Protein Family IF08816

Metagenome Isolate
139 Members
55 Samples
125 Scaffolds
372.99 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_152527|Ga0466735_152527_138_1343
Length
401 aa
Sequence
MMNKENQTDKASIAESCTVHPAPCTQKMTLFDVYPRWEIEPVRAQGCKIYDKNGTEYLDFYGGHAVISIGHSHPVYVEKIADQLNKMGFYSNSVHLPLQKEYAEKLGEASGYPDYSLFMVNSGAEANENALKLASFHTRRKKIVAFQHSFHGRTSAAVRVTDNQKYWAEINRGLEVIFLPLNDISAVEAELRNEDVSSVIIEGIQGIGGIVLPDTEFLQQLRKICNETGTVLIVDEIQSGYGRSGKFFAHQYAGIRPDIITIAKGMGNGFPISGVLIAPCFKAVYGELGTTFGGNQLACAAAIAVLEVIEKEKLIENAAFIGEYLMTELKKFPQIKEVRGRGLMIGVELVEPIKTVRDRLLFEEKVFTGATGTNVFRLLPPLCIDKEIADEFLKRFNKVLI

📊 Sample Types

Isolate 10.1%
Metagenome 89.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 25.9%
Termitidae 25.9%
Unclassified 16.7%
Rhinotermitidae 9.3%
Termopsidae 5.6%
Cicadellidae 5.6%
Blattidae 3.7%
Passalidae 3.7%
Hodotermitidae 1.9%
Aphrophoridae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 139
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
15 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 646564518 Candidatus Sulcia muelleri DMIN (unscreened) Isolate Cicadellidae
20 648028014 Candidatus Sulcia muelleri CARI Isolate Unclassified
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
26 2510917001 Candidatus Sulcia muelleri PSPU Isolate Aphrophoridae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
30 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
33 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
36 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
39 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 641228484 Candidatus Sulcia muelleri GWSS Isolate Cicadellidae
43 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
47 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
48 2599185120 Candidatus Sulcia muelleri BGSS Isolate Cicadellidae
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
51 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
52 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10000120 3300010167 Bacteria 93172
2 JGI24699J35502_11133056 3300002509 Bacteria 8477
3 Ga0068305_10145676 3300005083 Bacteria 6541
4 Ga0466733_185790 3300042659 Bacteria 1948
5 Ga0466703_352062 3300042636 Bacteria 6366
6 Ga0466704_240268 3300042643 Bacteria 23081
7 Ga0466704_420299 3300042643 Bacteria 6746
8 Ga0466727_291136 3300042655 Bacteria 1701
9 Ga0466701_075975 3300042598 Bacteria 4602
10 Ga0466706_221922 3300042599 Bacteria 5579
11 Ga0466700_075052 3300042600 Bacteria 2331
12 Ga0466711_020634 3300042615 Bacteria 5999
13 Ga0466726_335433 3300042619 Bacteria 14652
14 Ga0123357_10198503 3300009784 Bacteria 2290
15 Ga0123354_10026653 3300010882 Bacteria 9117
16 Ga0466697_239906 3300042611 Bacteria 2495
17 Ga0466705_119612 3300042612 Bacteria 8501
18 Ga0466705_342724 3300042612 Bacteria 3380
19 Ga0466735_232354 3300042624 Bacteria 2090
20 Ga0466703_298904 3300042636 Bacteria 1960
21 Ga0466709_369346 3300042648 Bacteria 6674
22 Ga0456237_0000027 3300041968 Bacteria 23204
23 Ga0466690_001962 3300042590 Bacteria 30858
24 Ga0466696_368481 3300042596 Bacteria 12350
25 Ga0466701_031869 3300042598 Bacteria 13359
26 Ga0466707_136298 3300042601 Bacteria 30628
27 Ga0466713_019367 3300042602 Bacteria 104354
28 Ga0466711_195085 3300042615 Bacteria 4101
