Protein Family IF08796
Metagenome
Isolate
115
Members
41
Samples
111
Scaffolds
202.37
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_118009|Ga0466735_118009_783_1463
- Length
- 226 aa
- Sequence
- MAYFSVPFSLAPTRFLWYDFFGWKNMRIVCLDLEGVLIPEIWIAFSEAAGIPELSRTTRDEPDYDKLMKFRLDLLDKHRLKLPDIQKVIGTMDPLPGAVEFTRTLRERTQLIILSDTFEQFAKPMMAKLGYPTLFCNSLEVSPEGTITGYKLRQQDGKKHAVAAFKSINLEVFAAGDSFNDLKMIREADDGCLFRAPESIRESCRDIVCVDSYGDFLGLINSFLTR
Sample Types
Isolate
3.5%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.0%
Kalotermitidae
32.5%
Unclassified
15.0%
Termopsidae
7.5%
Rhinotermitidae
7.5%
Hodotermitidae
2.5%
Taxonomy
Archaea
1
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 6 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 7 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 8 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 24 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_052771 | 3300042636 | Bacteria | 22250 |
| 2 | Ga0466703_292012 | 3300042636 | Bacteria | 42783 |
| 3 | Ga0466708_032209 | 3300042652 | Bacteria | 2556 |
| 4 | Ga0466692_164862 | 3300042591 | Bacteria | 4011 |
| 5 | Ga0466694_296235 | 3300042594 | Unclassified | 4692 |
| 6 | Ga0466699_093271 | 3300042597 | Bacteria | 2287 |
| 7 | Ga0123357_10447592 | 3300009784 | Bacteria | 1124 |
| 8 | Ga0466723_088658 | 3300042618 | Bacteria | 3515 |
| 9 | Ga0466726_005935 | 3300042619 | Bacteria | 2318 |
| 10 | Ga0466726_032777 | 3300042619 | Bacteria | 1306 |
| 11 | Ga0466729_027978 | 3300042621 | Bacteria | 4992 |
| 12 | Ga0466707_306763 | 3300042601 | Bacteria | 1779 |
| 13 | Ga0466722_081306 | 3300042609 | Bacteria | 24127 |
| 14 | Ga0466722_214590 | 3300042609 | Bacteria | 4618 |
| 15 | JGI24696J40584_12909933 | 3300002834 | Bacteria | 1247 |
| 16 | Ga0466705_275492 | 3300042612 | Bacteria | 2688 |
| 17 | Ga0466704_323682 | 3300042643 | Bacteria | 13166 |
| 18 | Ga0466692_112403 | 3300042591 | Bacteria | 13507 |
| 19 | Ga0466712_001829 | 3300042614 | Bacteria | 11966 |
| 20 | Ga0466718_017191 | 3300042617 | Bacteria | 1702 |
| 21 | Ga0466726_375405 | 3300042619 | Bacteria | 2243 |
| 22 | Ga0466719_302063 | 3300042606 | Bacteria | 7382 |
| 23 | Ga0466735_033212 | 3300042624 | Bacteria | 1349 |
| 24 | Ga0466703_200075 | 3300042636 | Bacteria | 12419 |
| 25 | Ga0466703_262941 | 3300042636 | Bacteria | 2236 |
| 26 | Ga0466704_048208 | 3300042643 | Bacteria | 10251 |
| 27 | Ga0466708_047561 | 3300042652 | Bacteria | 4468 |
| 28 | Ga0466708_282849 | 3300042652 | Bacteria | 16850 |
| 29 | Ga0466727_202826 | 3300042655 | Bacteria | 21540 |
| 30 | Ga0466692_072568 | 3300042591 | Bacteria | 10468 |
