Protein Family IF08819
Metagenome
Metatranscriptome
Isolate
149
Members
53
Samples
142
Scaffolds
133.91
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_162610|Ga0466735_162610_442_1005
- Length
- 160 aa
- Sequence
- MNHRSGFNPLEVMAAHRKALHRNMVTSLFRYERIRTTKTKALEIRRSAEKLITRAKVDSVHNRRLVSARLFDEGIVAKLFTDIALRMKDRPGGYTRIIKLGERLGDAADVVILELVDYKLDVEGASDKTAKKSDKRGTASQVAAKGKAVGVKKTAPPAAD
Sample Types
Isolate
4.7%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
3.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Kalotermitidae
27.5%
Unclassified
17.6%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
1
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 23 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 27 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 37 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466716_498137 | 3300042605 | Bacteria | 5355 |
| 2 | Ga0466719_402616 | 3300042606 | Bacteria | 26923 |
| 3 | Ga0466711_200253 | 3300042615 | Bacteria | 11274 |
| 4 | Ga0466726_289616 | 3300042619 | Bacteria | 4402 |
| 5 | Ga0466726_457957 | 3300042619 | Bacteria | 11252 |
| 6 | Ga0466703_002359 | 3300042636 | Bacteria | 7617 |
| 7 | Ga0466704_035661 | 3300042643 | Bacteria | 27042 |
| 8 | Ga0466704_294790 | 3300042643 | Bacteria | 13084 |
| 9 | Ga0123357_10390017 | 3300009784 | Bacteria | 1281 |
| 10 | JGI24695J34938_10000518 | 3300002450 | Bacteria | 37542 |
| 11 | JGI24695J34938_10036449 | 3300002450 | Bacteria | 2242 |
| 12 | Ga0068302_10049062 | 3300005071 | Bacteria | 2117 |
| 13 | Ga0264413_114574 | 3300024493 | Unclassified | 4341 |
| 14 | Ga0466693_427683 | 3300042592 | Bacteria | 1582 |
| 15 | Ga0466691_045559 | 3300042593 | Bacteria | 7374 |
| 16 | Ga0466691_073970 | 3300042593 | Bacteria | 40551 |
| 17 | Ga0466696_107707 | 3300042596 | Bacteria | 5533 |
| 18 | Ga0466699_197147 | 3300042597 | Bacteria | 4769 |
| 19 | Ga0466699_201037 | 3300042597 | Unclassified | 3405 |
| 20 | Ga0466705_029843 | 3300042612 | Bacteria | 27393 |
| 21 | Ga0466722_085955 | 3300042609 | Bacteria | 3413 |
| 22 | Ga0466723_104883 | 3300042618 | Bacteria | 18998 |
| 23 | Ga0466726_159588 | 3300042619 | Bacteria | 1053 |
| 24 | Ga0466704_034875 | 3300042643 | Bacteria | 15695 |
| 25 | Ga0466709_073711 | 3300042648 | Bacteria | 17631 |
| 26 | Ga0466709_078322 | 3300042648 | Bacteria | 34193 |
| 27 | Ga0123357_10125103 | 3300009784 | Bacteria | 3224 |
| 28 | JGI24698J34947_10041880 | 3300002449 | Bacteria | 2356 |
| 29 | JGI24698J34947_10084045 | 3300002449 | Bacteria | 1483 |
| 30 | Ga0222431_1003533 | 3300021190 | Bacteria | 2079 |
| 31 | Ga0466690_178814 | 3300042590 | Bacteria | 4458 |
| 32 | Ga0466699_026019 | 3300042597 | Bacteria | 9557 |
| 33 | Ga0466699_137551 | 3300042597 | Bacteria | 5507 |
| 34 | Ga0466705_326404 | 3300042612 | Bacteria | 1062 |
| 35 | Ga0466707_138884 | 3300042601 | Bacteria | 1309 |
| 36 | Ga0466707_286649 | 3300042601 | Bacteria | 1105 |
