Protein Family IF08783

Metagenome Isolate
281 Members
97 Samples
230 Scaffolds
322.53 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_093892|Ga0466735_093892_1568_2638
Length
356 aa
Sequence
MKNGIFSRKNCIILINLLHLLIEFDNFNNIHFNKTIMEKSYVIGIDIGGTNSVFGVVDARGTILYSDSIKTSLYSEIDKYVDALSVGLDGVIEKAGGKSTIKGIGVGAPNGNYYTGCIDFAPNLPWRGKIPLAQLINDKTGLPVTLTNDANAAAIGEMTYGVARGMKDFIVITLGTGVGSGIVVGGNLVYGHDGFAGELGHVIVRRENGRLCGCGRHGCLEAYTSATGVARTARELLVSRTEKSLLRDIDAELITSKDVYDAAVKGDKLSLEIFEKTGTILGEAFADFIAFSSPEAIILFGGLARSGDLIMEPIQRALDENVLKVFAGKTKLLFSQLKESDAAVLGASALGWEVKG

📊 Sample Types

Isolate 18.1%
Metagenome 81.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 36.1%
Termitidae 18.6%
Kalotermitidae 14.4%
Unclassified 13.4%
Rhinotermitidae 6.2%
Passalidae 3.1%
Termopsidae 3.1%
Hydrophilidae 2.1%
Hodotermitidae 1.0%
Tenebrionidae 1.0%
Culicidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 273
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
2 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
3 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
4 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
5 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
6 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
7 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
8 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
9 3004672520 Bacteroides sp. 51 Isolate Blattidae
10 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
11 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
12 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
13 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
19 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
20 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
21 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
22 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
23 3004667792 Bacteroides sp. 519 Isolate Blattidae
24 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
31 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
32 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
33 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
34 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
35 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
46 2920168565 Paludibacter sp. 221 Isolate Blattidae
47 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
48 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
49 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
50 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
51 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
52 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
53 2923982719 Parabacteroides sp. 52 Isolate Blattidae
54 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
55 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
56 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
57 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
58 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
59 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
60 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
61 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
62 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
63 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
64 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
65 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
66 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
67 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
68 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
69 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
70 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
71 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
72 3004677695 Bacteroides sp. 214 Isolate Blattidae
73 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
74 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
75 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
76 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
77 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
78 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
