Protein Family IF08770

Metagenome Isolate
142 Members
48 Samples
136 Scaffolds
119.65 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_074091|Ga0466735_074091_1307_1771
Length
154 aa
Sequence
VNNTVNTFVSGRAGEDKAAAYLENAGLSIIARNFRGRGGEIDLIALEGGTNPADLGAKPAAWPMEGLQGENSRLCPAGAAPQTLVFVEVKSWTAMDFENLEYSINAKKQKKIIETAKFFLQKHREYSEAAVRFDVVFVNADTITHLASAFTESV

📊 Sample Types

Isolate 4.2%
Metagenome 95.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.2%
Kalotermitidae 28.9%
Unclassified 15.6%
Rhinotermitidae 6.7%
Termopsidae 6.7%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
20 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
28 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
44 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
47 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
48 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_000091 3300042656 Bacteria 1231
2 Ga0466732_050189 3300042656 Bacteria 1140
3 Ga0123356_10029459 3300010049 Bacteria 5142
4 Ga0123353_12209867 3300010167 Bacteria 665
5 Ga0466700_152021 3300042600 Bacteria 1146
6 Ga0466700_463977 3300042600 Bacteria 1071
7 Ga0466719_092183 3300042606 Bacteria 1121
8 Ga0466722_200896 3300042609 Bacteria 2190
9 Ga0466705_418385 3300042612 Bacteria 2930
10 Ga0466712_041481 3300042614 Bacteria 1514
11 Ga0466712_091082 3300042614 Bacteria 11658
12 Ga0466711_034373 3300042615 Bacteria 3644
13 Ga0466715_249734 3300042616 Bacteria 10546
14 Ga0466718_132789 3300042617 Bacteria 1066
15 Ga0466723_116277 3300042618 Bacteria 4356
16 Ga0466726_202483 3300042619 Bacteria 3431
17 Ga0264413_100851 3300024493 Bacteria 32165
18 Ga0466692_097979 3300042591 Bacteria 1863
19 Ga0466694_224383 3300042594 Bacteria 2862
20 JGI24698J34947_10021051 3300002449 Unclassified 3511
21 JGI24698J34947_10053609 3300002449 Bacteria 2017
22 JGI24698J34947_10113997 3300002449 Bacteria 1187
23 Ga0466705_005290 3300042612 Bacteria 9700
24 Ga0466735_169789 3300042624 Bacteria 1173
25 Ga0466708_298225 3300042652 Bacteria 10265
26 Ga0466727_306705 3300042655 Bacteria 2310
27 Ga0123356_13868175 3300010049 Bacteria 517
28 Ga0466707_026094 3300042601 Bacteria 2952
29 Ga0466712_000910 3300042614 Bacteria 3525
30 Ga0466712_277036 3300042614 Bacteria 1169
31 Ga0466715_394762 3300042616 Bacteria 38358
32 Ga0466726_415755 3300042619 Bacteria 3444
33 Ga0466728_446391 3300042620 Bacteria 4297
34 Ga0466691_086166 3300042593 Bacteria 11074
35 Ga0466694_187344 3300042594 Bacteria 1041
36 Ga0466694_387489 3300042594 Bacteria 1621
37 Ga0466699_355914 3300042597 Bacteria 3363
38 AustNasuHG_c1004629 3300000089 Bacteria 4935
39 JGI24698J34947_10004302 3300002449 Bacteria 7750
40 JGI24698J34947_10005795 3300002449 Bacteria 6774
41 JGI24698J34947_10008914 3300002449 Bacteria 5504
42 Ga0072941_1010743 3300005201 Bacteria 35389
43 Ga0466731_296550 3300042622 Bacteria 2833
44 Ga0466735_074091 3300042624 Bacteria 3273
45 Ga0466708_173165 3300042652 Bacteria 2781
46 Ga0123356_11081855 3300010049 Bacteria 970
47 Ga0123353_10468982 3300010167 Bacteria 1847
