83 | 3300042615 | Ga0466711_097740 | Ga0466711_097740_298_1434 | 378 |
| 84 | 3300042616 | Ga0466715_058388 | Ga0466715_058388_322_1458 | 378 |
| 85 | 3300042618 | Ga0466723_262020 | Ga0466723_262020_8628_9764 | 378 |
| 86 | 3300042619 | Ga0466726_145651 | Ga0466726_145651_752_1888 | 378 |
| 87 | 3300042619 | Ga0466726_165686 | Ga0466726_165686_1158_2294 | 378 |
| 88 | 3300042619 | Ga0466726_460664 | Ga0466726_460664_12520_13656 | 378 |
| 89 | 3300042620 | Ga0466728_040984 | Ga0466728_040984_23686_24822 | 378 |
| 90 | 3300042643 | Ga0466704_230828 | Ga0466704_230828_4569_5705 | 378 |
| 91 | 3300005071 | Ga0068302_10046259 | Ga0068302_100462592 | 379 |
| 92 | 3300005083 | Ga0068305_10000131 | Ga0068305_1000013161 | 379 |
| 93 | 3300009784 | Ga0123357_10008349 | Ga0123357_100083493 | 379 |
| 94 | 3300010167 | Ga0123353_10576093 | Ga0123353_105760932 | 379 |
| 95 | 3300042609 | Ga0466722_163351 | Ga0466722_163351_233_1372 | 379 |
| 96 | 3300042616 | Ga0466715_627388 | Ga0466715_627388_31390_32529 | 379 |
| 97 | 3300042621 | Ga0466729_198612 | Ga0466729_198612_73104_74243 | 379 |
| 98 | 3300042643 | Ga0466704_037607 | Ga0466704_037607_13415_14554 | 379 |
| 99 | iso_pr_bacteria | 2754412482 | 2755214833 | 379 |
| 100 | 3300042593 | Ga0466691_091893 | Ga0466691_091893_9098_10240 | 380 |
| 101 | 3300042602 | Ga0466713_054647 | Ga0466713_054647_28456_29598 | 380 |
| 102 | 3300042606 | Ga0466719_274100 | Ga0466719_274100_1241_2383 | 380 |
| 103 | 3300042606 | Ga0466719_294508 | Ga0466719_294508_16520_17662 | 380 |
| 104 | 3300042606 | Ga0466719_345713 | Ga0466719_345713_2453_3595 | 380 |
| 105 | 3300042618 | Ga0466723_271557 | Ga0466723_271557_583_1725 | 380 |
| 106 | 3300042620 | Ga0466728_017387 | Ga0466728_017387_8953_10095 | 380 |
| 107 | 3300042620 | Ga0466728_380833 | Ga0466728_380833_33989_35131 | 380 |
| 108 | 3300042655 | Ga0466727_004981 | Ga0466727_004981_14690_15832 | 380 |
| 109 | 3300005083 | Ga0068305_10001537 | Ga0068305_100015378 | 381 |
| 110 | 3300042599 | Ga0466706_032922 | Ga0466706_032922_6706_7851 | 381 |
| 111 | 3300042601 | Ga0466707_213151 | Ga0466707_213151_17066_18211 | 381 |
| 112 | 3300042602 | Ga0466713_051451 | Ga0466713_051451_35018_36163 | 381 |
| 113 | 3300042618 | Ga0466723_090577 | Ga0466723_090577_141_1286 | 381 |
| 114 | 3300042621 | Ga0466729_127141 | Ga0466729_127141_2839_3984 | 381 |
| 115 | 3300042624 | Ga0466735_001236 | Ga0466735_001236_777_1922 | 381 |
| 116 | 3300042624 | Ga0466735_116209 | Ga0466735_116209_567_1712 | 381 |
| 117 | 3300042624 | Ga0466735_153444 | Ga0466735_153444_1489_2634 | 381 |
| 118 | 3300042624 | Ga0466735_226629 | Ga0466735_226629_123_1268 | 381 |
| 119 | iso_pr_bacteria | 2772190889 | 2773432091 | 381 |
| 120 | iso_pr_bacteria | 2772190893 | 2773438153 | 381 |
| 121 | 3300002504 | JGI24705J35276_12238806 | JGI24705J35276_1223880648 | 382 |
| 122 | 3300005083 | Ga0068305_10000168 | Ga0068305_1000016817 | 382 |
| 123 | 3300042590 | Ga0466690_069955 | Ga0466690_069955_2683_3831 | 382 |
| 124 | 3300042590 | Ga0466690_180876 | Ga0466690_180876_10920_12068 | 382 |
| 125 | 3300042599 | Ga0466706_048336 | Ga0466706_048336_21393_22541 | 382 |
| 126 | 3300042606 | Ga0466719_112385 | Ga0466719_112385_8764_9912 | 382 |
| 127 | 3300042616 | Ga0466715_012803 | Ga0466715_012803_29814_30962 | 382 |
| 128 | 3300042620 | Ga0466728_413945 | Ga0466728_413945_15882_17030 | 382 |
| 129 | 3300042624 | Ga0466735_228503 | Ga0466735_228503_1047_2195 | 382 |
| 130 | 3300042643 | Ga0466704_017715 | Ga0466704_017715_41339_42487 | 382 |
| 131 | 3300042648 | Ga0466709_403433 | Ga0466709_403433_7882_9030 | 382 |
| 132 | 3300042652 | Ga0466708_328797 | Ga0466708_328797_287_1435 | 382 |
| 133 | 3300042599 | Ga0466706_155209 | Ga0466706_155209_45419_46570 | 383 |
| 134 | 3300010167 | Ga0123353_10247852 | Ga0123353_102478522 | 386 |
| 135 | 3300042601 | Ga0466707_013650 | Ga0466707_013650_151252_152412 | 386 |
| 136 | 3300042616 | Ga0466715_066605 | Ga0466715_066605_19695_20855 | 386 |
| 137 | 3300042652 | Ga0466708_242671 | Ga0466708_242671_282_1442 | 386 |
| 138 | 3300042602 | Ga0466713_139066 | Ga0466713_139066_107747_108913 | 388 |
| 139 | 3300042624 | Ga0466735_163203 | Ga0466735_163203_24389_25558 | 389 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01702 | TGT | Queuine tRNA-ribosyltransferase | 17 | 374 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.91 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.