| 31 | Ga0466696_023451 | 3300042596 | Bacteria | 2941 |
| 32 | Ga0123353_10654047 | 3300010167 | Bacteria | 1487 |
| 33 | Ga0466711_164872 | 3300042615 | Bacteria | 5415 |
| 34 | Ga0466715_024285 | 3300042616 | Bacteria | 7771 |
| 35 | Ga0466726_365405 | 3300042619 | Bacteria | 2444 |
| 36 | Ga0466728_348138 | 3300042620 | Unclassified | 1113 |
| 37 | Ga0466719_081718 | 3300042606 | Bacteria | 13673 |
| 38 | Ga0466719_108774 | 3300042606 | Bacteria | 1645 |
| 39 | JGI24698J34947_10195298 | 3300002449 | Bacteria | 797 |
| 40 | JGI24695J34938_10094115 | 3300002450 | Archaea | 1228 |
| 41 | Ga0072941_1001253 | 3300005201 | Bacteria | 34161 |
| 42 | Ga0466735_001920 | 3300042624 | Bacteria | 1888 |
| 43 | Ga0466704_244245 | 3300042643 | Bacteria | 24869 |
| 44 | Ga0466691_054001 | 3300042593 | Bacteria | 1542 |
| 45 | Ga0466691_099375 | 3300042593 | Bacteria | 6432 |
| 46 | Ga0466691_218708 | 3300042593 | Bacteria | 10287 |
| 47 | Ga0466696_109177 | 3300042596 | Bacteria | 3101 |
| 48 | Ga0466718_159473 | 3300042617 | Bacteria | 3395 |
| 49 | Ga0466726_148550 | 3300042619 | Bacteria | 5458 |
| 50 | Ga0466726_347799 | 3300042619 | Bacteria | 1669 |
| 51 | Ga0466719_496954 | 3300042606 | Bacteria | 11759 |
| 52 | Ga0072941_1005413 | 3300005201 | Bacteria | 10120 |
| 53 | Ga0466705_049245 | 3300042612 | Bacteria | 9138 |
| 54 | Ga0466705_229558 | 3300042612 | Bacteria | 6270 |
| 55 | Ga0466731_032952 | 3300042622 | Bacteria | 1229 |
| 56 | Ga0466703_331235 | 3300042636 | Bacteria | 8212 |
| 57 | Ga0466703_401002 | 3300042636 | Bacteria | 4684 |
| 58 | Ga0466704_104728 | 3300042643 | Bacteria | 1037 |
| 59 | Ga0466708_128277 | 3300042652 | Bacteria | 3415 |
| 60 | Ga0466727_037524 | 3300042655 | Bacteria | 4283 |
| 61 | Ga0466727_069943 | 3300042655 | Bacteria | 3462 |
| 62 | Ga0466690_096233 | 3300042590 | Bacteria | 4726 |
| 63 | Ga0466691_097803 | 3300042593 | Bacteria | 6513 |
| 64 | Ga0466711_095405 | 3300042615 | Bacteria | 8443 |
| 65 | Ga0466715_432987 | 3300042616 | Bacteria | 8498 |
| 66 | Ga0466723_013154 | 3300042618 | Bacteria | 95841 |
| 67 | Ga0466723_039243 | 3300042618 | Bacteria | 3997 |
| 68 | Ga0466726_044703 | 3300042619 | Bacteria | 2747 |
| 69 | Ga0466728_397170 | 3300042620 | Bacteria | 2408 |
| 70 | Ga0466707_320118 | 3300042601 | Bacteria | 1652 |
| 71 | Ga0466713_085573 | 3300042602 | Bacteria | 1648 |
| 72 | Ga0466716_247787 | 3300042605 | Bacteria | 10104 |
| 73 | Ga0466719_388221 | 3300042606 | Bacteria | 1495 |
| 74 | JGI24695J34938_10000020 | 3300002450 | Bacteria | 112619 |
| 75 | JGI24700J35501_10929904 | 3300002508 | Bacteria | 10554 |
| 76 | Ga0466735_026311 | 3300042624 | Bacteria | 4089 |