| 37 | Ga0466711_352865 | 3300042615 | Bacteria | 9103 |
| 38 | Ga0466723_035562 | 3300042618 | Bacteria | 3258 |
| 39 | Ga0466726_186549 | 3300042619 | Bacteria | 2069 |
| 40 | Ga0466735_156091 | 3300042624 | Bacteria | 5054 |
| 41 | Ga0466703_009860 | 3300042636 | Bacteria | 17878 |
| 42 | Ga0466703_027293 | 3300042636 | Bacteria | 1484 |
| 43 | Ga0466703_095090 | 3300042636 | Bacteria | 24169 |
| 44 | Ga0466703_138929 | 3300042636 | Bacteria | 1150 |
| 45 | Ga0466704_288908 | 3300042643 | Bacteria | 13677 |
| 46 | Ga0466709_365886 | 3300042648 | Bacteria | 2740 |
| 47 | Ga0123356_10003935 | 3300010049 | Bacteria | 15452 |
| 48 | Ga0123356_10041207 | 3300010049 | Unclassified | 4303 |
| 49 | JGI24698J34947_10006934 | 3300002449 | Unclassified | 6229 |
| 50 | JGI24695J34938_10119402 | 3300002450 | Bacteria | 1073 |
| 51 | JGI24702J35022_10070515 | 3300002462 | Bacteria | 1881 |
| 52 | JGI24702J35022_10301804 | 3300002462 | Bacteria | 945 |
| 53 | Ga0068302_10993740 | 3300005071 | Bacteria | 635 |
| 54 | Ga0415639_102711 | 3300038395 | Bacteria | 1583 |
| 55 | Ga0466690_041540 | 3300042590 | Bacteria | 2401 |
| 56 | Ga0466692_086049 | 3300042591 | Bacteria | 21718 |
| 57 | Ga0466699_113216 | 3300042597 | Bacteria | 1748 |
| 58 | Ga0466716_036270 | 3300042605 | Unclassified | 1775 |
| 59 | Ga0466712_091295 | 3300042614 | Bacteria | 7133 |
| 60 | Ga0466715_250091 | 3300042616 | Bacteria | 5888 |
| 61 | Ga0466726_084221 | 3300042619 | Bacteria | 10442 |
| 62 | Ga0466726_302565 | 3300042619 | Bacteria | 2965 |
| 63 | Ga0466729_150137 | 3300042621 | Bacteria | 1119 |
| 64 | Ga0466731_272724 | 3300042622 | Bacteria | 2806 |
| 65 | Ga0466735_162610 | 3300042624 | Bacteria | 2065 |
| 66 | Ga0466735_216580 | 3300042624 | Bacteria | 1531 |
| 67 | Ga0466704_377961 | 3300042643 | Bacteria | 51523 |
| 68 | Ga0466708_164750 | 3300042652 | Bacteria | 41705 |
| 69 | Ga0466727_202595 | 3300042655 | Bacteria | 1203 |
| 70 | Ga0466727_322717 | 3300042655 | Bacteria | 2643 |
| 71 | Ga0123353_10018166 | 3300010167 | Unclassified | 10383 |
| 72 | JGI24705J35276_11857056 | 3300002504 | Bacteria | 720 |
| 73 | Ga0222431_1001001 | 3300021190 | Bacteria | 3354 |
| 74 | Ga0466691_083850 | 3300042593 | Bacteria | 6724 |
| 75 | Ga0466705_012580 | 3300042612 | Bacteria | 25353 |
| 76 | Ga0466706_238398 | 3300042599 | Bacteria | 1838 |
| 77 | Ga0466719_136572 | 3300042606 | Unclassified | 6112 |
| 78 | Ga0466722_084708 | 3300042609 | Bacteria | 3806 |
| 79 | Ga0466711_072851 | 3300042615 | Bacteria | 17942 |
| 80 | Ga0466715_316219 | 3300042616 | Bacteria | 7625 |
| 81 | Ga0466726_435324 | 3300042619 | Unclassified | 1322 |
| 82 | Ga0466735_003442 | 3300042624 | Bacteria | 1726 |
| 83 | Ga0466704_113010 | 3300042643 | Bacteria | 47024 |
| 84 | Ga0466708_363575 | 3300042652 | Bacteria | 19052 |
| 85 | Ga0466708_465053 | 3300042652 | Bacteria | 5681 |