29 Ga0466723_319751 3300042618 Bacteria 5938
30 Ga0123354_10001008 3300010882 Bacteria 32139
31 IMNBL1DRAFT_c0009341 3300000062 Bacteria 4850
32 JGI24702J35022_10005021 3300002462 Bacteria 7802
33 Ga0466732_075997 3300042656 Bacteria 1817
34 Ga0466729_310046 3300042621 Bacteria 8330
35 Ga0466735_235440 3300042624 Bacteria 2395
36 Ga0466703_310068 3300042636 Bacteria 1899
37 Ga0466703_428201 3300042636 Bacteria 2190
38 Ga0466709_319669 3300042648 Bacteria 3263
39 Ga0466657_241523 3300042582 Bacteria 10338
40 Ga0466690_013306 3300042590 Bacteria 11978
41 Ga0466692_165133 3300042591 Bacteria 3690
42 Ga0466692_201001 3300042591 Bacteria 5497
43 Ga0466696_220572 3300042596 Bacteria 15855
44 Ga0466713_029678 3300042602 Bacteria 23702
45 Ga0466714_147502 3300042603 Bacteria 2888
46 Ga0466722_124502 3300042609 Bacteria 7370
47 Ga0466698_011393 3300042610 Bacteria 1942
48 Ga0466698_361029 3300042610 Bacteria 2758
49 2227136350 2225789004 Bacteria 37050
50 IMNBL1DRAFT_c0004745 3300000062 Bacteria 8037
51 Ga0466697_175217 3300042611 Bacteria 24944
52 Ga0466735_112058 3300042624 Bacteria 1368
53 Ga0466735_152527 3300042624 Bacteria 1510
54 Ga0466704_045551 3300042643 Bacteria 5654
55 Ga0466690_270040 3300042590 Bacteria 15988
56 Ga0466707_106659 3300042601 Bacteria 13259
57 Ga0466713_067621 3300042602 Bacteria 3398
58 Ga0466713_106242 3300042602 Bacteria 4837
59 Ga0466723_079433 3300042618 Bacteria 22184
60 Ga0466735_183693 3300042624 Bacteria 4084
61 Ga0466703_422052 3300042636 Bacteria 8727
62 Ga0466696_420377 3300042596 Bacteria 3798
63 Ga0466707_126179 3300042601 Bacteria 55735
64 Ga0466713_064102 3300042602 Bacteria 4270
65 Ga0466716_402587 3300042605 Bacteria 1471
66 Ga0466719_504364 3300042606 Bacteria 6374
67 Ga0466697_029961 3300042611 Bacteria 1902
68 Ga0466715_183631 3300042616 Bacteria 24353
69 Ga0466715_336357 3300042616 Bacteria 2985
70 Ga0466729_190447 3300042621 Bacteria 1752
71 JGI24699J35502_11123346 3300002509 Bacteria 3535
72 Ga0466733_162571 3300042659 Bacteria 74751
73 Ga0466704_021339 3300042643 Bacteria 5052
74 Ga0466704_427418 3300042643 Bacteria 18170
75 Ga0466727_319003 3300042655 Bacteria 50861
76 Ga0466696_418686 3300042596 Bacteria 4642
77 Ga0466706_250316 3300042599 Bacteria 1994
78 Ga0466700_075704 3300042600 Bacteria 26374
79 Ga0466700_410010 3300042600 Bacteria 5204
80 Ga0466713_083344 3300042602 Bacteria 8774
81 Ga0466716_293878 3300042605 Bacteria 4563
82 Ga0466719_313295 3300042606 Bacteria 15821
83 Ga0466719_564315 3300042606 Bacteria 3907
84 Ga0466722_139992 3300042609 Bacteria 10006
85 Ga0466722_252821 3300042609 Bacteria 235840
86 Ga0466710_079452 3300042613 Bacteria 1492
87 Ga0466715_130115 3300042616 Bacteria 7059
88 Ga0466715_624320 3300042616 Bacteria 13305
89 Ga0123357_10006387 3300009784 Bacteria 14365
90 Ga0123357_10053660 3300009784 Bacteria 5438
91 Ga0123357_10185717 3300009784 Bacteria 2412
92 JGI24699J35502_11134000 3300002509 Bacteria 23716
93 Ga0466735_223575 3300042624 Bacteria 1614
94 Ga0466703_407242 3300042636 Bacteria 29081
95 Ga0466704_169353 3300042643 Bacteria 4817
96 Ga0466708_118827 3300042652 Bacteria 5097
97 Ga0466690_064068 3300042590 Bacteria 10754
98 Ga0466690_148225 3300042590 Bacteria 15696
99 Ga0466692_066865 3300042591 Bacteria 168349
100 Ga0466692_201593 3300042591 Bacteria 1301
