Protein Family IF08778

Metagenome Isolate
156 Members
53 Samples
149 Scaffolds
297.69 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_085051|Ga0466735_085051_455_1492
Length
345 aa
Sequence
VQKYVFFSLKNGLRYKRLKKNILNKKNVSLQFINLIKKNRRNYMSITKLDQILALVKTKSKKRVVAAYANDEHTIQALYLAIQEGIVDATLVGDEPTIAAVCKAHNFDIQKFKIVQEADENRAGGVAVSLINRGEGDILMKGLLSTDKYMRAILNKENGLMPGGKAVLSHVTVIETPKYHKLIICGDVAIIPAPDLNQKIAIANYLIKTAHALEIKNPKVAVIAATEQMLAGMPACVDAAIISKMADRNQIKGAIVDGPFSLDLALDMESAQIKKMTSEVAGDADCLLFPNIESGNIFYKCNTKLAGGELGAMVMGAKVPCILTSRGDSAKTKMYSIALAALTAK

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.8%
Kalotermitidae 26.4%
Unclassified 18.9%
Termopsidae 7.5%
Rhinotermitidae 5.7%
Passalidae 3.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
20 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
21 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
22 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
25 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
34 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
35 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
36 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
41 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
42 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_153484 3300042612 Bacteria 4965
2 2227591288 2225789004 Bacteria 47425
3 IMNBL1DRAFT_c0005512 3300000062 Bacteria 7211
4 JGI24695J34938_10095139 3300002450 Bacteria 1220
5 Ga0466694_341974 3300042594 Bacteria 2264
6 Ga0466696_196254 3300042596 Bacteria 8673
7 Ga0466711_208757 3300042615 Bacteria 7555
8 Ga0466726_297632 3300042619 Bacteria 2721
9 Ga0466728_444095 3300042620 Bacteria 3873
10 Ga0466729_193514 3300042621 Unclassified 2310
11 Ga0123353_10000426 3300010167 Bacteria 52111
12 Ga0123354_10182204 3300010882 Bacteria 2392
13 Ga0123354_10388637 3300010882 Bacteria 1195
14 Ga0466709_003919 3300042648 Bacteria 4480
15 Ga0466708_315337 3300042652 Bacteria 30097
16 Ga0466722_045711 3300042609 Bacteria 6163
17 Ga0068302_10038238 3300005071 Unclassified 1635
18 Ga0068305_10021076 3300005083 Bacteria 26083
19 Ga0068305_10564122 3300005083 Bacteria 2605
20 Ga0466690_080096 3300042590 Bacteria 3339
21 Ga0466690_089421 3300042590 Unclassified 11731
22 Ga0466690_305138 3300042590 Bacteria 11373
23 Ga0466690_345687 3300042590 Bacteria 26516
24 Ga0466692_020043 3300042591 Bacteria 3750
25 Ga0466692_124213 3300042591 Bacteria 5701
26 Ga0466691_032657 3300042593 Bacteria 10386
27 Ga0466696_080985 3300042596 Bacteria 38621
28 Ga0466711_291747 3300042615 Bacteria 2939
29 Ga0466723_136439 3300042618 Unclassified 2174
30 Ga0466729_031450 3300042621 Bacteria 2046
31 Ga0123353_10005558 3300010167 Bacteria 16577
32 Ga0466703_187804 3300042636 Bacteria 11577
33 Ga0466704_607630 3300042643 Bacteria 23830
34 Ga0466727_039285 3300042655 Bacteria 5079
35 Ga0466727_083036 3300042655 Bacteria 5986
36 Ga0466713_038863 3300042602 Bacteria 2990
37 Ga0466722_103228 3300042609 Bacteria 13192
38 Ga0466733_103016 3300042659 Bacteria 6307