| 86 | Ga0466727_024182 | 3300042655 | Unclassified | 1774 |
| 87 | Ga0466727_180470 | 3300042655 | Bacteria | 10986 |
| 88 | Ga0466727_207404 | 3300042655 | Bacteria | 1171 |
| 89 | Ga0123356_10000406 | 3300010049 | Bacteria | 48995 |
| 90 | JGI24702J35022_10161750 | 3300002462 | Bacteria | 1261 |
| 91 | Ga0466690_094749 | 3300042590 | Bacteria | 4968 |
| 92 | Ga0466696_021961 | 3300042596 | Bacteria | 13686 |
| 93 | Ga0466716_029348 | 3300042605 | Bacteria | 9815 |
| 94 | Ga0466716_106786 | 3300042605 | Bacteria | 35327 |
| 95 | Ga0466698_288036 | 3300042610 | Bacteria | 1166 |
| 96 | Ga0466715_413142 | 3300042616 | Bacteria | 1501 |
| 97 | Ga0466723_172370 | 3300042618 | Bacteria | 14030 |
| 98 | Ga0466728_251502 | 3300042620 | Bacteria | 7049 |
| 99 | Ga0466731_073169 | 3300042622 | Bacteria | 1173 |
| 100 | Ga0466735_213449 | 3300042624 | Bacteria | 1111 |
| 101 | JGI24702J35022_10048299 | 3300002462 | Unclassified | 2266 |
| 102 | Ga0223682_1004105 | 3300021231 | Bacteria | 1155 |
| 103 | Ga0466692_011250 | 3300042591 | Bacteria | 5520 |
| 104 | Ga0466699_113897 | 3300042597 | Bacteria | 2195 |
| 105 | Ga0466719_259540 | 3300042606 | Bacteria | 8873 |
| 106 | Ga0466722_047080 | 3300042609 | Bacteria | 7851 |
| 107 | Ga0466722_168859 | 3300042609 | Bacteria | 8787 |
| 108 | Ga0466718_090128 | 3300042617 | Bacteria | 34206 |
| 109 | Ga0466723_269231 | 3300042618 | Bacteria | 3454 |
| 110 | Ga0466723_285157 | 3300042618 | Bacteria | 2344 |
| 111 | Ga0466726_022405 | 3300042619 | Bacteria | 9232 |
| 112 | Ga0466735_120150 | 3300042624 | Bacteria | 1764 |
| 113 | Ga0466703_340305 | 3300042636 | Bacteria | 4664 |
| 114 | Ga0466704_304583 | 3300042643 | Bacteria | 47429 |
| 115 | Ga0123356_12212374 | 3300010049 | Bacteria | 687 |
| 116 | Ga0123354_10537511 | 3300010882 | Bacteria | 889 |
| 117 | JGI24695J34938_10002247 | 3300002450 | Bacteria | 14945 |
| 118 | JGI24695J34938_10005507 | 3300002450 | Bacteria | 7869 |
| 119 | JGI24702J35022_10032336 | 3300002462 | Bacteria | 2802 |
| 120 | Ga0466690_256958 | 3300042590 | Bacteria | 19473 |
| 121 | Ga0466691_004564 | 3300042593 | Bacteria | 29497 |
| 122 | Ga0466691_098671 | 3300042593 | Bacteria | 24875 |
| 123 | Ga0466694_280113 | 3300042594 | Bacteria | 1221 |
| 124 | Ga0466694_329272 | 3300042594 | Bacteria | 2908 |
| 125 | Ga0466713_115057 | 3300042602 | Bacteria | 32652 |
| 126 | Ga0466716_231978 | 3300042605 | Bacteria | 2369 |
| 127 | Ga0466715_021017 | 3300042616 | Bacteria | 9342 |
| 128 | Ga0466723_074053 | 3300042618 | Bacteria | 35080 |
| 129 | Ga0466728_242965 | 3300042620 | Bacteria | 2637 |
| 130 | Ga0466703_221485 | 3300042636 | Bacteria | 16425 |
| 131 | Ga0466708_273601 | 3300042652 | Bacteria | 1688 |
| 132 | Ga0466727_275317 | 3300042655 | Unclassified | 1082 |
| 133 | Ga0123355_10002359 | 3300009826 | Bacteria | 26671 |
| 134 | Ga0123356_10089987 | 3300010049 | Bacteria | 2921 |
