Protein Family IF08772

Metagenome Isolate
144 Members
50 Samples
125 Scaffolds
448.31 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_074441|Ga0466735_074441_4233_5720
Length
495 aa
Sequence
MEQFANIVSTIDGWLWGPWVLVWILPLTHVFMTVRTGFIQKKLLLGIKLSVTKDADGTGDVSQFGALTTALAATIGTGNIXXXXTAIARGGPGAVLWMWLMGVFGIATKYAESLIAVKYRVRTEDGTMLGGAMYALERGLKMKWLGVLFAVFAALASFGIGNGVQANAVATLLNETAPISITLTGIVNGDLGRSSVEIPIYITQLVAGAVMAVLVGMVILGGIKSISKVCIALVPFMALFYVFGCIVILVINHSYIFPAIALICKSAFSSDAATGGFVGFALSKAIQFGFSRGLFSNESGMGSAPIVAAAAKTRNPVRQALVSSTGTFWDTVLICLITGIVIISTVLAHPEINTGVVNGATLTHNAFMQITGFGPFVLTVALIVFAFSTILGWSYYGERCVAYLFGSKIIRNYRIIFVLVVFIGAIAPLDLAWNISDILNGLMTLPNIIAMILLSGVIAKETKKYLNNIDAIDADAIPLRTELIVKSKKGISSKE

📊 Sample Types

Isolate 12.5%
Metagenome 87.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 28.6%
Kalotermitidae 28.6%
Termitidae 16.3%
Rhinotermitidae 8.2%
Termopsidae 6.1%
Unclassified 6.1%
Passalidae 4.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
10 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
11 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
17 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
20 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
21 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
22 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
23 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
24 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
32 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
48 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_080173 3300042624 Bacteria 1417
2 Ga0466704_069484 3300042643 Bacteria 11775
3 Ga0466704_092710 3300042643 Bacteria 12460
4 Ga0466704_353863 3300042643 Bacteria 5701
5 Ga0466727_247762 3300042655 Unclassified 5079
6 Ga0466727_266312 3300042655 Bacteria 2213
7 IMNBL1DRAFT_c0001114 3300000062 Bacteria 20562
8 Ga0466707_209925 3300042601 Unclassified 13553
9 Ga0466716_153987 3300042605 Bacteria 7351
10 Ga0466716_156505 3300042605 Bacteria 5088
11 Ga0466723_167541 3300042618 Bacteria 38557
12 Ga0466726_066455 3300042619 Bacteria 1702
13 Ga0466726_414479 3300042619 Bacteria 2091
14 Ga0456237_0001752 3300041968 Bacteria 3493
15 Ga0466692_163242 3300042591 Bacteria 2842
16 Ga0466691_158932 3300042593 Bacteria 22865
17 Ga0466705_024358 3300042612 Bacteria 8180
18 Ga0466705_083381 3300042612 Unclassified 14794
19 Ga0466705_297989 3300042612 Bacteria 13597
20 Ga0466704_239830 3300042643 Bacteria 1970
21 Ga0466709_063956 3300042648 Bacteria 51970
22 Ga0466727_095483 3300042655 Bacteria 2039
23 2227471840 2225789004 Bacteria 23628
24 Ga0466707_050143 3300042601 Bacteria 47469
25 Ga0466718_002314 3300042617 Bacteria 3295
26 Ga0466726_086537 3300042619 Bacteria 2211
27 Ga0466690_030460 3300042590 Unclassified 2488
28 Ga0466690_097433 3300042590 Bacteria 2195
29 Ga0466690_251294 3300042590 Bacteria 2707
30 Ga0466690_428655 3300042590 Bacteria 3195
31 Ga0466729_217761 3300042621 Bacteria 50786
32 Ga0466703_314025 3300042636 Bacteria 11407
33 Ga0466703_389215 3300042636 Bacteria 42403
34 2227158567 2225789004 Bacteria 8427
35 2227485756 2225789004 Bacteria 21150
36 AustNasuHG_c1000218 3300000089 Bacteria 19111
37 Ga0068305_10024037 3300005083 Unclassified 12122