39 Ga0466733_215393 3300042659 Bacteria 2475
40 Ga0466691_045556 3300042593 Bacteria 17407
41 Ga0466696_010048 3300042596 Bacteria 35433
42 Ga0466701_001178 3300042598 Bacteria 8236
43 Ga0466705_496275 3300042612 Bacteria 9091
44 Ga0466711_072994 3300042615 Bacteria 3875
45 Ga0466723_063021 3300042618 Bacteria 19255
46 Ga0123353_10290612 3300010167 Bacteria 2503
47 Ga0466704_499034 3300042643 Bacteria 46935
48 Ga0466704_571048 3300042643 Bacteria 19058
49 Ga0466709_094187 3300042648 Bacteria 75625
50 Ga0466701_032729 3300042598 Bacteria 33089
51 Ga0466707_411120 3300042601 Bacteria 3792
52 Ga0466713_003097 3300042602 Bacteria 4564
53 Ga0466714_108495 3300042603 Bacteria 1539
54 Ga0466719_325427 3300042606 Bacteria 1522
55 Ga0466722_053578 3300042609 Bacteria 8865
56 Ga0466705_196382 3300042612 Bacteria 3014
57 IMNBL1DRAFT_c0000751 3300000062 Bacteria 25684
58 IMNBL1DRAFT_c0029545 3300000062 Bacteria 2025
59 JGI24702J35022_10005226 3300002462 Bacteria 7610
60 JGI24702J35022_10028431 3300002462 Bacteria 3004
61 JGI24696J40584_12933164 3300002834 Bacteria 1515
62 JGI24696J40584_12961064 3300002834 Bacteria 10394
63 Ga0466695_049279 3300042595 Bacteria 12838
64 Ga0466699_147511 3300042597 Bacteria 1394
65 Ga0466711_369231 3300042615 Bacteria 4425
66 Ga0466726_215520 3300042619 Bacteria 2357
67 Ga0466729_033136 3300042621 Bacteria 4311
68 Ga0123356_10180909 3300010049 Unclassified 2130
69 Ga0123353_10345359 3300010167 Unclassified 2246
70 Ga0466708_174290 3300042652 Bacteria 6484
71 Ga0466706_280624 3300042599 Bacteria 4091
72 Ga0466713_102420 3300042602 Bacteria 24303
73 Ga0466720_238349 3300042607 Bacteria 4570
74 JGI24696J40584_12934553 3300002834 Unclassified 1542
75 Ga0466690_219540 3300042590 Bacteria 6967
76 Ga0466693_106704 3300042592 Unclassified 2164
77 Ga0466693_211907 3300042592 Bacteria 2296
78 Ga0466691_003533 3300042593 Unclassified 8640
79 Ga0466696_192329 3300042596 Bacteria 14138
80 Ga0466726_469380 3300042619 Bacteria 2704
81 Ga0466703_051943 3300042636 Bacteria 6677
82 Ga0466704_384308 3300042643 Unclassified 6130
83 Ga0466727_097267 3300042655 Bacteria 11860
84 Ga0466706_094835 3300042599 Bacteria 10682
85 Ga0466706_127998 3300042599 Bacteria 35830
86 IMNBL1DRAFT_c0007296 3300000062 Bacteria 5847
87 JGI24696J40584_12873447 3300002834 Unclassified 1055
88 JGI24696J40584_12961689 3300002834 Bacteria 37497
89 Ga0466690_112336 3300042590 Bacteria 10274
90 Ga0466690_129976 3300042590 Bacteria 12172
91 Ga0466693_023399 3300042592 Unclassified 1430
92 Ga0466694_236083 3300042594 Bacteria 2621
93 Ga0466710_099331 3300042613 Bacteria 1235
94 Ga0466718_029861 3300042617 Bacteria 1657
95 Ga0466726_282820 3300042619 Bacteria 2991
96 Ga0466726_413685 3300042619 Bacteria 2124
97 Ga0466703_265691 3300042636 Bacteria 4053
98 Ga0466727_240889 3300042655 Bacteria 4631
99 Ga0466706_169397 3300042599 Bacteria 4744
100 Ga0466705_054284 3300042612 Bacteria 22492
101 IMNBL1DRAFT_c0011283 3300000062 Bacteria 4189
102 IMNBL1DRAFT_c0012113 3300000062 Bacteria 3969