| 135 | Ga0123356_11919891 | 3300010049 | Bacteria | 737 |
| 136 | Ga0123353_10368720 | 3300010167 | Bacteria | 2154 |
| 137 | JGI24698J34947_10131252 | 3300002449 | Unclassified | 1070 |
| 138 | Ga0072941_1029785 | 3300005201 | Bacteria | 7683 |
| 139 | Ga0255786_1008068 | 3300022815 | Bacteria | 2703 |
| 140 | Ga0255786_1022548 | 3300022815 | Bacteria | 522 |
| 141 | Ga0466690_361892 | 3300042590 | Bacteria | 2451 |
| 142 | Ga0466699_008834 | 3300042597 | Archaea | 3542 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002450 | JGI24695J34938_10000518 | JGI24695J34938_1000051828 | 128 |
| 2 | 3300002462 | JGI24702J35022_10048299 | JGI24702J35022_100482991 | 128 |
| 3 | 3300002504 | JGI24705J35276_11857056 | JGI24705J35276_118570562 | 128 |
| 4 | 3300009784 | Ga0123357_10125103 | Ga0123357_101251034 | 128 |
| 5 | 3300009784 | Ga0123357_10390017 | Ga0123357_103900172 | 128 |
| 6 | 3300010049 | Ga0123356_11919891 | Ga0123356_119198912 | 128 |
| 7 | 3300021231 | Ga0223682_1004105 | Ga0223682_10041051 | 128 |
| 8 | 3300022815 | Ga0255786_1008068 | Ga0255786_10080683 | 128 |
| 9 | 3300022815 | Ga0255786_1022548 | Ga0255786_10225481 | 128 |
| 10 | 3300024493 | Ga0264413_114574 | Ga0264413_1145743 | 128 |
| 11 | 3300042590 | Ga0466690_094749 | Ga0466690_094749_4249_4740 | 128 |
| 12 | 3300042593 | Ga0466691_004564 | Ga0466691_004564_21169_21600 | 128 |
| 13 | 3300042596 | Ga0466696_107707 | Ga0466696_107707_3465_3959 | 128 |
| 14 | 3300042597 | Ga0466699_113216 | Ga0466699_113216_787_1194 | 128 |
| 15 | 3300042597 | Ga0466699_113897 | Ga0466699_113897_1727_2161 | 128 |
| 16 | 3300042597 | Ga0466699_197147 | Ga0466699_197147_3224_3688 | 128 |
| 17 | 3300042597 | Ga0466699_201037 | Ga0466699_201037_802_1266 | 128 |
| 18 | 3300042602 | Ga0466713_115057 | Ga0466713_115057_24320_24853 | 128 |
| 19 | 3300042610 | Ga0466698_288036 | Ga0466698_288036_128_562 | 128 |
| 20 | 3300042612 | Ga0466705_029843 | Ga0466705_029843_24900_25364 | 128 |
| 21 | 3300042616 | Ga0466715_250091 | Ga0466715_250091_2716_3180 | 128 |
| 22 | 3300042616 | Ga0466715_316219 | Ga0466715_316219_6565_7071 | 128 |
| 23 | 3300042618 | Ga0466723_035562 | Ga0466723_035562_2254_2769 | 128 |
| 24 | 3300042619 | Ga0466726_022405 | Ga0466726_022405_4596_5015 | 128 |
| 25 | 3300042619 | Ga0466726_159588 | Ga0466726_159588_296_721 | 128 |
| 26 | 3300042619 | Ga0466726_457957 | Ga0466726_457957_8141_8635 | 128 |
| 27 | 3300042643 | Ga0466704_113010 | Ga0466704_113010_3672_4136 | 128 |
| 28 | 3300042652 | Ga0466708_465053 | Ga0466708_465053_592_1062 | 128 |
| 29 | 3300002450 | JGI24695J34938_10005507 | JGI24695J34938_1000550712 | 129 |
| 30 | 3300002450 | JGI24695J34938_10119402 | JGI24695J34938_101194021 | 129 |
| 31 | 3300002462 | JGI24702J35022_10032336 | JGI24702J35022_100323365 | 129 |
| 32 | 3300002462 | JGI24702J35022_10301804 | JGI24702J35022_103018043 | 129 |
| 33 | 3300005201 | Ga0072941_1029785 | Ga0072941_10297858 | 129 |