48 Ga0466719_360113 3300042606 Bacteria 8804
49 Ga0466715_078708 3300042616 Bacteria 1581
50 Ga0466715_535173 3300042616 Bacteria 1847
51 Ga0466715_570575 3300042616 Bacteria 20092
52 Ga0466718_098621 3300042617 Bacteria 5798
53 Ga0466718_141229 3300042617 Bacteria 7489
54 Ga0466726_360395 3300042619 Bacteria 1262
55 Ga0466726_374632 3300042619 Bacteria 1172
56 Ga0466695_336155 3300042595 Bacteria 1143
57 Ga0466699_308427 3300042597 Bacteria 1537
58 Nasutiter_Contig33744 2030936001 Bacteria 797
59 AustNasuHG_c1016443 3300000089 Bacteria 2476
60 JGI24695J34938_10002625 3300002450 Bacteria 13482
61 JGI24695J34938_10014986 3300002450 Bacteria 3994
62 JGI24695J34938_10043091 3300002450 Bacteria 2016
63 Ga0074263_117735 3300005485 Unclassified 1331
64 Ga0466731_037643 3300042622 Bacteria 4919
65 Ga0466735_212847 3300042624 Unclassified 1748
66 Ga0466702_097735 3300042635 Bacteria 1710
67 Ga0466704_194953 3300042643 Bacteria 8389
68 Ga0466727_061817 3300042655 Bacteria 1819
69 Ga0123356_10007399 3300010049 Bacteria 10954
70 Ga0123356_10833732 3300010049 Bacteria 1093
71 Ga0466700_168716 3300042600 Bacteria 2213
72 Ga0466707_037278 3300042601 Unclassified 1902
73 Ga0466707_150106 3300042601 Bacteria 10020
74 Ga0466719_241307 3300042606 Bacteria 1571
75 Ga0466698_028651 3300042610 Bacteria 1289
76 Ga0466690_329174 3300042590 Bacteria 1812
77 Ga0466694_145020 3300042594 Bacteria 3621
78 Ga0466699_435625 3300042597 Bacteria 2083
79 JGI24702J35022_10072280 3300002462 Bacteria 1859
80 JGI24699J35502_10710821 3300002509 Bacteria 776
81 Ga0466705_291225 3300042612 Bacteria 1702
82 Ga0466709_146817 3300042648 Bacteria 30075
83 Ga0123356_11216628 3300010049 Bacteria 919
84 Ga0466700_123812 3300042600 Bacteria 11955
85 Ga0466707_359198 3300042601 Bacteria 6073
86 Ga0466719_199961 3300042606 Bacteria 1546
87 Ga0466711_277432 3300042615 Bacteria 2505
88 Ga0466711_364049 3300042615 Bacteria 29051
89 Ga0466711_372158 3300042615 Bacteria 3702
90 Ga0466715_476792 3300042616 Bacteria 2357
91 Ga0466691_000739 3300042593 Bacteria 3503
92 Ga0466694_172049 3300042594 Bacteria 13742
93 Ga0466694_317366 3300042594 Bacteria 2236
94 Ga0466694_395397 3300042594 Bacteria 1696
95 AustNasuHG_c1010063 3300000089 Bacteria 3306
96 JGI24695J34938_10005039 3300002450 Bacteria 8403
97 Ga0466735_115960 3300042624 Bacteria 1450
98 Ga0466704_207376 3300042643 Bacteria 2432
99 Ga0123356_10006086 3300010049 Bacteria 12239
100 Ga0466722_234855 3300042609 Bacteria 2653
101 Ga0466711_155221 3300042615 Bacteria 8949
102 Ga0466715_180236 3300042616 Bacteria 2766
103 Ga0466723_359907 3300042618 Bacteria 8863
104 Ga0466729_039116 3300042621 Bacteria 2270
105 Ga0264413_100652 3300024493 Bacteria 12802
106 Ga0466690_064813 3300042590 Unclassified 1304
107 Ga0466694_088603 3300042594 Bacteria 1480
108 FAAS_10088326 3300001880 Unclassified 525
109 JGI24698J34947_10012209 3300002449 Bacteria 4713
110 JGI24698J34947_10175031 3300002449 Bacteria 864
111 JGI24695J34938_10018038 3300002450 Bacteria 3541
112 Ga0466705_044690 3300042612 Bacteria 24374