79 2922326829 Bacteroides sp. 224 Isolate Blattidae
80 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
81 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
82 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
83 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
84 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
85 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
86 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
87 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
88 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
89 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
90 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
91 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
92 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
93 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
94 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
95 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
96 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
97 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466710_292706 3300042613 Unclassified 3235
2 Ga0466711_323861 3300042615 Bacteria 2937
3 Ga0466715_119072 3300042616 Bacteria 9048
4 Ga0466726_211588 3300042619 Bacteria 2623
5 Ga0466705_297878 3300042612 Bacteria 9895
6 Ga0562377_0004 3300056842 Bacteria 3525959
7 Ga0123353_10028381 3300010167 Bacteria 8597
8 Ga0466701_035983 3300042598 Bacteria 36269
9 Ga0466706_129722 3300042599 Bacteria 9634
10 Ga0466706_218716 3300042599 Bacteria 2577
11 Ga0466707_174399 3300042601 Bacteria 9055
12 Ga0466713_013757 3300042602 Bacteria 111029
13 Ga0466713_037688 3300042602 Bacteria 8094
14 Ga0466713_118645 3300042602 Bacteria 113373
15 Ga0466716_095541 3300042605 Bacteria 62772
16 Ga0466716_499732 3300042605 Bacteria 4133
17 Ga0466722_121524 3300042609 Bacteria 1497
18 Ga0466703_186749 3300042636 Unclassified 4180
19 Ga0466703_243974 3300042636 Bacteria 11125
20 Ga0466703_374219 3300042636 Bacteria 24808
21 Ga0466709_064284 3300042648 Bacteria 13198
22 Ga0466727_192333 3300042655 Bacteria 7094
23 Ga0160448_101472 3300012854 Bacteria 7528
24 Ga0466657_222391 3300042582 Bacteria 4071
25 Ga0466696_009032 3300042596 Bacteria 2510
26 IMNBGM34_c007955 3300000036 Bacteria 1359
27 IMNBL1DRAFT_c0001182 3300000062 Bacteria 19907
28 IMNBL1DRAFT_c0028853 3300000062 Bacteria 2062
29 JGI24702J35022_10064074 3300002462 Bacteria 1970
30 Ga0466711_077037 3300042615 Bacteria 10814
31 Ga0466711_091753 3300042615 Bacteria 15220
32 Ga0466715_158052 3300042616 Bacteria 6555
33 Ga0466715_237164 3300042616 Bacteria 20763
34 Ga0466715_327431 3300042616 Bacteria 11649
35 Ga0466723_064404 3300042618 Bacteria 11296
36 Ga0466726_093842 3300042619 Bacteria 1632
37 Ga0466728_154482 3300042620 Bacteria 34843
38 Ga0466728_180682 3300042620 Bacteria 7084
39 Ga0466728_264238 3300042620 Bacteria 8155
40 Ga0466733_165673 3300042659 Bacteria 9015
41 Ga0123357_10194641 3300009784 Bacteria 2326
42 Ga0466706_060160 3300042599 Bacteria 4112
43 Ga0466706_164369 3300042599 Bacteria 4337
44 Ga0466707_042036 3300042601 Bacteria 5533
45 Ga0466713_009611 3300042602 Bacteria 50770
46 Ga0466714_109666 3300042603 Bacteria 2099
47 Ga0466722_113613 3300042609 Bacteria 129604
48 Ga0466734_077027 3300042623 Bacteria 4043
49 Ga0466704_227992 3300042643 Unclassified 13276
50 Ga0466704_277144 3300042643 Bacteria 3284
51 Ga0466709_399168 3300042648 Bacteria 2359
52 Ga0466708_214005 3300042652 Bacteria 21996
53 Ga0466727_028152 3300042655 Bacteria 14252
54 Ga0466690_306403 3300042590 Bacteria 20840
55 Ga0466696_170441 3300042596 Unclassified 5539
56 Ga0466696_394022 3300042596 Bacteria 212291
57 IMNBL1DRAFT_c0007168 3300000062 Bacteria 5922
58 IMNBL1DRAFT_c0014412 3300000062 Bacteria 3491
59 JGI24702J35022_10000539 3300002462 Bacteria 22829
60 Ga0068305_10015691 3300005083 Bacteria 40812
61 Ga0466715_471063 3300042616 Bacteria 22550
62 Ga0466726_052728 3300042619 Bacteria 10684
63 Ga0466726_076133 3300042619 Bacteria 50177
64 Ga0466726_201869 3300042619 Bacteria 2080
65 Ga0466728_061024 3300042620 Bacteria 3387