38 Ga0466706_175662 3300042599 Bacteria 3937
39 Ga0466713_027922 3300042602 Bacteria 99091
40 Ga0466720_076660 3300042607 Bacteria 19001
41 Ga0466711_178331 3300042615 Bacteria 10418
42 Ga0466715_134057 3300042616 Bacteria 12584
43 Ga0466715_561450 3300042616 Bacteria 11347
44 Ga0466726_098213 3300042619 Bacteria 3321
45 Ga0466726_228104 3300042619 Bacteria 6535
46 Ga0264413_103863 3300024493 Bacteria 13916
47 Ga0466690_082146 3300042590 Bacteria 2590
48 Ga0466691_035184 3300042593 Bacteria 9555
49 Ga0466691_141392 3300042593 Bacteria 3504
50 Ga0466735_074441 3300042624 Bacteria 13324
51 Ga0466703_048543 3300042636 Bacteria 11129
52 Ga0466703_420457 3300042636 Bacteria 2589
53 Ga0466704_251062 3300042643 Bacteria 2991
54 Ga0466709_126675 3300042648 Bacteria 69442
55 Ga0466708_347213 3300042652 Bacteria 2136
56 Ga0466727_139194 3300042655 Bacteria 19736
57 Ga0068305_10012225 3300005083 Bacteria 7074
58 Ga0074263_104116 3300005485 Bacteria 2536
59 Ga0466707_064034 3300042601 Unclassified 8248
60 Ga0466707_188924 3300042601 Bacteria 7766
61 Ga0466716_140831 3300042605 Bacteria 6819
62 Ga0466720_225752 3300042607 Bacteria 13816
63 Ga0466722_166494 3300042609 Bacteria 11065
64 Ga0466723_312197 3300042618 Bacteria 11558
65 Ga0466690_052917 3300042590 Unclassified 10043
66 Ga0466694_087954 3300042594 Bacteria 6826
67 Ga0466705_329237 3300042612 Unclassified 4332
68 Ga0466732_144242 3300042656 Bacteria 5065
69 Ga0466708_273759 3300042652 Bacteria 6692
70 JGI24698J34947_10016327 3300002449 Bacteria 4029
71 Ga0466720_081271 3300042607 Bacteria 11222
72 Ga0466722_083728 3300042609 Archaea 5498
73 Ga0466722_126456 3300042609 Bacteria 11948
74 Ga0466722_245527 3300042609 Bacteria 3091
75 Ga0466723_190796 3300042618 Bacteria 36065
76 Ga0466696_053753 3300042596 Bacteria 23190
77 Ga0466704_333902 3300042643 Bacteria 5799
78 Ga0466704_533539 3300042643 Unclassified 1905
79 Ga0466704_547421 3300042643 Unclassified 5047
80 Ga0466708_042747 3300042652 Bacteria 6856
81 Ga0466708_189631 3300042652 Bacteria 13277
82 JGI24698J34947_10033833 3300002449 Unclassified 2679
83 Ga0466707_181235 3300042601 Bacteria 4322
84 Ga0466716_162737 3300042605 Unclassified 1415
85 Ga0466719_050328 3300042606 Bacteria 9303
86 Ga0466719_104333 3300042606 Bacteria 1518
87 Ga0466722_208582 3300042609 Bacteria 6537
88 Ga0466715_231994 3300042616 Bacteria 116561
89 Ga0466718_124206 3300042617 Bacteria 3872
90 Ga0466723_081892 3300042618 Bacteria 3524
91 Ga0466723_157059 3300042618 Bacteria 28946
92 Ga0466726_013733 3300042619 Bacteria 3156
93 Ga0466726_086229 3300042619 Bacteria 3280
94 Ga0264413_114603 3300024493 Bacteria 3497
95 Ga0466699_370719 3300042597 Bacteria 2096
96 Ga0466704_111979 3300042643 Bacteria 2534
97 Ga0466704_133979 3300042643 Bacteria 31511
98 Ga0466704_551181 3300042643 Bacteria 3972
99 Ga0466727_176063 3300042655 Bacteria 1757
100 Ga0068305_10087375 3300005083 Bacteria 5435
101 Ga0466706_221283 3300042599 Bacteria 43471
102 Ga0466713_000549 3300042602 Bacteria 6653
103 Ga0466713_075763 3300042602 Bacteria 37516
104 Ga0466716_187708 3300042605 Bacteria 2019
105 Ga0466722_239349 3300042609 Bacteria 5086
106 Ga0466705_423846 3300042612 Bacteria 6421