| 77 | Ga0466735_118009 | 3300042624 | Bacteria | 2600 |
| 78 | Ga0466704_087285 | 3300042643 | Bacteria | 5155 |
| 79 | Ga0466690_427120 | 3300042590 | Bacteria | 1707 |
| 80 | Ga0466726_328030 | 3300042619 | Bacteria | 1398 |
| 81 | Ga0466726_444431 | 3300042619 | Bacteria | 1441 |
| 82 | Ga0466728_026164 | 3300042620 | Bacteria | 14723 |
| 83 | Ga0466728_037811 | 3300042620 | Bacteria | 1867 |
| 84 | Ga0466728_198222 | 3300042620 | Bacteria | 1495 |
| 85 | Ga0466706_276213 | 3300042599 | Bacteria | 1079 |
| 86 | Ga0466707_345839 | 3300042601 | Bacteria | 1009 |
| 87 | JGI24702J35022_10001366 | 3300002462 | Bacteria | 15144 |
| 88 | Ga0466703_069498 | 3300042636 | Bacteria | 1312 |
| 89 | Ga0466703_110299 | 3300042636 | Bacteria | 6166 |
| 90 | Ga0466704_042177 | 3300042643 | Bacteria | 8446 |
| 91 | Ga0466708_037775 | 3300042652 | Bacteria | 1857 |
| 92 | Ga0466708_193377 | 3300042652 | Bacteria | 9373 |
| 93 | Ga0466727_116691 | 3300042655 | Bacteria | 2594 |
| 94 | Ga0466691_095714 | 3300042593 | Bacteria | 13728 |
| 95 | Ga0466696_093804 | 3300042596 | Bacteria | 8980 |
| 96 | Ga0123356_10317313 | 3300010049 | Bacteria | 1670 |
| 97 | Ga0466723_220471 | 3300042618 | Bacteria | 2069 |
| 98 | Ga0466726_004920 | 3300042619 | Bacteria | 12274 |
| 99 | Ga0466716_205822 | 3300042605 | Bacteria | 12486 |
| 100 | Ga0466719_210604 | 3300042606 | Bacteria | 2015 |
| 101 | Ga0466722_014246 | 3300042609 | Bacteria | 18174 |
| 102 | Ga0466727_157929 | 3300042655 | Bacteria | 1121 |
| 103 | Ga0466694_242745 | 3300042594 | Bacteria | 1547 |
| 104 | Ga0466694_262806 | 3300042594 | Bacteria | 3026 |
| 105 | Ga0466696_013909 | 3300042596 | Bacteria | 15963 |
| 106 | Ga0466728_002711 | 3300042620 | Bacteria | 1246 |
| 107 | Ga0466706_274519 | 3300042599 | Bacteria | 7721 |
| 108 | Ga0466707_179898 | 3300042601 | Bacteria | 1028 |
| 109 | Ga0466722_071756 | 3300042609 | Bacteria | 3487 |
| 110 | Nasutiter_Contig26118 | 2030936001 | Bacteria | 713 |
| 111 | Ga0072941_1004291 | 3300005201 | Bacteria | 46702 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutiter_Contig26118 | Nasutiterm_1898370 | 183 |
| 2 | 3300042619 | Ga0466726_375405 | Ga0466726_375405_105_680 | 191 |
| 3 | 3300042593 | Ga0466691_054001 | Ga0466691_054001_450_1028 | 192 |
| 4 | 3300042615 | Ga0466711_164872 | Ga0466711_164872_91_711 | 194 |
| 5 | 3300042619 | Ga0466726_347799 | Ga0466726_347799_310_900 | 196 |
| 6 | 3300042601 | Ga0466707_306763 | Ga0466707_306763_695_1288 | 197 |
| 7 | 3300042643 | Ga0466704_048208 | Ga0466704_048208_9579_10175 | 198 |
| 8 | 3300042652 | Ga0466708_193377 | Ga0466708_193377_8529_9125 | 198 |