113 Ga0466735_190046 3300042624 Bacteria 1744
114 Ga0466703_228698 3300042636 Bacteria 3799
115 Ga0466709_114667 3300042648 Bacteria 3223
116 Ga0466708_227918 3300042652 Bacteria 3321
117 Ga0466708_283359 3300042652 Unclassified 1100
118 Ga0466727_159864 3300042655 Bacteria 1198
119 Ga0123356_10556816 3300010049 Bacteria 1308
120 Ga0123356_12238745 3300010049 Bacteria 683
121 Ga0466700_059335 3300042600 Bacteria 1899
122 Ga0466712_207059 3300042614 Bacteria 1789
123 Ga0466715_072097 3300042616 Bacteria 1882
124 Ga0466726_029762 3300042619 Bacteria 2905
125 Ga0466690_432981 3300042590 Bacteria 6571
126 Ga0466699_062943 3300042597 Bacteria 1981
127 Ga0123356_10003302 3300010049 Bacteria 16941
128 Ga0466719_119853 3300042606 Bacteria 1388
129 Ga0466712_126095 3300042614 Unclassified 2068
130 Ga0466692_047602 3300042591 Bacteria 7497
131 Ga0466694_062678 3300042594 Bacteria 8128
132 Ga0466696_115284 3300042596 Bacteria 1303
133 Ga0466699_226234 3300042597 Bacteria 7640
134 JGI24698J34947_10088558 3300002449 Bacteria 1428
135 JGI24695J34938_10016431 3300002450 Bacteria 3762
136 JGI24695J34938_10310788 3300002450 Bacteria 683

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_283359 Ga0466708_283359_164_502 112
2 3300042655 Ga0466727_306705 Ga0466727_306705_1776_2114 112
3 3300042590 Ga0466690_064813 Ga0466690_064813_99_443 114
4 3300042606 Ga0466719_360113 Ga0466719_360113_3416_3760 114
5 3300042618 Ga0466723_359907 Ga0466723_359907_7421_7765 114
6 3300042620 Ga0466728_446391 Ga0466728_446391_2315_2659 114
7 3300042648 Ga0466709_146817 Ga0466709_146817_24196_24540 114
8 3300042590 Ga0466690_329174 Ga0466690_329174_68_415 115
9 3300042590 Ga0466690_432981 Ga0466690_432981_2123_2470 115
10 3300042593 Ga0466691_000739 Ga0466691_000739_2696_3043 115
11 3300042597 Ga0466699_308427 Ga0466699_308427_1028_1375 115
12 3300042600 Ga0466700_463977 Ga0466700_463977_444_791 115
13 3300042601 Ga0466707_026094 Ga0466707_026094_1856_2203 115
14 3300042601 Ga0466707_037278 Ga0466707_037278_614_961 115
15 3300042601 Ga0466707_150106 Ga0466707_150106_4801_5148 115
16 3300042606 Ga0466719_092183 Ga0466719_092183_353_700 115
17 3300042606 Ga0466719_241307 Ga0466719_241307_430_777 115
18 3300042612 Ga0466705_005290 Ga0466705_005290_6047_6394 115
19 3300042612 Ga0466705_291225 Ga0466705_291225_1114_1461 115
20 3300042612 Ga0466705_418385 Ga0466705_418385_1973_2320 115
21 3300042615 Ga0466711_034373 Ga0466711_034373_1257_1604 115
22 3300042615 Ga0466711_155221 Ga0466711_155221_4856_5203 115
23 3300042615 Ga0466711_372158 Ga0466711_372158_1965_2312 115
24 3300042616 Ga0466715_072097 Ga0466715_072097_1138_1485 115
25 3300042616 Ga0466715_078708 Ga0466715_078708_19_366 115
26 3300042616 Ga0466715_249734 Ga0466715_249734_3561_3908 115
27 3300042616 Ga0466715_535173 Ga0466715_535173_550_897 115
28 3300042618 Ga0466723_116277 Ga0466723_116277_1417_1764 115
29 3300042619 Ga0466726_202483 Ga0466726_202483_2794_3141 115
30 3300042619 Ga0466726_360395 Ga0466726_360395_392_739 115