66 Ga0466728_167295 3300042620 Bacteria 8014
67 Ga0466705_284863 3300042612 Bacteria 5252
68 Ga0123354_10067742 3300010882 Bacteria 5196
69 Ga0466706_006892 3300042599 Bacteria 6984
70 Ga0466706_053224 3300042599 Bacteria 2501
71 Ga0466706_139780 3300042599 Bacteria 25325
72 Ga0466707_099113 3300042601 Bacteria 4149
73 Ga0466713_028040 3300042602 Bacteria 9090
74 Ga0466713_100528 3300042602 Bacteria 510720
75 Ga0466714_074091 3300042603 Bacteria 3989
76 Ga0466714_096045 3300042603 Bacteria 19538
77 Ga0466716_137156 3300042605 Bacteria 11738
78 Ga0466716_238887 3300042605 Bacteria 28802
79 Ga0466722_015662 3300042609 Bacteria 7177
80 Ga0466735_093892 3300042624 Bacteria 3733
81 Ga0466703_002806 3300042636 Bacteria 1635
82 Ga0466703_185216 3300042636 Bacteria 18948
83 Ga0466704_526153 3300042643 Bacteria 1864
84 Ga0466727_201511 3300042655 Bacteria 8832
85 Ga0466690_040815 3300042590 Bacteria 27317
86 Ga0466691_076597 3300042593 Bacteria 34769
87 Ga0466691_092282 3300042593 Bacteria 2572
88 Ga0466696_230105 3300042596 Bacteria 2115
89 Ga0466696_432160 3300042596 Bacteria 11292
90 2227541305 2225789004 Unclassified 15560
91 JGI24696J40584_12935015 3300002834 Bacteria 1551
92 Ga0466710_435740 3300042613 Bacteria 1338
93 Ga0466711_039155 3300042615 Bacteria 7544
94 Ga0466723_059293 3300042618 Bacteria 11190
95 Ga0466705_111736 3300042612 Bacteria 12747
96 Ga0466705_333635 3300042612 Bacteria 3574
97 Ga0466733_088610 3300042659 Bacteria 5318
98 Ga0466706_042414 3300042599 Bacteria 11971
99 Ga0466706_070230 3300042599 Bacteria 4192
100 Ga0466707_416730 3300042601 Bacteria 3484
101 Ga0466714_012355 3300042603 Bacteria 1877
102 Ga0466714_013813 3300042603 Bacteria 151010
103 Ga0466721_212652 3300042608 Bacteria 16387
104 Ga0466722_219556 3300042609 Bacteria 1889
105 Ga0466735_010350 3300042624 Bacteria 4302
106 Ga0466703_018300 3300042636 Bacteria 15549
107 Ga0466708_044096 3300042652 Bacteria 70438
108 Ga0466727_103661 3300042655 Bacteria 10179
109 Ga0466690_066226 3300042590 Bacteria 16041
110 Ga0466690_266095 3300042590 Bacteria 5906
111 Ga0466692_173188 3300042591 Bacteria 49928
112 Ga0466696_045091 3300042596 Bacteria 15483
113 JGI24702J35022_10065359 3300002462 Bacteria 1951
114 Ga0466711_066658 3300042615 Bacteria 7473
115 Ga0466711_255641 3300042615 Bacteria 5718
116 Ga0466715_445208 3300042616 Bacteria 2589
117 Ga0466723_025239 3300042618 Bacteria 67003
118 Ga0466723_146997 3300042618 Bacteria 23442
119 Ga0123353_10000162 3300010167 Bacteria 85033
120 Ga0123353_10346157 3300010167 Unclassified 2243
121 Ga0466706_011089 3300042599 Bacteria 3312
122 Ga0466706_115643 3300042599 Bacteria 11447
123 Ga0466713_154843 3300042602 Bacteria 19050
124 Ga0466716_021658 3300042605 Bacteria 5504
125 Ga0466716_050358 3300042605 Bacteria 8712
126 Ga0466719_354092 3300042606 Bacteria 3843
127 Ga0466719_478446 3300042606 Bacteria 11606
128 Ga0466722_190554 3300042609 Bacteria 18850
129 Ga0466735_089103 3300042624 Bacteria 2698
130 Ga0466735_138394 3300042624 Bacteria 4797
131 Ga0466730_088029 3300042625 Bacteria 3059
132 Ga0466703_151997 3300042636 Bacteria 10621
133 Ga0466703_165186 3300042636 Bacteria 7424
134 Ga0466703_364369 3300042636 Bacteria 13478
135 Ga0466704_126477 3300042643 Bacteria 9636
136 Ga0466704_353113 3300042643 Bacteria 3323
137 Ga0466709_387947 3300042648 Bacteria 2349
138 Ga0466727_170943 3300042655 Bacteria 36421
139 Ga0466657_064955 3300042582 Bacteria 3403
140 Ga0466692_140391 3300042591 Bacteria 136970
141 Ga0466696_154148 3300042596 Bacteria 2762
142 Ga0466696_404036 3300042596 Bacteria 3062
143 IMNBL1DRAFT_c0000838 3300000062 Bacteria 24143
144 JGI24705J35276_12235290 3300002504 Bacteria 6369
145 JGI24696J40584_12960159 3300002834 Bacteria 6454
146 Ga0068305_10022870 3300005083 Unclassified 3846
147 Ga0466715_152522 3300042616 Bacteria 3581
148 Ga0466715_413814 3300042616 Bacteria 9845
149 Ga0466723_008165 3300042618 Bacteria 2653
150 Ga0466705_155733 3300042612 Bacteria 30369
151 Ga0123353_10522148 3300010167 Bacteria 1722
152 Ga0466707_125431 3300042601 Bacteria 10173
153 Ga0466713_016556 3300042602 Bacteria 4146