| 9 | 3300042619 | Ga0466726_005935 | Ga0466726_005935_495_1094 | 199 |
| 10 | 3300042590 | Ga0466690_096233 | Ga0466690_096233_1027_1629 | 200 |
| 11 | 3300042590 | Ga0466690_427120 | Ga0466690_427120_958_1560 | 200 |
| 12 | 3300042591 | Ga0466692_112403 | Ga0466692_112403_356_958 | 200 |
| 13 | 3300042594 | Ga0466694_242745 | Ga0466694_242745_266_868 | 200 |
| 14 | 3300042594 | Ga0466694_296235 | Ga0466694_296235_2079_2681 | 200 |
| 15 | 3300042599 | Ga0466706_274519 | Ga0466706_274519_6466_7068 | 200 |
| 16 | 3300042609 | Ga0466722_014246 | Ga0466722_014246_17043_17645 | 200 |
| 17 | 3300042612 | Ga0466705_229558 | Ga0466705_229558_2288_2890 | 200 |
| 18 | 3300042614 | Ga0466712_001829 | Ga0466712_001829_5069_5671 | 200 |
| 19 | 3300042616 | Ga0466715_024285 | Ga0466715_024285_1001_1603 | 200 |
| 20 | 3300042617 | Ga0466718_017191 | Ga0466718_017191_186_788 | 200 |
| 21 | 3300042617 | Ga0466718_159473 | Ga0466718_159473_455_1057 | 200 |
| 22 | 3300042621 | Ga0466729_027978 | Ga0466729_027978_2864_3466 | 200 |
| 23 | 3300042622 | Ga0466731_032952 | Ga0466731_032952_313_915 | 200 |
| 24 | 3300042643 | Ga0466704_244245 | Ga0466704_244245_13176_13778 | 200 |
| 25 | 3300042655 | Ga0466727_069943 | Ga0466727_069943_1968_2570 | 200 |
| 26 | 3300042655 | Ga0466727_202826 | Ga0466727_202826_3757_4359 | 200 |
| 27 | iso_pr_bacteria | 2781125692 | 2781430601 | 200 |
| 28 | 3300002449 | JGI24698J34947_10195298 | JGI24698J34947_101952981 | 201 |
| 29 | 3300002462 | JGI24702J35022_10001366 | JGI24702J35022_100013667 | 201 |
| 30 | 3300010049 | Ga0123356_10317313 | Ga0123356_103173131 | 201 |
| 31 | 3300042591 | Ga0466692_164862 | Ga0466692_164862_1656_2261 | 201 |
| 32 | 3300042596 | Ga0466696_013909 | Ga0466696_013909_12412_13017 | 201 |
| 33 | 3300042597 | Ga0466699_093271 | Ga0466699_093271_145_750 | 201 |
| 34 | 3300042601 | Ga0466707_320118 | Ga0466707_320118_227_832 | 201 |
| 35 | 3300042602 | Ga0466713_085573 | Ga0466713_085573_185_790 | 201 |
| 36 | 3300042605 | Ga0466716_205822 | Ga0466716_205822_3629_4234 | 201 |
| 37 | 3300042605 | Ga0466716_247787 | Ga0466716_247787_8933_9538 | 201 |
| 38 | 3300042606 | Ga0466719_388221 | Ga0466719_388221_474_1079 | 201 |
| 39 | 3300042612 | Ga0466705_275492 | Ga0466705_275492_1776_2381 | 201 |
| 40 | 3300042616 | Ga0466715_432987 | Ga0466715_432987_7710_8315 | 201 |
| 41 | 3300042619 | Ga0466726_032777 | Ga0466726_032777_341_946 | 201 |
| 42 | 3300042619 | Ga0466726_365405 | Ga0466726_365405_558_1163 | 201 |
| 43 | 3300042619 | Ga0466726_444431 | Ga0466726_444431_240_845 | 201 |
| 44 | 3300042620 | Ga0466728_002711 | Ga0466728_002711_462_1067 | 201 |