101 Ga0466691_036539 3300042593 Bacteria 23739
102 Ga0466706_125352 3300042599 Bacteria 4752
103 Ga0466706_186023 3300042599 Bacteria 49026
104 Ga0466707_000450 3300042601 Bacteria 21294
105 Ga0466713_112493 3300042602 Bacteria 23866
106 Ga0466716_208614 3300042605 Bacteria 18687
107 Ga0466719_189062 3300042606 Bacteria 1551
108 Ga0466711_392107 3300042615 Bacteria 21134
109 Ga0466715_159807 3300042616 Bacteria 19701
110 Ga0466723_127060 3300042618 Bacteria 8635
111 Ga0466723_223232 3300042618 Bacteria 20243
112 Ga0123353_10554379 3300010167 Bacteria 1657
113 JGI24699J35502_11134231 3300002509 Bacteria 105586
114 Ga0123357_10000568 3300009784 Bacteria 36446
115 Ga0466703_089142 3300042636 Bacteria 4900
116 Ga0466704_058431 3300042643 Bacteria 15073
117 Ga0466704_479698 3300042643 Bacteria 22962
118 Ga0466692_009647 3300042591 Bacteria 10786
119 Ga0466706_186966 3300042599 Bacteria 1631
120 Ga0466707_414182 3300042601 Bacteria 1303
121 Ga0466716_100953 3300042605 Bacteria 18314
122 Ga0466722_003387 3300042609 Bacteria 27001
123 Ga0466715_285451 3300042616 Bacteria 1878
124 Ga0466726_218744 3300042619 Bacteria 7727
125 Ga0466728_087812 3300042620 Bacteria 65534

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_112058 Ga0466735_112058_235_1206 323
2 3300042624 Ga0466735_223575 Ga0466735_223575_336_1307 323
3 3300042591 Ga0466692_009647 Ga0466692_009647_3889_4872 327
4 3300042601 Ga0466707_414182 Ga0466707_414182_17_1003 328
5 2225789004 2227136350 2227535802 349
6 3300042615 Ga0466711_195085 Ga0466711_195085_16_1095 359
7 3300042618 Ga0466723_319751 Ga0466723_319751_4071_5189 360
8 3300042655 Ga0466727_291136 Ga0466727_291136_153_1292 360
9 3300042602 Ga0466713_083344 Ga0466713_083344_3807_4931 361
10 3300042582 Ga0466657_241523 Ga0466657_241523_2132_3262 362
11 3300042620 Ga0466728_087812 Ga0466728_087812_7896_9014 362
12 3300042611 Ga0466697_175217 Ga0466697_175217_15160_16293 363
13 3300042643 Ga0466704_427418 Ga0466704_427418_5629_6753 366
14 3300042599 Ga0466706_186966 Ga0466706_186966_358_1479 367
15 3300042606 Ga0466719_189062 Ga0466719_189062_154_1266 370
16 3300042590 Ga0466690_013306 Ga0466690_013306_5377_6495 372
17 3300042596 Ga0466696_368481 Ga0466696_368481_9713_10831 372
18 3300042602 Ga0466713_067621 Ga0466713_067621_960_2078 372
19 3300042605 Ga0466716_293878 Ga0466716_293878_1205_2323 372
20 3300042618 Ga0466723_127060 Ga0466723_127060_3697_4815 372
21 3300042636 Ga0466703_407242 Ga0466703_407242_9950_11068 372
22 3300042591 Ga0466692_165133 Ga0466692_165133_2059_3180 373
23 3300042591 Ga0466692_201001 Ga0466692_201001_3744_4865 373
24 3300042596 Ga0466696_418686 Ga0466696_418686_1325_2446 373
25 3300042599 Ga0466706_221922 Ga0466706_221922_2402_3523 373
26 3300042599 Ga0466706_250316 Ga0466706_250316_846_1967 373
27 3300042600 Ga0466700_075052 Ga0466700_075052_1029_2150 373
28 3300042600 Ga0466700_075704 Ga0466700_075704_1263_2384 373
29 3300042601 Ga0466707_106659 Ga0466707_106659_8765_9886 373
30 3300042602 Ga0466713_106242 Ga0466713_106242_2093_3214 373
31 3300042609 Ga0466722_124502 Ga0466722_124502_4171_5292 373
32 3300042609 Ga0466722_139992 Ga0466722_139992_8579_9700 373
33 3300042610 Ga0466698_011393 Ga0466698_011393_766_1887 373
34 3300042610 Ga0466698_361029 Ga0466698_361029_249_1370 373