107 Ga0466711_360309 3300042615 Bacteria 3458
108 Ga0466715_239863 3300042616 Bacteria 10056
109 Ga0466692_082541 3300042591 Bacteria 22010
110 Ga0466708_399382 3300042652 Bacteria 34348
111 Ga0466727_228411 3300042655 Bacteria 2132
112 AustNasuHG_c1014419 3300000089 Bacteria 2689
113 Ga0466713_153672 3300042602 Unclassified 7006
114 Ga0466716_027124 3300042605 Bacteria 1818
115 Ga0466716_382194 3300042605 Bacteria 4604
116 Ga0466719_069854 3300042606 Bacteria 6615
117 Ga0466720_021337 3300042607 Bacteria 9772
118 Ga0466720_022537 3300042607 Bacteria 11283
119 Ga0466722_039326 3300042609 Bacteria 5870
120 Ga0466722_156644 3300042609 Bacteria 1891
121 Ga0466715_412803 3300042616 Bacteria 5673
122 Ga0466723_108600 3300042618 Bacteria 8461
123 Ga0466728_121185 3300042620 Bacteria 4944
124 Ga0466696_077829 3300042596 Bacteria 45805
125 Ga0466696_424707 3300042596 Bacteria 44406

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_187708 Ga0466716_187708_874_1995 363
2 3300042643 Ga0466704_533539 Ga0466704_533539_40_1134 364
3 3300042643 Ga0466704_251062 Ga0466704_251062_40_1137 365
4 3300005083 Ga0068305_10087375 Ga0068305_100873755 375
5 3300042624 Ga0466735_080173 Ga0466735_080173_56_1345 409
6 3300042605 Ga0466716_027124 Ga0466716_027124_208_1458 410
7 3300042605 Ga0466716_162737 Ga0466716_162737_77_1369 411
8 3300042655 Ga0466727_095483 Ga0466727_095483_285_1670 412
9 3300042655 Ga0466727_139194 Ga0466727_139194_15470_16843 413
10 3300042590 Ga0466690_097433 Ga0466690_097433_138_1520 416
11 3300042606 Ga0466719_104333 Ga0466719_104333_83_1366 418
12 3300042605 Ga0466716_153987 Ga0466716_153987_1259_2641 422
13 3300042648 Ga0466709_063956 Ga0466709_063956_15752_17134 422
14 3300042655 Ga0466727_176063 Ga0466727_176063_378_1706 425
15 3300042643 Ga0466704_069484 Ga0466704_069484_3346_4728 427
16 3300042652 Ga0466708_042747 Ga0466708_042747_4488_5870 427
17 3300042643 Ga0466704_111979 Ga0466704_111979_543_1925 429
18 3300042619 Ga0466726_066455 Ga0466726_066455_62_1456 432
19 3300042652 Ga0466708_273759 Ga0466708_273759_5116_6519 433
20 3300042655 Ga0466727_266312 Ga0466727_266312_351_1733 433
21 3300042619 Ga0466726_098213 Ga0466726_098213_446_1840 434
22 3300000089 AustNasuHG_c1000218 AustNasuHG_100021816 435
23 3300042606 Ga0466719_050328 Ga0466719_050328_5697_7079 436
24 3300042594 Ga0466694_087954 Ga0466694_087954_3283_4680 437
25 3300042605 Ga0466716_156505 Ga0466716_156505_2753_4135 437
26 3300042597 Ga0466699_370719 Ga0466699_370719_105_1502 438
27 3300042618 Ga0466723_108600 Ga0466723_108600_1276_2658 438
28 3300002449 JGI24698J34947_10016327 JGI24698J34947_100163274 439
29 3300042618 Ga0466723_190796 Ga0466723_190796_23331_24710 439
30 3300042619 Ga0466726_013733 Ga0466726_013733_692_2065 439
31 3300042619 Ga0466726_414479 Ga0466726_414479_304_1689 439
32 3300042602 Ga0466713_000549 Ga0466713_000549_2266_3588 440
33 3300042655 Ga0466727_247762 Ga0466727_247762_2801_4207 440
34 3300024493 Ga0264413_114603 Ga0264413_1146032 441
35 3300042590 Ga0466690_428655 Ga0466690_428655_340_1722 441
36 3300042593 Ga0466691_035184 Ga0466691_035184_4574_5956 441
37 3300042596 Ga0466696_053753 Ga0466696_053753_1408_2790 441
38 3300042605 Ga0466716_140831 Ga0466716_140831_3692_5074 441