154 Ga0466713_047868 3300042602 Bacteria 11022
155 Ga0466713_128443 3300042602 Bacteria 30120
156 Ga0466713_146724 3300042602 Bacteria 5308
157 Ga0466716_344224 3300042605 Bacteria 3086
158 Ga0466719_377084 3300042606 Bacteria 3496
159 Ga0466722_069271 3300042609 Bacteria 10768
160 Ga0466722_178845 3300042609 Bacteria 79493
161 Ga0466735_198286 3300042624 Bacteria 6893
162 Ga0466704_182973 3300042643 Bacteria 4932
163 Ga0466704_502513 3300042643 Bacteria 10794
164 Ga0466704_554901 3300042643 Bacteria 24622
165 Ga0466708_367106 3300042652 Bacteria 72455
166 Ga0466727_250096 3300042655 Bacteria 9105
167 Ga0466690_134124 3300042590 Bacteria 14927
168 Ga0466690_207852 3300042590 Bacteria 22066
169 Ga0466692_066865 3300042591 Bacteria 168349
170 Ga0466692_090388 3300042591 Bacteria 9587
171 Ga0466691_082186 3300042593 Bacteria 3837
172 Ga0466691_112917 3300042593 Bacteria 16704
173 Ga0466691_150356 3300042593 Bacteria 13013
174 Ga0466695_400238 3300042595 Bacteria 3354
175 Ga0466696_483865 3300042596 Bacteria 4945
176 2227549636 2225789004 Bacteria 15057
177 IMNBL1DRAFT_c0000136 3300000062 Bacteria 65757
178 Ga0068305_10016449 3300005083 Unclassified 7735
179 Ga0466711_184071 3300042615 Bacteria 34370
180 Ga0466723_154978 3300042618 Bacteria 69722
181 Ga0466728_404970 3300042620 Bacteria 46041
182 Ga0466705_039673 3300042612 Bacteria 7371
183 Ga0466733_216697 3300042659 Bacteria 189231
184 Ga0123357_10166436 3300009784 Bacteria 2623
185 Ga0466706_016306 3300042599 Bacteria 2225
186 Ga0466706_117781 3300042599 Bacteria 29621
187 Ga0466707_055253 3300042601 Bacteria 7309
188 Ga0466713_033308 3300042602 Bacteria 2287
189 Ga0466719_282129 3300042606 Bacteria 2984
190 Ga0466722_030811 3300042609 Bacteria 14557
191 Ga0466735_001520 3300042624 Bacteria 7941
192 Ga0466735_224846 3300042624 Bacteria 6547
193 Ga0466703_043230 3300042636 Bacteria 9803
194 Ga0466704_055849 3300042643 Bacteria 53217
195 Ga0466704_263576 3300042643 Bacteria 9057
196 Ga0466657_372707 3300042582 Bacteria 5356
197 Ga0466696_101690 3300042596 Bacteria 1504
198 Ga0466696_449766 3300042596 Bacteria 6002
199 JGI24702J35022_10054552 3300002462 Bacteria 2132
200 Ga0466705_462315 3300042612 Bacteria 2831
201 Ga0466711_041942 3300042615 Bacteria 8794
202 Ga0466715_048528 3300042616 Bacteria 41779
203 Ga0466715_055808 3300042616 Bacteria 10565
204 Ga0466715_427106 3300042616 Bacteria 52396
205 Ga0466726_347118 3300042619 Bacteria 10170
206 Ga0466728_070909 3300042620 Bacteria 19692
207 Ga0466729_099612 3300042621 Bacteria 24055
208 Ga0466705_258636 3300042612 Bacteria 8663
209 Ga0466733_006538 3300042659 Bacteria 7062
210 Ga0466733_038286 3300042659 Bacteria 266317
211 Ga0466733_129143 3300042659 Bacteria 21646
212 Ga0123353_10008646 3300010167 Bacteria 13935
213 Ga0123354_10312194 3300010882 Bacteria 1466
214 Ga0466706_202547 3300042599 Bacteria 1823
215 Ga0466707_121272 3300042601 Bacteria 14434
216 Ga0466713_047975 3300042602 Bacteria 7761
217 Ga0466713_139646 3300042602 Bacteria 516516
218 Ga0466716_286851 3300042605 Bacteria 11732
219 Ga0466716_384664 3300042605 Bacteria 3229
220 Ga0466716_536943 3300042605 Bacteria 9244
221 Ga0466719_032833 3300042606 Bacteria 5307
222 Ga0466719_263220 3300042606 Bacteria 12678
223 Ga0466731_090176 3300042622 Bacteria 1387
224 Ga0466708_114192 3300042652 Bacteria 2806
225 Ga0466727_220111 3300042655 Bacteria 43243
226 Ga0466690_386085 3300042590 Bacteria 20488
227 Ga0466693_133705 3300042592 Bacteria 1571
228 Ga0466696_097370 3300042596 Bacteria 12209
229 2227529891 2225789004 Bacteria 3174
230 JGI24699J35502_11134227 3300002509 Bacteria 76542

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10194641 Ga0123357_101946413 271
2 iso_pr_bacteria 2609459943 2610743586 289
3 iso_pr_bacteria 2967483437 2967484501 299
4 3300042601 Ga0466707_174399 Ga0466707_174399_7363_8304 303
5 3300010167 Ga0123353_10346157 Ga0123353_103461572 311
6 3300042603 Ga0466714_012355 Ga0466714_012355_24_983 311
7 3300010882 Ga0123354_10067742 Ga0123354_100677425 315
8 3300042609 Ga0466722_015662 Ga0466722_015662_1175_2122 315