35 3300042611 Ga0466697_029961 Ga0466697_029961_97_1218 373
36 3300042615 Ga0466711_392107 Ga0466711_392107_11523_12644 373
37 3300042621 Ga0466729_190447 Ga0466729_190447_67_1188 373
38 3300042624 Ga0466735_232354 Ga0466735_232354_323_1444 373
39 3300042636 Ga0466703_089142 Ga0466703_089142_1183_2304 373
40 3300042636 Ga0466703_310068 Ga0466703_310068_141_1262 373
41 3300042636 Ga0466703_352062 Ga0466703_352062_3278_4399 373
42 iso_pr_bacteria 2609459943 2610742673 373
43 iso_pr_bacteria 2695420931 2698110332 373
44 iso_pr_bacteria 2820762746 2820765127 373
45 iso_pr_bacteria 2830041218 2830044739 373
46 3300000062 IMNBL1DRAFT_c0004745 IMNBL1DRAFT_00047452 374
47 3300000062 IMNBL1DRAFT_c0009341 IMNBL1DRAFT_00093413 374
48 3300002462 JGI24702J35022_10005021 JGI24702J35022_100050215 374
49 3300002509 JGI24699J35502_11123346 JGI24699J35502_111233462 374
50 3300002509 JGI24699J35502_11133056 JGI24699J35502_111330565 374
51 3300002509 JGI24699J35502_11134231 JGI24699J35502_1113423124 374
52 3300009784 Ga0123357_10000568 Ga0123357_100005685 374
53 3300009784 Ga0123357_10006387 Ga0123357_1000638715 374
54 3300009784 Ga0123357_10053660 Ga0123357_100536602 374
55 3300009784 Ga0123357_10198503 Ga0123357_101985031 374
56 3300010882 Ga0123354_10001008 Ga0123354_100010087 374
57 3300042590 Ga0466690_148225 Ga0466690_148225_8233_9357 374
58 3300042598 Ga0466701_075975 Ga0466701_075975_3367_4491 374
59 3300042599 Ga0466706_125352 Ga0466706_125352_1610_2734 374
60 3300042599 Ga0466706_186023 Ga0466706_186023_18022_19146 374
61 3300042600 Ga0466700_410010 Ga0466700_410010_3013_4137 374
62 3300042601 Ga0466707_000450 Ga0466707_000450_4327_5451 374
63 3300042602 Ga0466713_064102 Ga0466713_064102_1532_2656 374
64 3300042606 Ga0466719_564315 Ga0466719_564315_1048_2172 374
65 3300042611 Ga0466697_239906 Ga0466697_239906_1099_2223 374
66 3300042613 Ga0466710_079452 Ga0466710_079452_308_1432 374
67 3300042616 Ga0466715_183631 Ga0466715_183631_8281_9405 374
68 3300042616 Ga0466715_624320 Ga0466715_624320_2944_4068 374
69 3300042619 Ga0466726_218744 Ga0466726_218744_4916_6040 374
70 3300042624 Ga0466735_235440 Ga0466735_235440_568_1692 374
71 3300042636 Ga0466703_422052 Ga0466703_422052_3355_4479 374
72 3300042636 Ga0466703_428201 Ga0466703_428201_733_1857 374
73 3300042643 Ga0466704_021339 Ga0466704_021339_1943_3067 374
74 3300042643 Ga0466704_479698 Ga0466704_479698_8601_9725 374
75 3300042648 Ga0466709_369346 Ga0466709_369346_1604_2728 374
76 3300042655 Ga0466727_319003 Ga0466727_319003_23614_24738 374
77 iso_pr_bacteria 2910930387 2910930942 374
78 3300009784 Ga0123357_10185717 Ga0123357_101857172 375
79 3300041968 Ga0456237_0000027 Ga0456237_0000027_6237_7364 375
80 3300042590 Ga0466690_001962 Ga0466690_001962_15687_16814 375
81 3300042590 Ga0466690_270040 Ga0466690_270040_6065_7192 375
82 3300042591 Ga0466692_066865 Ga0466692_066865_10601_11728 375
83 3300042596 Ga0466696_420377 Ga0466696_420377_2383_3510 375
84 3300042602 Ga0466713_019367 Ga0466713_019367_96409_97536 375
85 3300042602 Ga0466713_029678 Ga0466713_029678_14535_15662 375
86 3300042602 Ga0466713_112493 Ga0466713_112493_14279_15406 375
87 3300042606 Ga0466719_313295 Ga0466719_313295_1435_2562 375
88 3300042606 Ga0466719_504364 Ga0466719_504364_4564_5691 375