103 Ga0466690_105298 3300042590 Bacteria 2237
104 Ga0466696_005733 3300042596 Bacteria 17522
105 Ga0466696_215035 3300042596 Bacteria 4586
106 Ga0466696_231982 3300042596 Bacteria 3493
107 Ga0466699_008855 3300042597 Bacteria 1691
108 Ga0466715_008731 3300042616 Bacteria 1990
109 Ga0466715_009739 3300042616 Bacteria 69251
110 Ga0466715_154042 3300042616 Bacteria 17029
111 Ga0466715_263327 3300042616 Bacteria 12358
112 Ga0466726_332421 3300042619 Bacteria 11158
113 Ga0466728_043613 3300042620 Bacteria 6797
114 Ga0466728_076470 3300042620 Bacteria 13064
115 Ga0466728_086057 3300042620 Bacteria 7597
116 Ga0466729_103195 3300042621 Bacteria 2398
117 Ga0123355_10000308 3300009826 Bacteria 62784
118 Ga0123355_10002877 3300009826 Bacteria 24450
119 Ga0123353_10011017 3300010167 Bacteria 12693
120 Ga0123353_10201507 3300010167 Bacteria 3130
121 Ga0466704_500113 3300042643 Unclassified 4803
122 Ga0466709_204440 3300042648 Bacteria 87623
123 Ga0466727_248912 3300042655 Unclassified 1887
124 Ga0466706_209610 3300042599 Bacteria 69562
125 Ga0466700_434979 3300042600 Bacteria 2379
126 Ga0466719_401571 3300042606 Bacteria 16231
127 Ga0466722_031905 3300042609 Bacteria 36244
128 Ga0466705_059486 3300042612 Bacteria 10161
129 Ga0466733_111686 3300042659 Bacteria 1649
130 2227483819 2225789004 Bacteria 4334
131 Ga0466690_089517 3300042590 Bacteria 5773
132 Ga0466690_091861 3300042590 Bacteria 8994
133 Ga0466696_245977 3300042596 Bacteria 18314
134 Ga0466712_300862 3300042614 Bacteria 1124
135 Ga0466711_434272 3300042615 Bacteria 3815
136 Ga0466715_004531 3300042616 Bacteria 37567
137 Ga0466723_179062 3300042618 Bacteria 9608
138 Ga0466726_367347 3300042619 Bacteria 1547
139 Ga0466728_120445 3300042620 Unclassified 1256
140 Ga0466735_085051 3300042624 Bacteria 2599
141 Ga0466703_300757 3300042636 Bacteria 6211
142 Ga0466709_041701 3300042648 Bacteria 32131
143 Ga0466709_216743 3300042648 Bacteria 57156
144 Ga0466708_199202 3300042652 Bacteria 16986
145 Ga0466708_232096 3300042652 Bacteria 10708
146 Ga0466706_021441 3300042599 Bacteria 78920
147 Ga0466716_469531 3300042605 Bacteria 2461
148 Ga0466719_445989 3300042606 Bacteria 3448
149 Ga0466722_027014 3300042609 Bacteria 9008

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_215520 Ga0466726_215520_46_792 248
2 3300042590 Ga0466690_080096 Ga0466690_080096_1775_2605 276
3 3300042620 Ga0466728_076470 Ga0466728_076470_5189_6094 276
4 3300042618 Ga0466723_136439 Ga0466723_136439_207_1106 277
5 3300042618 Ga0466723_179062 Ga0466723_179062_1762_2661 278
6 3300042648 Ga0466709_003919 Ga0466709_003919_1574_2473 278
7 3300042590 Ga0466690_105298 Ga0466690_105298_308_1216 279
8 3300042606 Ga0466719_445989 Ga0466719_445989_1216_2115 279
9 3300042590 Ga0466690_089421 Ga0466690_089421_8632_9543 280
10 3300042616 Ga0466715_008731 Ga0466715_008731_649_1548 280
11 3300042616 Ga0466715_154042 Ga0466715_154042_13754_14653 280
12 3300042655 Ga0466727_248912 Ga0466727_248912_812_1654 280