9 3300042590 Ga0466690_066226 Ga0466690_066226_11789_12742 317
10 3300042596 Ga0466696_045091 Ga0466696_045091_10229_11185 318
11 3300042596 Ga0466696_404036 Ga0466696_404036_27_983 318
12 3300042602 Ga0466713_033308 Ga0466713_033308_981_1937 318
13 3300042609 Ga0466722_219556 Ga0466722_219556_303_1259 318
14 3300042619 Ga0466726_201869 Ga0466726_201869_428_1384 318
15 iso_pr_bacteria 2940193328 2940193882 318
16 iso_pr_bacteria 2940336608 2940337160 318
17 2225789004 2227529891 2228040892 319
18 3300042582 Ga0466657_064955 Ga0466657_064955_1010_1969 319
19 3300042582 Ga0466657_222391 Ga0466657_222391_339_1298 319
20 3300042582 Ga0466657_372707 Ga0466657_372707_2468_3427 319
21 3300042599 Ga0466706_070230 Ga0466706_070230_950_1909 319
22 3300042605 Ga0466716_021658 Ga0466716_021658_2313_3272 319
23 3300042605 Ga0466716_344224 Ga0466716_344224_1609_2568 319
24 3300042613 Ga0466710_292706 Ga0466710_292706_845_1804 319
25 3300042620 Ga0466728_180682 Ga0466728_180682_2005_2964 319
26 3300042620 Ga0466728_264238 Ga0466728_264238_4330_5289 319
27 3300042620 Ga0466728_404970 Ga0466728_404970_29224_30183 319
28 3300042636 Ga0466703_243974 Ga0466703_243974_2663_3622 319
29 3300042659 Ga0466733_006538 Ga0466733_006538_4697_5656 319
30 iso_pr_bacteria 2922326829 2922330500 319
31 2225789004 2227541305 2228063257 320
32 3300000062 IMNBL1DRAFT_c0007168 IMNBL1DRAFT_00071685 320
33 3300002462 JGI24702J35022_10064074 JGI24702J35022_100640741 320
34 3300002834 JGI24696J40584_12935015 JGI24696J40584_129350151 320
35 3300012854 Ga0160448_101472 Ga0160448_1014722 320
36 3300042591 Ga0466692_066865 Ga0466692_066865_7402_8364 320
37 3300042591 Ga0466692_140391 Ga0466692_140391_97719_98681 320
38 3300042591 Ga0466692_173188 Ga0466692_173188_31115_32077 320
39 3300042595 Ga0466695_400238 Ga0466695_400238_451_1413 320
40 3300042599 Ga0466706_060160 Ga0466706_060160_308_1270 320
41 3300042601 Ga0466707_042036 Ga0466707_042036_2885_3847 320
42 3300042601 Ga0466707_055253 Ga0466707_055253_3843_4805 320
43 3300042601 Ga0466707_125431 Ga0466707_125431_4471_5433 320
44 3300042602 Ga0466713_013757 Ga0466713_013757_88564_89526 320
45 3300042602 Ga0466713_016556 Ga0466713_016556_2962_3924 320
46 3300042602 Ga0466713_047868 Ga0466713_047868_9684_10646 320
47 3300042602 Ga0466713_100528 Ga0466713_100528_105846_106808 320
48 3300042602 Ga0466713_118645 Ga0466713_118645_37381_38343 320
49 3300042602 Ga0466713_139646 Ga0466713_139646_314789_315751 320
50 3300042602 Ga0466713_146724 Ga0466713_146724_3212_4174 320
51 3300042603 Ga0466714_074091 Ga0466714_074091_1106_2068 320
52 3300042603 Ga0466714_109666 Ga0466714_109666_584_1546 320
53 3300042609 Ga0466722_121524 Ga0466722_121524_93_1055 320
54 3300042612 Ga0466705_258636 Ga0466705_258636_2959_3921 320
55 3300042615 Ga0466711_066658 Ga0466711_066658_675_1637 320
56 3300042615 Ga0466711_184071 Ga0466711_184071_21116_22078 320
57 3300042616 Ga0466715_152522 Ga0466715_152522_241_1203 320
58 3300042616 Ga0466715_327431 Ga0466715_327431_4905_5867 320
59 3300042616 Ga0466715_413814 Ga0466715_413814_1016_1978 320
60 3300042619 Ga0466726_347118 Ga0466726_347118_5281_6243 320
61 3300042625 Ga0466730_088029 Ga0466730_088029_1943_2905 320
62 3300042636 Ga0466703_002806 Ga0466703_002806_376_1338 320
63 3300042636 Ga0466703_151997 Ga0466703_151997_617_1579 320
64 3300042643 Ga0466704_353113 Ga0466704_353113_1768_2730 320
65 3300042655 Ga0466727_170943 Ga0466727_170943_154_1116 320
66 3300042655 Ga0466727_250096 Ga0466727_250096_1366_2328 320
67 3300042659 Ga0466733_129143 Ga0466733_129143_12744_13706 320
68 3300042659 Ga0466733_216697 Ga0466733_216697_85509_86471 320
69 iso_pr_bacteria 2695420314 2695472751 320
70 iso_pr_bacteria 2910926975 2910927684 320
71 iso_pr_bacteria 2910930387 2910932484 320
72 iso_pr_bacteria 2910942425 2910942598 320
73 iso_pr_bacteria 2910959314 2910960570 320
74 iso_pr_bacteria 2940244548 2940246277 320
75 iso_pr_bacteria 2940248789 2940250320 320
76 iso_pr_bacteria 2940253009 2940254395 320
77 iso_pr_bacteria 2940257232 2940258595 320
78 iso_pr_bacteria 643348524 643422975 320