89 3300042609 Ga0466722_252821 Ga0466722_252821_172064_173191 375
90 3300042612 Ga0466705_119612 Ga0466705_119612_130_1257 375
91 3300042612 Ga0466705_342724 Ga0466705_342724_1539_2666 375
92 3300042615 Ga0466711_020634 Ga0466711_020634_441_1568 375
93 3300042616 Ga0466715_159807 Ga0466715_159807_17046_18173 375
94 3300042618 Ga0466723_223232 Ga0466723_223232_16270_17397 375
95 3300042621 Ga0466729_310046 Ga0466729_310046_1158_2285 375
96 3300042636 Ga0466703_298904 Ga0466703_298904_417_1544 375
97 3300042643 Ga0466704_045551 Ga0466704_045551_3516_4643 375
98 3300042643 Ga0466704_240268 Ga0466704_240268_4496_5623 375
99 3300042643 Ga0466704_420299 Ga0466704_420299_1582_2709 375
100 3300042656 Ga0466732_075997 Ga0466732_075997_414_1541 375
101 3300042659 Ga0466733_185790 Ga0466733_185790_505_1632 375
102 iso_pr_bacteria 2820759988 2820761388 375
103 iso_pr_bacteria 2940216256 2940217815 375
104 iso_pr_bacteria 643348524 643422973 375
105 3300002509 JGI24699J35502_11134000 JGI24699J35502_111340008 376
106 3300005083 Ga0068305_10145676 Ga0068305_101456766 376
107 3300042590 Ga0466690_064068 Ga0466690_064068_5107_6237 376
108 3300042591 Ga0466692_201593 Ga0466692_201593_25_1155 376
109 3300042605 Ga0466716_100953 Ga0466716_100953_12461_13591 376
110 3300042605 Ga0466716_208614 Ga0466716_208614_17417_18547 376
111 3300042616 Ga0466715_336357 Ga0466715_336357_395_1525 376
112 3300042619 Ga0466726_335433 Ga0466726_335433_9876_11006 376
113 3300042652 Ga0466708_118827 Ga0466708_118827_3662_4792 376
114 3300010882 Ga0123354_10026653 Ga0123354_100266534 377
115 3300042596 Ga0466696_220572 Ga0466696_220572_5408_6541 377
116 3300042609 Ga0466722_003387 Ga0466722_003387_12752_13885 377
117 3300042624 Ga0466735_183693 Ga0466735_183693_2674_3807 377
118 3300042659 Ga0466733_162571 Ga0466733_162571_67536_68669 377
119 3300042598 Ga0466701_031869 Ga0466701_031869_8565_9701 378
120 3300042601 Ga0466707_126179 Ga0466707_126179_48686_49822 378
121 iso_pr_bacteria 2718218155 2720330074 378
122 3300010167 Ga0123353_10554379 Ga0123353_105543792 379
123 3300042603 Ga0466714_147502 Ga0466714_147502_1540_2679 379
124 3300042605 Ga0466716_402587 Ga0466716_402587_30_1169 379
125 3300042618 Ga0466723_079433 Ga0466723_079433_8628_9767 379
126 3300042616 Ga0466715_130115 Ga0466715_130115_5355_6497 380
127 3300042616 Ga0466715_285451 Ga0466715_285451_174_1316 380
128 3300042643 Ga0466704_058431 Ga0466704_058431_11820_12962 380
129 3300042643 Ga0466704_169353 Ga0466704_169353_1688_2830 380
130 iso_pr_bacteria 2510917001 2510921507 381
131 iso_pr_bacteria 2599185120 2599224923 381
132 iso_pr_bacteria 641228484 641331653 381
133 iso_pr_bacteria 646564518 646708206 381
134 iso_pr_bacteria 648028014 648180177 381
135 3300010167 Ga0123353_10000120 Ga0123353_1000012036 384
136 3300042648 Ga0466709_319669 Ga0466709_319669_534_1691 385
137 3300042601 Ga0466707_136298 Ga0466707_136298_13657_14847 386
138 3300042593 Ga0466691_036539 Ga0466691_036539_17359_18528 389
139 3300042624 Ga0466735_152527 Ga0466735_152527_138_1343 401

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00202 Aminotran_3 Aminotransferase class-III 39 400 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.95 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.