| 34 | 3300010167 | Ga0123353_10018166 | Ga0123353_1001816610 | 129 |
| 35 | 3300010167 | Ga0123353_10368720 | Ga0123353_103687203 | 129 |
| 36 | 3300010882 | Ga0123354_10537511 | Ga0123354_105375112 | 129 |
| 37 | 3300021190 | Ga0222431_1003533 | Ga0222431_10035333 | 129 |
| 38 | 3300042590 | Ga0466690_256958 | Ga0466690_256958_19058_19447 | 129 |
| 39 | 3300042593 | Ga0466691_045559 | Ga0466691_045559_6222_6644 | 129 |
| 40 | 3300042594 | Ga0466694_280113 | Ga0466694_280113_280_714 | 129 |
| 41 | 3300042601 | Ga0466707_286649 | Ga0466707_286649_429_929 | 129 |
| 42 | 3300042609 | Ga0466722_085955 | Ga0466722_085955_1685_2110 | 129 |
| 43 | 3300042609 | Ga0466722_168859 | Ga0466722_168859_6914_7303 | 129 |
| 44 | 3300042618 | Ga0466723_104883 | Ga0466723_104883_16785_17174 | 129 |
| 45 | 3300042619 | Ga0466726_186549 | Ga0466726_186549_328_771 | 129 |
| 46 | 3300042620 | Ga0466728_242965 | Ga0466728_242965_1767_2255 | 129 |
| 47 | 3300042636 | Ga0466703_340305 | Ga0466703_340305_3279_3767 | 129 |
| 48 | 3300042655 | Ga0466727_180470 | Ga0466727_180470_9427_9921 | 129 |
| 49 | 3300002462 | JGI24702J35022_10070515 | JGI24702J35022_100705152 | 130 |
| 50 | 3300021190 | Ga0222431_1001001 | Ga0222431_10010015 | 130 |
| 51 | 3300042597 | Ga0466699_008834 | Ga0466699_008834_944_1408 | 130 |
| 52 | 3300042597 | Ga0466699_137551 | Ga0466699_137551_3148_3612 | 130 |
| 53 | 3300042612 | Ga0466705_012580 | Ga0466705_012580_22419_22880 | 130 |
| 54 | 3300042617 | Ga0466718_090128 | Ga0466718_090128_3381_3821 | 130 |
| 55 | 3300042618 | Ga0466723_172370 | Ga0466723_172370_11176_11634 | 130 |
| 56 | 3300042619 | Ga0466726_435324 | Ga0466726_435324_832_1296 | 130 |
| 57 | 3300042622 | Ga0466731_272724 | Ga0466731_272724_1237_1665 | 130 |
| 58 | 3300042643 | Ga0466704_034875 | Ga0466704_034875_15069_15566 | 130 |
| 59 | 3300042643 | Ga0466704_304583 | Ga0466704_304583_22073_22534 | 130 |
| 60 | 3300042655 | Ga0466727_275317 | Ga0466727_275317_52_561 | 130 |
| 61 | 3300042655 | Ga0466727_322717 | Ga0466727_322717_2032_2469 | 130 |
| 62 | 3300002449 | JGI24698J34947_10006934 | JGI24698J34947_100069341 | 131 |
| 63 | 3300002449 | JGI24698J34947_10041880 | JGI24698J34947_100418801 | 131 |
| 64 | 3300002449 | JGI24698J34947_10131252 | JGI24698J34947_101312523 | 131 |
| 65 | 3300010049 | Ga0123356_10000406 | Ga0123356_100004066 | 131 |
| 66 | 3300010049 | Ga0123356_10089987 | Ga0123356_100899872 | 131 |
| 67 | 3300010049 | Ga0123356_12212374 | Ga0123356_122123741 | 131 |
| 68 | 3300042590 | Ga0466690_178814 | Ga0466690_178814_2067_2462 | 131 |
| 69 | 3300042591 | Ga0466692_011250 | Ga0466692_011250_2446_2883 | 131 |
| 70 | 3300042593 | Ga0466691_073970 | Ga0466691_073970_28101_28562 | 131 |
| 71 | 3300042593 | Ga0466691_083850 | Ga0466691_083850_80_559 | 131 |
| 72 | 3300042593 | Ga0466691_098671 | Ga0466691_098671_4967_5422 | 131 |