79 iso_pr_bacteria 8100166142 8100168468 320
80 2225789004 2227549636 2228078182 321
81 3300000062 IMNBL1DRAFT_c0000838 IMNBL1DRAFT_00008389 321
82 3300000062 IMNBL1DRAFT_c0001182 IMNBL1DRAFT_00011823 321
83 3300000062 IMNBL1DRAFT_c0014412 IMNBL1DRAFT_00144124 321
84 3300002462 JGI24702J35022_10065359 JGI24702J35022_100653592 321
85 3300002834 JGI24696J40584_12960159 JGI24696J40584_129601594 321
86 3300005083 Ga0068305_10016449 Ga0068305_100164491 321
87 3300009784 Ga0123357_10166436 Ga0123357_101664361 321
88 3300010882 Ga0123354_10312194 Ga0123354_103121942 321
89 3300042590 Ga0466690_040815 Ga0466690_040815_25041_26006 321
90 3300042590 Ga0466690_386085 Ga0466690_386085_18950_19915 321
91 3300042592 Ga0466693_133705 Ga0466693_133705_568_1533 321
92 3300042593 Ga0466691_076597 Ga0466691_076597_15952_16917 321
93 3300042593 Ga0466691_092282 Ga0466691_092282_317_1282 321
94 3300042596 Ga0466696_097370 Ga0466696_097370_9447_10412 321
95 3300042596 Ga0466696_170441 Ga0466696_170441_3737_4702 321
96 3300042596 Ga0466696_432160 Ga0466696_432160_6597_7562 321
97 3300042596 Ga0466696_449766 Ga0466696_449766_36_1001 321
98 3300042596 Ga0466696_483865 Ga0466696_483865_3789_4754 321
99 3300042599 Ga0466706_053224 Ga0466706_053224_1291_2256 321
100 3300042601 Ga0466707_121272 Ga0466707_121272_10119_11084 321
101 3300042602 Ga0466713_009611 Ga0466713_009611_1411_2376 321
102 3300042602 Ga0466713_028040 Ga0466713_028040_5069_6034 321
103 3300042602 Ga0466713_037688 Ga0466713_037688_1779_2744 321
104 3300042602 Ga0466713_128443 Ga0466713_128443_13211_14176 321
105 3300042602 Ga0466713_154843 Ga0466713_154843_16156_17121 321
106 3300042605 Ga0466716_050358 Ga0466716_050358_5415_6380 321
107 3300042606 Ga0466719_032833 Ga0466719_032833_4256_5221 321
108 3300042609 Ga0466722_113613 Ga0466722_113613_12398_13363 321
109 3300042612 Ga0466705_111736 Ga0466705_111736_8211_9176 321
110 3300042612 Ga0466705_297878 Ga0466705_297878_8065_9030 321
111 3300042612 Ga0466705_333635 Ga0466705_333635_2314_3279 321
112 3300042613 Ga0466710_435740 Ga0466710_435740_64_1029 321
113 3300042616 Ga0466715_158052 Ga0466715_158052_5570_6535 321
114 3300042616 Ga0466715_427106 Ga0466715_427106_30616_31581 321
115 3300042616 Ga0466715_445208 Ga0466715_445208_461_1426 321
116 3300042618 Ga0466723_025239 Ga0466723_025239_52050_53015 321
117 3300042618 Ga0466723_064404 Ga0466723_064404_3449_4414 321
118 3300042618 Ga0466723_146997 Ga0466723_146997_20533_21498 321
119 3300042619 Ga0466726_052728 Ga0466726_052728_6492_7457 321
120 3300042619 Ga0466726_093842 Ga0466726_093842_349_1314 321
121 3300042619 Ga0466726_211588 Ga0466726_211588_350_1315 321
122 3300042636 Ga0466703_043230 Ga0466703_043230_3541_4506 321
123 3300042636 Ga0466703_185216 Ga0466703_185216_3071_4036 321
124 3300042643 Ga0466704_126477 Ga0466704_126477_2395_3360 321
125 3300042643 Ga0466704_182973 Ga0466704_182973_2278_3243 321
126 3300042643 Ga0466704_227992 Ga0466704_227992_3536_4501 321
127 3300042643 Ga0466704_277144 Ga0466704_277144_101_1066 321
128 3300042643 Ga0466704_502513 Ga0466704_502513_5493_6458 321
129 3300042643 Ga0466704_554901 Ga0466704_554901_23188_24153 321
130 3300042652 Ga0466708_367106 Ga0466708_367106_6293_7258 321
131 3300042655 Ga0466727_103661 Ga0466727_103661_214_1179 321
132 3300042655 Ga0466727_201511 Ga0466727_201511_855_1820 321
133 3300042659 Ga0466733_038286 Ga0466733_038286_148446_149411 321
134 3300042659 Ga0466733_165673 Ga0466733_165673_202_1167 321
135 3300056842 Ga0562377_0004 Ga0562377_0004_1176343_1177308 321
136 iso_pr_bacteria 2695420317 2695484817 321
137 iso_pr_bacteria 2695420931 2698110365 321
138 iso_pr_bacteria 2873600114 2873603331 321
139 iso_pr_bacteria 2873610414 2873613724 321
140 iso_pr_bacteria 8100157865 8100161124 321
141 3300000062 IMNBL1DRAFT_c0000136 IMNBL1DRAFT_000013637 322
142 3300002462 JGI24702J35022_10000539 JGI24702J35022_1000053918 322
143 3300002462 JGI24702J35022_10054552 JGI24702J35022_100545522 322
144 3300042590 Ga0466690_207852 Ga0466690_207852_12580_13548 322
145 3300042593 Ga0466691_150356 Ga0466691_150356_4893_5861 322