39 3300042612 Ga0466705_083381 Ga0466705_083381_13184_14566 441
40 3300042612 Ga0466705_329237 Ga0466705_329237_2763_4145 441
41 3300042617 Ga0466718_002314 Ga0466718_002314_1501_2883 441
42 3300042636 Ga0466703_314025 Ga0466703_314025_2059_3441 441
43 3300042643 Ga0466704_092710 Ga0466704_092710_4513_5895 441
44 3300042643 Ga0466704_239830 Ga0466704_239830_510_1892 441
45 3300042643 Ga0466704_353863 Ga0466704_353863_635_2017 441
46 3300042655 Ga0466727_228411 Ga0466727_228411_556_1941 441
47 3300042605 Ga0466716_382194 Ga0466716_382194_338_1720 442
48 3300042607 Ga0466720_225752 Ga0466720_225752_7184_8590 442
49 3300042612 Ga0466705_297989 Ga0466705_297989_4896_6281 442
50 3300042612 Ga0466705_423846 Ga0466705_423846_3505_4887 442
51 3300042619 Ga0466726_228104 Ga0466726_228104_3786_5171 442
52 3300042643 Ga0466704_333902 Ga0466704_333902_1250_2632 442
53 3300042643 Ga0466704_547421 Ga0466704_547421_2423_3805 442
54 3300042596 Ga0466696_077829 Ga0466696_077829_41306_42688 443
55 3300042599 Ga0466706_221283 Ga0466706_221283_39279_40661 443
56 3300042612 Ga0466705_024358 Ga0466705_024358_314_1696 443
57 3300042618 Ga0466723_312197 Ga0466723_312197_1875_3257 443
58 3300042636 Ga0466703_389215 Ga0466703_389215_22087_23472 443
59 3300042593 Ga0466691_158932 Ga0466691_158932_18935_20332 444
60 3300042609 Ga0466722_039326 Ga0466722_039326_532_1923 444
61 3300042596 Ga0466696_424707 Ga0466696_424707_27955_29361 445
62 3300042618 Ga0466723_167541 Ga0466723_167541_9355_10692 445
63 3300000089 AustNasuHG_c1014419 AustNasuHG_10144192 446
64 3300042643 Ga0466704_133979 Ga0466704_133979_25687_27084 446
65 3300042643 Ga0466704_551181 Ga0466704_551181_247_1644 446
66 3300042616 Ga0466715_239863 Ga0466715_239863_5385_6782 447
67 3300042636 Ga0466703_048543 Ga0466703_048543_225_1625 447
68 3300041968 Ga0456237_0001752 Ga0456237_0001752_793_2190 448
69 3300042590 Ga0466690_030460 Ga0466690_030460_358_1755 448
70 3300024493 Ga0264413_103863 Ga0264413_1038635 449
71 3300042601 Ga0466707_209925 Ga0466707_209925_2694_4079 449
72 3300042602 Ga0466713_027922 Ga0466713_027922_25441_26826 449
73 3300042602 Ga0466713_153672 Ga0466713_153672_5154_6539 449
74 3300042616 Ga0466715_231994 Ga0466715_231994_107675_109060 449
75 3300005083 Ga0068305_10024037 Ga0068305_100240376 450
76 3300042601 Ga0466707_188924 Ga0466707_188924_2466_3875 451
77 3300042607 Ga0466720_021337 Ga0466720_021337_4242_5633 451
78 3300042607 Ga0466720_022537 Ga0466720_022537_4884_6272 451
79 3300042607 Ga0466720_076660 Ga0466720_076660_13020_14411 451
80 3300042609 Ga0466722_156644 Ga0466722_156644_218_1612 451
81 3300042619 Ga0466726_086229 Ga0466726_086229_1799_3205 451
82 3300002449 JGI24698J34947_10033833 JGI24698J34947_100338332 452
83 3300042621 Ga0466729_217761 Ga0466729_217761_16414_17802 452
84 3300042601 Ga0466707_050143 Ga0466707_050143_44297_45709 453
85 3300042617 Ga0466718_124206 Ga0466718_124206_461_1858 453
86 3300042590 Ga0466690_052917 Ga0466690_052917_317_1717 455
87 3300042606 Ga0466719_069854 Ga0466719_069854_4692_6098 455
88 3300042648 Ga0466709_126675 Ga0466709_126675_14934_16319 455
89 2225789004 2227485756 2227951773 456
90 3300042616 Ga0466715_134057 Ga0466715_134057_3458_4861 456