| 73 | 3300042596 | Ga0466696_021961 | Ga0466696_021961_13152_13634 | 131 |
| 74 | 3300042605 | Ga0466716_036270 | Ga0466716_036270_62_541 | 131 |
| 75 | 3300042606 | Ga0466719_259540 | Ga0466719_259540_528_980 | 131 |
| 76 | 3300042609 | Ga0466722_047080 | Ga0466722_047080_3427_3822 | 131 |
| 77 | 3300042615 | Ga0466711_352865 | Ga0466711_352865_5836_6324 | 131 |
| 78 | 3300042620 | Ga0466728_251502 | Ga0466728_251502_2333_2836 | 131 |
| 79 | 3300042621 | Ga0466729_150137 | Ga0466729_150137_75_614 | 131 |
| 80 | 3300042622 | Ga0466731_073169 | Ga0466731_073169_428_907 | 131 |
| 81 | 3300042624 | Ga0466735_213449 | Ga0466735_213449_386_892 | 131 |
| 82 | 3300042636 | Ga0466703_027293 | Ga0466703_027293_947_1444 | 131 |
| 83 | 3300002449 | JGI24698J34947_10084045 | JGI24698J34947_100840451 | 132 |
| 84 | 3300009826 | Ga0123355_10002359 | Ga0123355_1000235926 | 132 |
| 85 | 3300038395 | Ga0415639_102711 | Ga0415639_102711_1160_1558 | 132 |
| 86 | 3300042592 | Ga0466693_427683 | Ga0466693_427683_588_1022 | 132 |
| 87 | 3300042599 | Ga0466706_238398 | Ga0466706_238398_168_608 | 132 |
| 88 | 3300042615 | Ga0466711_200253 | Ga0466711_200253_175_573 | 132 |
| 89 | 3300042616 | Ga0466715_021017 | Ga0466715_021017_8579_9040 | 132 |
| 90 | 3300042616 | Ga0466715_413142 | Ga0466715_413142_54_557 | 132 |
| 91 | 3300010049 | Ga0123356_10003935 | Ga0123356_1000393515 | 133 |
| 92 | 3300042590 | Ga0466690_361892 | Ga0466690_361892_1941_2411 | 133 |
| 93 | 3300042594 | Ga0466694_329272 | Ga0466694_329272_348_776 | 133 |
| 94 | 3300042606 | Ga0466719_402616 | Ga0466719_402616_6242_6703 | 133 |
| 95 | 3300042612 | Ga0466705_326404 | Ga0466705_326404_93_578 | 133 |
| 96 | 3300042619 | Ga0466726_084221 | Ga0466726_084221_8979_9380 | 133 |
| 97 | 3300042636 | Ga0466703_009860 | Ga0466703_009860_16585_17043 | 133 |
| 98 | 3300042648 | Ga0466709_073711 | Ga0466709_073711_13445_13918 | 133 |
| 99 | 3300042648 | Ga0466709_365886 | Ga0466709_365886_2251_2715 | 133 |
| 100 | 3300002450 | JGI24695J34938_10036449 | JGI24695J34938_100364492 | 134 |
| 101 | 3300042624 | Ga0466735_216580 | Ga0466735_216580_337_876 | 134 |
| 102 | 3300042636 | Ga0466703_221485 | Ga0466703_221485_11654_12115 | 134 |
| 103 | 3300042643 | Ga0466704_035661 | Ga0466704_035661_9314_9811 | 134 |
| 104 | 3300042643 | Ga0466704_377961 | Ga0466704_377961_6683_7156 | 134 |
| 105 | 3300005071 | Ga0068302_10049062 | Ga0068302_100490623 | 135 |
| 106 | 3300005071 | Ga0068302_10993740 | Ga0068302_109937401 | 135 |
| 107 | 3300010049 | Ga0123356_10041207 | Ga0123356_100412074 | 135 |
| 108 | 3300042597 | Ga0466699_026019 | Ga0466699_026019_6074_6481 | 135 |
| 109 | 3300042636 | Ga0466703_138929 | Ga0466703_138929_545_1048 | 135 |
| 110 | 3300042652 | Ga0466708_363575 | Ga0466708_363575_17937_18344 | 135 |
| 111 | 3300042648 | Ga0466709_078322 | Ga0466709_078322_19007_19510 | 136 |
| 112 | 3300042655 | Ga0466727_207404 | Ga0466727_207404_665_1156 | 136 |