146 3300042599 Ga0466706_011089 Ga0466706_011089_1509_2477 322
147 3300042599 Ga0466706_139780 Ga0466706_139780_2408_3376 322
148 3300042599 Ga0466706_164369 Ga0466706_164369_2860_3828 322
149 3300042599 Ga0466706_202547 Ga0466706_202547_463_1431 322
150 3300042603 Ga0466714_013813 Ga0466714_013813_50420_51388 322
151 3300042605 Ga0466716_137156 Ga0466716_137156_8738_9706 322
152 3300042606 Ga0466719_478446 Ga0466719_478446_10049_11017 322
153 3300042612 Ga0466705_155733 Ga0466705_155733_12046_13014 322
154 3300042616 Ga0466715_055808 Ga0466715_055808_8430_9398 322
155 3300042620 Ga0466728_154482 Ga0466728_154482_25314_26282 322
156 3300042623 Ga0466734_077027 Ga0466734_077027_2235_3203 322
157 3300042624 Ga0466735_224846 Ga0466735_224846_2195_3163 322
158 3300042636 Ga0466703_364369 Ga0466703_364369_11900_12868 322
159 3300042643 Ga0466704_526153 Ga0466704_526153_593_1561 322
160 3300042648 Ga0466709_064284 Ga0466709_064284_302_1270 322
161 3300042648 Ga0466709_387947 Ga0466709_387947_359_1327 322
162 3300042652 Ga0466708_214005 Ga0466708_214005_17112_18080 322
163 3300042655 Ga0466727_220111 Ga0466727_220111_20067_21035 322
164 iso_pr_bacteria 2910949487 2910952798 322
165 3300010167 Ga0123353_10000162 Ga0123353_1000016230 323
166 3300042590 Ga0466690_266095 Ga0466690_266095_3518_4489 323
167 3300042593 Ga0466691_082186 Ga0466691_082186_2045_3016 323
168 3300042596 Ga0466696_009032 Ga0466696_009032_527_1498 323
169 3300042596 Ga0466696_154148 Ga0466696_154148_1474_2445 323
170 3300042599 Ga0466706_006892 Ga0466706_006892_2449_3420 323
171 3300042599 Ga0466706_016306 Ga0466706_016306_435_1406 323
172 3300042599 Ga0466706_117781 Ga0466706_117781_20520_21491 323
173 3300042599 Ga0466706_218716 Ga0466706_218716_826_1797 323
174 3300042601 Ga0466707_099113 Ga0466707_099113_2882_3853 323
175 3300042605 Ga0466716_095541 Ga0466716_095541_57568_58539 323
176 3300042605 Ga0466716_238887 Ga0466716_238887_9658_10629 323
177 3300042605 Ga0466716_384664 Ga0466716_384664_204_1175 323
178 3300042605 Ga0466716_536943 Ga0466716_536943_708_1679 323
179 3300042606 Ga0466719_282129 Ga0466719_282129_1708_2679 323
180 3300042609 Ga0466722_178845 Ga0466722_178845_59621_60592 323
181 3300042609 Ga0466722_190554 Ga0466722_190554_1263_2234 323
182 3300042612 Ga0466705_462315 Ga0466705_462315_524_1495 323
183 3300042615 Ga0466711_255641 Ga0466711_255641_1776_2747 323
184 3300042615 Ga0466711_323861 Ga0466711_323861_353_1324 323
185 3300042616 Ga0466715_048528 Ga0466715_048528_40415_41386 323
186 3300042616 Ga0466715_119072 Ga0466715_119072_7261_8232 323
187 3300042616 Ga0466715_237164 Ga0466715_237164_1532_2503 323
188 3300042618 Ga0466723_008165 Ga0466723_008165_1063_2034 323
189 3300042620 Ga0466728_061024 Ga0466728_061024_1898_2869 323
190 3300042620 Ga0466728_070909 Ga0466728_070909_16094_17065 323
191 3300042624 Ga0466735_010350 Ga0466735_010350_2734_3705 323
192 3300042636 Ga0466703_018300 Ga0466703_018300_6902_7873 323
193 3300042636 Ga0466703_186749 Ga0466703_186749_2816_3787 323
194 3300042643 Ga0466704_263576 Ga0466704_263576_3237_4208 323
195 3300042648 Ga0466709_399168 Ga0466709_399168_486_1457 323
196 3300042652 Ga0466708_114192 Ga0466708_114192_563_1534 323
197 3300042655 Ga0466727_192333 Ga0466727_192333_2858_3829 323
198 3300042659 Ga0466733_088610 Ga0466733_088610_3865_4836 323
199 iso_pr_bacteria 2820757377 2820759680 323
200 iso_pr_bacteria 2920168565 2920168997 323
201 iso_pr_bacteria 2923982719 2923985183 323
202 iso_pr_bacteria 2940195863 2940196661 323
203 iso_pr_bacteria 2940371297 2940373101 323
204 iso_pr_bacteria 3004667792 3004668422 323
205 iso_pr_bacteria 3004677695 3004677847 323
206 3300002509 JGI24699J35502_11134227 JGI24699J35502_1113422711 324
207 3300042599 Ga0466706_115643 Ga0466706_115643_8061_9035 324
208 3300042599 Ga0466706_129722 Ga0466706_129722_345_1319 324
209 3300042605 Ga0466716_286851 Ga0466716_286851_685_1659 324
210 3300042612 Ga0466705_039673 Ga0466705_039673_3767_4741 324
211 3300042615 Ga0466711_077037 Ga0466711_077037_1109_2083 324
212 3300042618 Ga0466723_059293 Ga0466723_059293_8027_9001 324