91 3300042616 Ga0466715_412803 Ga0466715_412803_4252_5652 457
92 2225789004 2227158567 2227567125 458
93 3300042602 Ga0466713_075763 Ga0466713_075763_22674_24050 458
94 3300042615 Ga0466711_360309 Ga0466711_360309_1794_3197 458
95 3300042590 Ga0466690_082146 Ga0466690_082146_223_1620 459
96 3300042590 Ga0466690_251294 Ga0466690_251294_891_2291 459
97 3300042591 Ga0466692_163242 Ga0466692_163242_1353_2765 459
98 3300042609 Ga0466722_245527 Ga0466722_245527_979_2388 459
99 3300042636 Ga0466703_420457 Ga0466703_420457_131_1561 459
100 2225789004 2227471840 2227918434 460
101 3300042615 Ga0466711_178331 Ga0466711_178331_4146_5552 461
102 iso_pr_bacteria 2940264388 2940264800 461
103 iso_pr_bacteria 2940267548 2940267960 461
104 iso_pr_bacteria 2940270707 2940271119 461
105 iso_pr_bacteria 2940273867 2940274286 461
106 3300000062 IMNBL1DRAFT_c0001114 IMNBL1DRAFT_000111414 463
107 3300005485 Ga0074263_104116 Ga0074263_1041162 463
108 3300042609 Ga0466722_083728 Ga0466722_083728_2313_3704 463
109 3300042607 Ga0466720_081271 Ga0466720_081271_6111_7505 464
110 3300042652 Ga0466708_189631 Ga0466708_189631_497_1891 464
111 3300042601 Ga0466707_064034 Ga0466707_064034_4869_6266 465
112 3300042618 Ga0466723_081892 Ga0466723_081892_2110_3507 465
113 3300042652 Ga0466708_399382 Ga0466708_399382_927_2324 465
114 3300005083 Ga0068305_10012225 Ga0068305_100122255 466
115 3300042593 Ga0466691_141392 Ga0466691_141392_82_1482 466
116 3300042609 Ga0466722_166494 Ga0466722_166494_2353_3753 466
117 3300042618 Ga0466723_157059 Ga0466723_157059_746_2146 466
118 3300042620 Ga0466728_121185 Ga0466728_121185_484_1884 466
119 3300005083 Ga0068305_10012225 Ga0068305_100122254 467
120 iso_pr_bacteria 2940264388 2940264574 467
121 iso_pr_bacteria 2940267548 2940267649 467
122 iso_pr_bacteria 2940270707 2940270808 467
123 iso_pr_bacteria 2940273867 2940274053 467
124 3300042601 Ga0466707_181235 Ga0466707_181235_2702_4108 468
125 3300042616 Ga0466715_561450 Ga0466715_561450_264_1670 468
126 3300042619 Ga0466726_086537 Ga0466726_086537_663_2069 468
127 3300042652 Ga0466708_347213 Ga0466708_347213_553_1959 468
128 3300042656 Ga0466732_144242 Ga0466732_144242_374_1780 468
129 iso_pr_bacteria 2940230426 2940231064 470
130 iso_pr_bacteria 2940233634 2940234269 470
131 iso_pr_bacteria 2940277027 2940279186 470
132 iso_pr_bacteria 2940280053 2940282404 470
133 iso_pr_bacteria 2940283334 2940284135 470
134 iso_pr_bacteria 2940286528 2940286811 470
135 iso_pr_bacteria 2940289514 2940289977 470
136 iso_pr_bacteria 2940292506 2940292828 470
137 iso_pr_bacteria 2940295490 2940295953 470
138 iso_pr_bacteria 2944625312 2944627612 470
139 3300042599 Ga0466706_175662 Ga0466706_175662_1959_3374 471
140 3300042609 Ga0466722_126456 Ga0466722_126456_5316_6824 471
141 3300042609 Ga0466722_239349 Ga0466722_239349_1926_3392 480
142 3300042591 Ga0466692_082541 Ga0466692_082541_204_1685 493
143 3300042624 Ga0466735_074441 Ga0466735_074441_4233_5720 495
144 3300042609 Ga0466722_208582 Ga0466722_208582_1046_2563 505

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01235 Na_Ala_symp Sodium:alanine symporter family 52 469 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.