| 113 | 3300042591 | Ga0466692_086049 | Ga0466692_086049_16009_16443 | 137 |
| 114 | 3300042614 | Ga0466712_091295 | Ga0466712_091295_2124_2537 | 137 |
| 115 | 3300042618 | Ga0466723_285157 | Ga0466723_285157_322_810 | 137 |
| 116 | 3300042605 | Ga0466716_231978 | Ga0466716_231978_191_694 | 138 |
| 117 | 3300042605 | Ga0466716_498137 | Ga0466716_498137_338_754 | 138 |
| 118 | 3300042609 | Ga0466722_084708 | Ga0466722_084708_1340_1756 | 138 |
| 119 | 3300042619 | Ga0466726_289616 | Ga0466726_289616_28_444 | 138 |
| 120 | 3300042636 | Ga0466703_002359 | Ga0466703_002359_3762_4301 | 138 |
| 121 | 3300042655 | Ga0466727_024182 | Ga0466727_024182_944_1360 | 138 |
| 122 | 3300002462 | JGI24702J35022_10161750 | JGI24702J35022_101617502 | 139 |
| 123 | 3300042605 | Ga0466716_106786 | Ga0466716_106786_31710_32183 | 139 |
| 124 | 3300042636 | Ga0466703_095090 | Ga0466703_095090_20111_20530 | 139 |
| 125 | 3300042643 | Ga0466704_288908 | Ga0466704_288908_6273_6692 | 139 |
| 126 | iso_pr_bacteria | 2819994798 | 2819998097 | 139 |
| 127 | 3300042606 | Ga0466719_136572 | Ga0466719_136572_3470_4006 | 142 |
| 128 | 3300042618 | Ga0466723_074053 | Ga0466723_074053_33678_34139 | 142 |
| 129 | 3300042624 | Ga0466735_120150 | Ga0466735_120150_788_1216 | 142 |
| 130 | 3300042652 | Ga0466708_273601 | Ga0466708_273601_270_755 | 142 |
| 131 | 3300002450 | JGI24695J34938_10002247 | JGI24695J34938_1000224723 | 143 |
| 132 | 3300042590 | Ga0466690_041540 | Ga0466690_041540_820_1362 | 143 |
| 133 | 3300042601 | Ga0466707_138884 | Ga0466707_138884_259_798 | 143 |
| 134 | 3300042624 | Ga0466735_003442 | Ga0466735_003442_627_1130 | 144 |
| 135 | 3300042652 | Ga0466708_164750 | Ga0466708_164750_36426_36914 | 144 |
| 136 | 3300042615 | Ga0466711_072851 | Ga0466711_072851_8748_9188 | 146 |
| 137 | 3300042619 | Ga0466726_302565 | Ga0466726_302565_1496_1936 | 146 |
| 138 | iso_pr_bacteria | 2781125635 | 2781278717 | 146 |
| 139 | iso_pr_bacteria | 2781125645 | 2781297762 | 146 |
| 140 | iso_pr_bacteria | 2781125639 | 2781285226 | 147 |
| 141 | 3300042618 | Ga0466723_269231 | Ga0466723_269231_2660_3163 | 149 |
| 142 | 3300042643 | Ga0466704_294790 | Ga0466704_294790_11768_12301 | 149 |
| 143 | 3300042655 | Ga0466727_202595 | Ga0466727_202595_678_1127 | 149 |
| 144 | 3300042605 | Ga0466716_029348 | Ga0466716_029348_379_864 | 150 |
| 145 | iso_pr_bacteria | 2781125685 | 2781417588 | 151 |
| 146 | 3300042624 | Ga0466735_156091 | Ga0466735_156091_1672_2178 | 152 |
| 147 | iso_pr_bacteria | 2781125658 | 2781324678 | 153 |
| 148 | 3300042624 | Ga0466735_162610 | Ga0466735_162610_442_1005 | 160 |
| 149 | iso_pr_bacteria | 650716102 | 650883192 | 179 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01196 | Ribosomal_L17 | Ribosomal protein L17 | 21 | 116 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.67 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.