213 3300042621 Ga0466729_099612 Ga0466729_099612_15792_16766 324
214 3300042643 Ga0466704_055849 Ga0466704_055849_49701_50675 324
215 iso_pr_bacteria 2820748953 2820749553 324
216 iso_pr_bacteria 2820767225 2820767508 324
217 iso_pr_bacteria 2940199050 2940201733 324
218 iso_pr_bacteria 2940209341 2940211058 324
219 iso_pr_bacteria 2940346213 2940349177 324
220 3300002504 JGI24705J35276_12235290 JGI24705J35276_122352903 325
221 3300005083 Ga0068305_10022870 Ga0068305_100228703 325
222 3300010167 Ga0123353_10008646 Ga0123353_100086469 325
223 3300010167 Ga0123353_10522148 Ga0123353_105221482 325
224 3300042596 Ga0466696_230105 Ga0466696_230105_304_1281 325
225 3300042601 Ga0466707_416730 Ga0466707_416730_347_1324 325
226 3300042606 Ga0466719_263220 Ga0466719_263220_6405_7382 325
227 3300042606 Ga0466719_354092 Ga0466719_354092_31_1008 325
228 3300042606 Ga0466719_377084 Ga0466719_377084_376_1353 325
229 3300042609 Ga0466722_030811 Ga0466722_030811_12572_13549 325
230 3300042615 Ga0466711_039155 Ga0466711_039155_3872_4849 325
231 3300042636 Ga0466703_165186 Ga0466703_165186_1350_2327 325
232 iso_pr_bacteria 2820772500 2820773655 325
233 iso_pr_bacteria 2940205530 2940207898 325
234 iso_pr_bacteria 2940212447 2940214813 325
235 iso_pr_bacteria 2940298504 2940300867 325
236 iso_pr_bacteria 2940302308 2940304669 325
237 iso_pr_bacteria 2940306115 2940308324 325
238 iso_pr_bacteria 2940309933 2940312164 325
239 iso_pr_bacteria 2940313741 2940315882 325
240 iso_pr_bacteria 2940317558 2940319792 325
241 iso_pr_bacteria 2940321370 2940323303 325
242 iso_pr_bacteria 2940325180 2940327632 325
243 iso_pr_bacteria 2940328985 2940331437 325
244 iso_pr_bacteria 2940332795 2940334934 325
245 3300010167 Ga0123353_10028381 Ga0123353_100283815 326
246 3300042590 Ga0466690_306403 Ga0466690_306403_11117_12097 326
247 3300042596 Ga0466696_394022 Ga0466696_394022_18216_19196 326
248 3300042599 Ga0466706_042414 Ga0466706_042414_8548_9528 326
249 3300042615 Ga0466711_041942 Ga0466711_041942_7452_8432 326
250 3300042615 Ga0466711_091753 Ga0466711_091753_7509_8489 326
251 3300042618 Ga0466723_154978 Ga0466723_154978_64611_65591 326
252 iso_pr_bacteria 2830041218 2830045124 326
253 iso_pr_bacteria 2940202316 2940202835 326
254 iso_pr_bacteria 3004672520 3004673571 326
255 3300005083 Ga0068305_10015691 Ga0068305_1001569113 327
256 3300042590 Ga0466690_134124 Ga0466690_134124_11149_12132 327
257 3300042593 Ga0466691_112917 Ga0466691_112917_244_1227 327
258 3300042605 Ga0466716_499732 Ga0466716_499732_2511_3494 327
259 3300042622 Ga0466731_090176 Ga0466731_090176_119_1102 327
260 3300042616 Ga0466715_471063 Ga0466715_471063_18024_19010 328
261 3300042624 Ga0466735_001520 Ga0466735_001520_4790_5779 329
262 3300042636 Ga0466703_374219 Ga0466703_374219_62_1051 329
263 3300042598 Ga0466701_035983 Ga0466701_035983_15690_16682 330
264 3300042624 Ga0466735_138394 Ga0466735_138394_1404_2396 330
265 3300042624 Ga0466735_198286 Ga0466735_198286_557_1549 330
266 3300000036 IMNBGM34_c007955 IMNBGM34_0079551 332
267 3300000062 IMNBL1DRAFT_c0028853 IMNBL1DRAFT_00288532 332
268 3300042620 Ga0466728_167295 Ga0466728_167295_2826_3830 334
269 3300042591 Ga0466692_090388 Ga0466692_090388_1936_2946 336
270 3300042619 Ga0466726_076133 Ga0466726_076133_41903_42913 336
271 3300042602 Ga0466713_047975 Ga0466713_047975_3855_4871 338
272 3300042603 Ga0466714_096045 Ga0466714_096045_9041_10057 338
273 3300042609 Ga0466722_069271 Ga0466722_069271_8319_9335 338
274 3300042608 Ga0466721_212652 Ga0466721_212652_15120_16139 339
275 3300042655 Ga0466727_028152 Ga0466727_028152_454_1473 339
276 3300042612 Ga0466705_284863 Ga0466705_284863_756_1778 340
277 3300042624 Ga0466735_089103 Ga0466735_089103_927_1949 340
278 3300042652 Ga0466708_044096 Ga0466708_044096_155_1186 343
279 3300042596 Ga0466696_101690 Ga0466696_101690_211_1257 348
280 iso_pr_bacteria 2910949487 2910951382 354
281 3300042624 Ga0466735_093892 Ga0466735_093892_1568_2638 356

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00480 ROK ROK family 42 350 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.