13 3300042620 Ga0466728_043613 Ga0466728_043613_2556_3455 281
14 3300042636 Ga0466703_187804 Ga0466703_187804_9056_9955 281
15 3300042643 Ga0466704_499034 Ga0466704_499034_1613_2515 281
16 2225789004 2227483819 2227947597 282
17 3300042590 Ga0466690_305138 Ga0466690_305138_1622_2521 282
18 3300042596 Ga0466696_080985 Ga0466696_080985_30415_31314 282
19 3300042615 Ga0466711_291747 Ga0466711_291747_636_1535 282
20 3300042636 Ga0466703_265691 Ga0466703_265691_1370_2269 282
21 3300000062 IMNBL1DRAFT_c0005512 IMNBL1DRAFT_00055125 283
22 3300042655 Ga0466727_097267 Ga0466727_097267_5455_6357 283
23 3300042636 Ga0466703_300757 Ga0466703_300757_354_1274 285
24 3300042612 Ga0466705_054284 Ga0466705_054284_11591_12511 286
25 3300042643 Ga0466704_571048 Ga0466704_571048_1721_2641 286
26 3300042615 Ga0466711_208757 Ga0466711_208757_2206_3117 288
27 3300042636 Ga0466703_051943 Ga0466703_051943_2011_2910 292
28 3300042652 Ga0466708_174290 Ga0466708_174290_1300_2211 292
29 iso_pr_bacteria 2820744581 2820746633 294
30 3300042590 Ga0466690_091861 Ga0466690_091861_1453_2349 298
31 3300042590 Ga0466690_129976 Ga0466690_129976_2019_2915 298
32 3300042592 Ga0466693_023399 Ga0466693_023399_28_924 298
33 3300042592 Ga0466693_211907 Ga0466693_211907_841_1737 298
34 3300042593 Ga0466691_003533 Ga0466691_003533_1307_2203 298
35 3300042598 Ga0466701_032729 Ga0466701_032729_10340_11236 298
36 3300042607 Ga0466720_238349 Ga0466720_238349_504_1400 298
37 iso_pr_bacteria 2820797595 2820798778 298
38 3300002462 JGI24702J35022_10028431 JGI24702J35022_100284312 299
39 3300002834 JGI24696J40584_12873447 JGI24696J40584_128734471 299
40 3300002834 JGI24696J40584_12933164 JGI24696J40584_129331641 299
41 3300002834 JGI24696J40584_12934553 JGI24696J40584_129345531 299
42 3300002834 JGI24696J40584_12961064 JGI24696J40584_129610642 299
43 3300002834 JGI24696J40584_12961689 JGI24696J40584_129616892 299
44 3300010167 Ga0123353_10005558 Ga0123353_100055583 299
45 3300042590 Ga0466690_345687 Ga0466690_345687_8396_9295 299
46 3300042591 Ga0466692_124213 Ga0466692_124213_3717_4616 299
47 3300042593 Ga0466691_032657 Ga0466691_032657_7893_8792 299
48 3300042596 Ga0466696_196254 Ga0466696_196254_6334_7233 299
49 3300042596 Ga0466696_231982 Ga0466696_231982_1059_1958 299
50 3300042606 Ga0466719_325427 Ga0466719_325427_109_1008 299
51 3300042606 Ga0466719_401571 Ga0466719_401571_14658_15557 299
52 3300042609 Ga0466722_027014 Ga0466722_027014_6369_7268 299
53 3300042612 Ga0466705_153484 Ga0466705_153484_3975_4874 299
54 3300042616 Ga0466715_263327 Ga0466715_263327_7871_8770 299
55 3300042619 Ga0466726_282820 Ga0466726_282820_502_1401 299
56 3300042619 Ga0466726_469380 Ga0466726_469380_243_1142 299
57 3300042620 Ga0466728_086057 Ga0466728_086057_2290_3189 299
58 3300042643 Ga0466704_500113 Ga0466704_500113_3437_4336 299
59 3300042648 Ga0466709_204440 Ga0466709_204440_72519_73418 299
60 3300042652 Ga0466708_199202 Ga0466708_199202_12242_13141 299
61 3300042652 Ga0466708_315337 Ga0466708_315337_21513_22412 299