31 3300042621 Ga0466729_039116 Ga0466729_039116_152_499 115
32 3300042622 Ga0466731_037643 Ga0466731_037643_3755_4102 115
33 3300042624 Ga0466735_169789 Ga0466735_169789_123_470 115
34 3300042624 Ga0466735_190046 Ga0466735_190046_750_1097 115
35 3300042624 Ga0466735_212847 Ga0466735_212847_641_988 115
36 3300042636 Ga0466703_228698 Ga0466703_228698_2269_2616 115
37 3300042643 Ga0466704_194953 Ga0466704_194953_2827_3174 115
38 3300042643 Ga0466704_207376 Ga0466704_207376_1472_1819 115
39 3300042648 Ga0466709_114667 Ga0466709_114667_1080_1427 115
40 3300042655 Ga0466727_159864 Ga0466727_159864_289_636 115
41 iso_pr_bacteria 2781125690 2781427323 115
42 iso_pr_bacteria 650716099 650880617 115
43 3300002449 JGI24698J34947_10005795 JGI24698J34947_100057953 116
44 3300010049 Ga0123356_12238745 Ga0123356_122387452 116
45 3300010167 Ga0123353_10468982 Ga0123353_104689823 116
46 3300010167 Ga0123353_12209867 Ga0123353_122098672 116
47 3300042594 Ga0466694_088603 Ga0466694_088603_67_438 116
48 2030936001 Nasutiter_Contig33744 Nasutiterm_754650 117
49 3300024493 Ga0264413_100652 Ga0264413_1006526 117
50 3300024493 Ga0264413_100851 Ga0264413_10085131 117
51 3300042591 Ga0466692_047602 Ga0466692_047602_3739_4092 117
52 3300042594 Ga0466694_145020 Ga0466694_145020_936_1289 117
53 3300042594 Ga0466694_187344 Ga0466694_187344_618_971 117
54 3300042594 Ga0466694_224383 Ga0466694_224383_463_816 117
55 3300042597 Ga0466699_062943 Ga0466699_062943_1366_1719 117
56 3300042597 Ga0466699_355914 Ga0466699_355914_1842_2195 117
57 3300042597 Ga0466699_435625 Ga0466699_435625_707_1060 117
58 3300042612 Ga0466705_044690 Ga0466705_044690_7351_7704 117
59 3300042614 Ga0466712_041481 Ga0466712_041481_63_416 117
60 3300042614 Ga0466712_126095 Ga0466712_126095_382_735 117
61 3300042614 Ga0466712_207059 Ga0466712_207059_29_382 117
62 3300042614 Ga0466712_277036 Ga0466712_277036_19_372 117
63 3300042615 Ga0466711_277432 Ga0466711_277432_1620_1973 117
64 3300042616 Ga0466715_180236 Ga0466715_180236_1402_1755 117
65 3300042616 Ga0466715_570575 Ga0466715_570575_3709_4062 117
66 3300042617 Ga0466718_132789 Ga0466718_132789_163_516 117
67 3300042619 Ga0466726_029762 Ga0466726_029762_854_1207 117
68 3300042635 Ga0466702_097735 Ga0466702_097735_867_1220 117
69 3300042655 Ga0466727_061817 Ga0466727_061817_1287_1640 117
70 3300042656 Ga0466732_000091 Ga0466732_000091_824_1177 117
71 iso_pr_bacteria 2781125651 2781310750 117
72 3300000089 AustNasuHG_c1004629 AustNasuHG_10046296 118
73 3300000089 AustNasuHG_c1010063 AustNasuHG_10100636 118
74 3300000089 AustNasuHG_c1016443 AustNasuHG_10164434 118
75 3300001880 FAAS_10088326 FAAS_100883262 118
76 3300002449 JGI24698J34947_10012209 JGI24698J34947_100122098 118
77 3300002449 JGI24698J34947_10175031 JGI24698J34947_101750312 118
78 3300002450 JGI24695J34938_10002625 JGI24695J34938_1000262510 118
79 3300005201 Ga0072941_1010743 Ga0072941_101074310 118
80 3300005485 Ga0074263_117735 Ga0074263_1177353 118
81 3300010049 Ga0123356_10003302 Ga0123356_100033026 118
82 3300010049 Ga0123356_13868175 Ga0123356_138681751 118