| 45 | 3300042620 | Ga0466728_026164 | Ga0466728_026164_10866_11471 | 201 |
| 46 | 3300042620 | Ga0466728_198222 | Ga0466728_198222_824_1429 | 201 |
| 47 | 3300042620 | Ga0466728_348138 | Ga0466728_348138_243_848 | 201 |
| 48 | 3300042624 | Ga0466735_026311 | Ga0466735_026311_2626_3231 | 201 |
| 49 | 3300042643 | Ga0466704_042177 | Ga0466704_042177_1436_2041 | 201 |
| 50 | 3300042652 | Ga0466708_037775 | Ga0466708_037775_439_1044 | 201 |
| 51 | 3300042652 | Ga0466708_047561 | Ga0466708_047561_1000_1605 | 201 |
| 52 | iso_pr_bacteria | 650716099 | 650879422 | 201 |
| 53 | 3300005201 | Ga0072941_1001253 | Ga0072941_10012538 | 202 |
| 54 | 3300005201 | Ga0072941_1004291 | Ga0072941_100429127 | 202 |
| 55 | 3300005201 | Ga0072941_1005413 | Ga0072941_10054133 | 202 |
| 56 | 3300042594 | Ga0466694_262806 | Ga0466694_262806_212_820 | 202 |
| 57 | 3300042606 | Ga0466719_496954 | Ga0466719_496954_9182_9790 | 202 |
| 58 | 3300042619 | Ga0466726_044703 | Ga0466726_044703_1661_2269 | 202 |
| 59 | 3300042619 | Ga0466726_148550 | Ga0466726_148550_1080_1688 | 202 |
| 60 | 3300042619 | Ga0466726_328030 | Ga0466726_328030_232_840 | 202 |
| 61 | 3300042620 | Ga0466728_037811 | Ga0466728_037811_325_933 | 202 |
| 62 | 3300042620 | Ga0466728_397170 | Ga0466728_397170_543_1151 | 202 |
| 63 | 3300042624 | Ga0466735_033212 | Ga0466735_033212_74_682 | 202 |
| 64 | 3300042636 | Ga0466703_200075 | Ga0466703_200075_7488_8096 | 202 |
| 65 | 3300042636 | Ga0466703_262941 | Ga0466703_262941_29_637 | 202 |
| 66 | 3300042636 | Ga0466703_292012 | Ga0466703_292012_41844_42452 | 202 |
| 67 | 3300042636 | Ga0466703_331235 | Ga0466703_331235_6099_6707 | 202 |
| 68 | 3300042652 | Ga0466708_282849 | Ga0466708_282849_7898_8506 | 202 |
| 69 | iso_pr_bacteria | 2781125638 | 2781283530 | 202 |
| 70 | 3300002450 | JGI24695J34938_10000020 | JGI24695J34938_1000002062 | 203 |
| 71 | 3300002450 | JGI24695J34938_10094115 | JGI24695J34938_100941152 | 203 |
| 72 | 3300042593 | Ga0466691_095714 | Ga0466691_095714_11547_12158 | 203 |
| 73 | 3300042593 | Ga0466691_099375 | Ga0466691_099375_4836_5447 | 203 |
| 74 | 3300042596 | Ga0466696_109177 | Ga0466696_109177_2194_2805 | 203 |
| 75 | 3300042599 | Ga0466706_276213 | Ga0466706_276213_228_839 | 203 |
| 76 | 3300042601 | Ga0466707_179898 | Ga0466707_179898_337_948 | 203 |
| 77 | 3300042606 | Ga0466719_210604 | Ga0466719_210604_1375_1986 | 203 |
| 78 | 3300042609 | Ga0466722_214590 | Ga0466722_214590_432_1043 | 203 |
| 79 | 3300042612 | Ga0466705_049245 | Ga0466705_049245_7050_7661 | 203 |
| 80 | 3300042618 | Ga0466723_039243 | Ga0466723_039243_2763_3374 | 203 |