62 3300042655 Ga0466727_039285 Ga0466727_039285_2079_2978 299
63 3300042655 Ga0466727_083036 Ga0466727_083036_1347_2246 299
64 3300000062 IMNBL1DRAFT_c0007296 IMNBL1DRAFT_00072962 300
65 3300005071 Ga0068302_10038238 Ga0068302_100382381 300
66 3300042591 Ga0466692_020043 Ga0466692_020043_395_1297 300
67 3300042597 Ga0466699_147511 Ga0466699_147511_187_1089 300
68 3300042601 Ga0466707_411120 Ga0466707_411120_2206_3108 300
69 3300042602 Ga0466713_102420 Ga0466713_102420_13386_14288 300
70 3300042609 Ga0466722_031905 Ga0466722_031905_8232_9134 300
71 3300042612 Ga0466705_496275 Ga0466705_496275_1041_1943 300
72 3300042615 Ga0466711_369231 Ga0466711_369231_846_1748 300
73 3300042619 Ga0466726_297632 Ga0466726_297632_1667_2569 300
74 3300042619 Ga0466726_367347 Ga0466726_367347_494_1396 300
75 3300042619 Ga0466726_413685 Ga0466726_413685_595_1497 300
76 3300042621 Ga0466729_033136 Ga0466729_033136_503_1405 300
77 3300042621 Ga0466729_103195 Ga0466729_103195_1165_2067 300
78 3300042621 Ga0466729_193514 Ga0466729_193514_1059_1961 300
79 2225789004 2227591288 2228150836 301
80 3300042595 Ga0466695_049279 Ga0466695_049279_6272_7177 301
81 3300042596 Ga0466696_005733 Ga0466696_005733_10922_11827 301
82 3300042596 Ga0466696_010048 Ga0466696_010048_31382_32287 301
83 3300042599 Ga0466706_094835 Ga0466706_094835_9478_10383 301
84 3300042599 Ga0466706_169397 Ga0466706_169397_370_1275 301
85 3300042600 Ga0466700_434979 Ga0466700_434979_922_1827 301
86 3300042602 Ga0466713_038863 Ga0466713_038863_418_1323 301
87 3300042603 Ga0466714_108495 Ga0466714_108495_461_1366 301
88 3300042605 Ga0466716_469531 Ga0466716_469531_158_1063 301
89 3300042613 Ga0466710_099331 Ga0466710_099331_110_1015 301
90 3300042615 Ga0466711_434272 Ga0466711_434272_1947_2852 301
91 3300042616 Ga0466715_009739 Ga0466715_009739_43337_44242 301
92 3300042620 Ga0466728_444095 Ga0466728_444095_435_1340 301
93 3300042648 Ga0466709_041701 Ga0466709_041701_4291_5196 301
94 3300042648 Ga0466709_094187 Ga0466709_094187_62639_63544 301
95 3300042655 Ga0466727_240889 Ga0466727_240889_3269_4174 301
96 3300042659 Ga0466733_103016 Ga0466733_103016_3765_4670 301
97 3300042659 Ga0466733_111686 Ga0466733_111686_553_1458 301
98 3300042659 Ga0466733_215393 Ga0466733_215393_269_1174 301
99 iso_pr_bacteria 2820746860 2820747711 301
100 iso_pr_bacteria 2820770630 2820771766 301
101 iso_pr_bacteria 2820785563 2820786792 301
102 iso_pr_bacteria 2820788205 2820788781 301
103 3300000062 IMNBL1DRAFT_c0000751 IMNBL1DRAFT_00007514 302
104 3300000062 IMNBL1DRAFT_c0011283 IMNBL1DRAFT_00112832 302
105 3300009826 Ga0123355_10000308 Ga0123355_1000030820 302
106 3300009826 Ga0123355_10002877 Ga0123355_1000287715 302
107 3300010167 Ga0123353_10000426 Ga0123353_1000042615 302
108 3300010167 Ga0123353_10011017 Ga0123353_100110172 302
109 3300010167 Ga0123353_10201507 Ga0123353_102015073 302
110 3300042590 Ga0466690_089517 Ga0466690_089517_1033_1941 302
111 3300042590 Ga0466690_112336 Ga0466690_112336_5097_6005 302