| 81 | 3300042618 | Ga0466723_088658 | Ga0466723_088658_1566_2177 | 203 |
| 82 | 3300042624 | Ga0466735_001920 | Ga0466735_001920_939_1550 | 203 |
| 83 | 3300042636 | Ga0466703_110299 | Ga0466703_110299_5242_5853 | 203 |
| 84 | 3300042636 | Ga0466703_401002 | Ga0466703_401002_2564_3175 | 203 |
| 85 | 3300042643 | Ga0466704_104728 | Ga0466704_104728_120_731 | 203 |
| 86 | 3300042643 | Ga0466704_323682 | Ga0466704_323682_12144_12755 | 203 |
| 87 | 3300042652 | Ga0466708_032209 | Ga0466708_032209_1779_2390 | 203 |
| 88 | iso_pr_bacteria | 2819994798 | 2819996193 | 203 |
| 89 | 3300002508 | JGI24700J35501_10929904 | JGI24700J35501_109299043 | 204 |
| 90 | 3300042606 | Ga0466719_081718 | Ga0466719_081718_9128_9742 | 204 |
| 91 | 3300042655 | Ga0466727_157929 | Ga0466727_157929_359_973 | 204 |
| 92 | 3300010167 | Ga0123353_10654047 | Ga0123353_106540472 | 205 |
| 93 | 3300042591 | Ga0466692_072568 | Ga0466692_072568_4035_4652 | 205 |
| 94 | 3300042593 | Ga0466691_097803 | Ga0466691_097803_5768_6385 | 205 |
| 95 | 3300042596 | Ga0466696_093804 | Ga0466696_093804_3324_3941 | 205 |
| 96 | 3300042601 | Ga0466707_345839 | Ga0466707_345839_258_875 | 205 |
| 97 | 3300042606 | Ga0466719_302063 | Ga0466719_302063_5252_5869 | 205 |
| 98 | 3300002834 | JGI24696J40584_12909933 | JGI24696J40584_129099332 | 206 |
| 99 | 3300042606 | Ga0466719_108774 | Ga0466719_108774_364_984 | 206 |
| 100 | 3300042615 | Ga0466711_095405 | Ga0466711_095405_5525_6145 | 206 |
| 101 | 3300042618 | Ga0466723_013154 | Ga0466723_013154_22169_22789 | 206 |
| 102 | 3300042619 | Ga0466726_004920 | Ga0466726_004920_5044_5664 | 206 |
| 103 | 3300042636 | Ga0466703_052771 | Ga0466703_052771_7118_7738 | 206 |
| 104 | 3300042643 | Ga0466704_087285 | Ga0466704_087285_4329_4949 | 206 |
| 105 | 3300042655 | Ga0466727_037524 | Ga0466727_037524_2337_2957 | 206 |
| 106 | 3300042593 | Ga0466691_218708 | Ga0466691_218708_7533_8156 | 207 |
| 107 | 3300042596 | Ga0466696_023451 | Ga0466696_023451_2021_2644 | 207 |
| 108 | 3300042609 | Ga0466722_071756 | Ga0466722_071756_372_995 | 207 |
| 109 | 3300042652 | Ga0466708_128277 | Ga0466708_128277_1210_1842 | 210 |
| 110 | 3300009784 | Ga0123357_10447592 | Ga0123357_104475921 | 211 |
| 111 | 3300042636 | Ga0466703_069498 | Ga0466703_069498_12_647 | 211 |
| 112 | 3300042655 | Ga0466727_116691 | Ga0466727_116691_687_1325 | 212 |
| 113 | 3300042609 | Ga0466722_081306 | Ga0466722_081306_23144_23785 | 213 |
| 114 | 3300042618 | Ga0466723_220471 | Ga0466723_220471_132_776 | 214 |
| 115 | 3300042624 | Ga0466735_118009 | Ga0466735_118009_783_1463 | 226 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.