112 3300042590 Ga0466690_219540 Ga0466690_219540_4735_5643 302
113 3300042592 Ga0466693_106704 Ga0466693_106704_201_1109 302
114 3300042593 Ga0466691_045556 Ga0466691_045556_4806_5714 302
115 3300042594 Ga0466694_236083 Ga0466694_236083_629_1537 302
116 3300042594 Ga0466694_341974 Ga0466694_341974_1225_2133 302
117 3300042596 Ga0466696_215035 Ga0466696_215035_1868_2776 302
118 3300042597 Ga0466699_008855 Ga0466699_008855_77_985 302
119 3300042598 Ga0466701_001178 Ga0466701_001178_5012_5920 302
120 3300042599 Ga0466706_127998 Ga0466706_127998_33087_33995 302
121 3300042602 Ga0466713_003097 Ga0466713_003097_2707_3615 302
122 3300042609 Ga0466722_053578 Ga0466722_053578_2619_3527 302
123 3300042612 Ga0466705_059486 Ga0466705_059486_4914_5822 302
124 3300042614 Ga0466712_300862 Ga0466712_300862_28_936 302
125 3300042616 Ga0466715_004531 Ga0466715_004531_22023_22931 302
126 3300042617 Ga0466718_029861 Ga0466718_029861_656_1564 302
127 3300042618 Ga0466723_063021 Ga0466723_063021_13737_14645 302
128 3300042619 Ga0466726_332421 Ga0466726_332421_1588_2496 302
129 3300042620 Ga0466728_120445 Ga0466728_120445_121_1029 302
130 3300042621 Ga0466729_031450 Ga0466729_031450_27_935 302
131 3300042643 Ga0466704_384308 Ga0466704_384308_3189_4097 302
132 3300042643 Ga0466704_607630 Ga0466704_607630_5496_6404 302
133 3300042648 Ga0466709_216743 Ga0466709_216743_53051_53959 302
134 3300042652 Ga0466708_232096 Ga0466708_232096_5071_5979 302
135 iso_pr_bacteria 2820737921 2820738912 302
136 3300000062 IMNBL1DRAFT_c0012113 IMNBL1DRAFT_00121134 303
137 3300000062 IMNBL1DRAFT_c0029545 IMNBL1DRAFT_00295452 303
138 3300002450 JGI24695J34938_10095139 JGI24695J34938_100951392 303
139 3300002462 JGI24702J35022_10005226 JGI24702J35022_100052262 303
140 3300005083 Ga0068305_10021076 Ga0068305_100210764 303
141 3300005083 Ga0068305_10564122 Ga0068305_105641221 303
142 3300010049 Ga0123356_10180909 Ga0123356_101809092 303
143 3300010167 Ga0123353_10290612 Ga0123353_102906122 303
144 3300010167 Ga0123353_10345359 Ga0123353_103453592 303
145 3300010882 Ga0123354_10182204 Ga0123354_101822042 303
146 3300010882 Ga0123354_10388637 Ga0123354_103886371 303
147 3300042596 Ga0466696_245977 Ga0466696_245977_13548_14459 303
148 3300042599 Ga0466706_021441 Ga0466706_021441_36216_37127 303
149 3300042599 Ga0466706_209610 Ga0466706_209610_30015_30926 303
150 3300042599 Ga0466706_280624 Ga0466706_280624_783_1694 303
151 3300042609 Ga0466722_045711 Ga0466722_045711_188_1099 303
152 3300042609 Ga0466722_103228 Ga0466722_103228_3090_4001 303
153 3300042596 Ga0466696_192329 Ga0466696_192329_8830_9744 304
154 3300042615 Ga0466711_072994 Ga0466711_072994_926_1849 307
155 3300042612 Ga0466705_196382 Ga0466705_196382_695_1693 332
156 3300042624 Ga0466735_085051 Ga0466735_085051_455_1492 345

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01515 PTA_PTB Phosphate acetyl/butaryl transferase 126 341 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01515 GO:0016746 acyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.