83 3300042600 Ga0466700_059335 Ga0466700_059335_416_772 118
84 3300042600 Ga0466700_152021 Ga0466700_152021_650_1006 118
85 3300042606 Ga0466719_119853 Ga0466719_119853_659_1015 118
86 3300042606 Ga0466719_199961 Ga0466719_199961_721_1077 118
87 3300042614 Ga0466712_091082 Ga0466712_091082_9106_9462 118
88 3300042616 Ga0466715_394762 Ga0466715_394762_29408_29764 118
89 3300042616 Ga0466715_476792 Ga0466715_476792_1304_1660 118
90 3300042617 Ga0466718_098621 Ga0466718_098621_2521_2877 118
91 3300042617 Ga0466718_141229 Ga0466718_141229_5575_5931 118
92 3300042622 Ga0466731_296550 Ga0466731_296550_1062_1418 118
93 3300002449 JGI24698J34947_10004302 JGI24698J34947_100043025 119
94 3300002450 JGI24695J34938_10016431 JGI24695J34938_100164316 119
95 3300002509 JGI24699J35502_10710821 JGI24699J35502_107108212 119
96 3300042596 Ga0466696_115284 Ga0466696_115284_522_881 119
97 3300042609 Ga0466722_200896 Ga0466722_200896_1649_2008 119
98 3300042624 Ga0466735_115960 Ga0466735_115960_267_626 119
99 3300042656 Ga0466732_050189 Ga0466732_050189_308_667 119
100 3300010049 Ga0123356_10833732 Ga0123356_108337322 120
101 3300042591 Ga0466692_097979 Ga0466692_097979_905_1270 121
102 3300042593 Ga0466691_086166 Ga0466691_086166_8134_8499 121
103 3300042597 Ga0466699_226234 Ga0466699_226234_1665_2030 121
104 3300042652 Ga0466708_173165 Ga0466708_173165_382_747 121
105 3300042652 Ga0466708_227918 Ga0466708_227918_45_410 121
106 iso_pr_bacteria 2781125640 2781287546 121
107 3300002450 JGI24695J34938_10014986 JGI24695J34938_100149862 122
108 3300002450 JGI24695J34938_10018038 JGI24695J34938_100180382 122
109 3300002450 JGI24695J34938_10043091 JGI24695J34938_100430911 122
110 3300042594 Ga0466694_317366 Ga0466694_317366_967_1335 122
111 3300042594 Ga0466694_387489 Ga0466694_387489_1126_1494 122
112 3300042595 Ga0466695_336155 Ga0466695_336155_761_1129 122
113 3300042614 Ga0466712_000910 Ga0466712_000910_724_1092 122
114 3300002449 JGI24698J34947_10021051 JGI24698J34947_100210512 123
115 3300042594 Ga0466694_395397 Ga0466694_395397_1254_1625 123
116 3300042600 Ga0466700_123812 Ga0466700_123812_8827_9198 123
117 3300042600 Ga0466700_168716 Ga0466700_168716_1113_1484 123
118 3300042601 Ga0466707_359198 Ga0466707_359198_609_980 123
119 3300002449 JGI24698J34947_10053609 JGI24698J34947_100536091 124
120 3300002449 JGI24698J34947_10113997 JGI24698J34947_101139972 124
121 3300042652 Ga0466708_298225 Ga0466708_298225_4828_5202 124
122 3300010049 Ga0123356_11081855 Ga0123356_110818552 126
123 3300042619 Ga0466726_374632 Ga0466726_374632_734_1114 126
124 3300010049 Ga0123356_10007399 Ga0123356_1000739910 127
125 3300042594 Ga0466694_062678 Ga0466694_062678_1624_2007 127
126 iso_pr_bacteria 2781125659 2781327855 128
127 3300010049 Ga0123356_10006086 Ga0123356_100060869 129
128 3300042594 Ga0466694_172049 Ga0466694_172049_11588_11977 129
129 3300042615 Ga0466711_364049 Ga0466711_364049_7181_7570 129
130 3300042619 Ga0466726_415755 Ga0466726_415755_1570_1959 129
131 iso_pr_bacteria 2781125655 2781319182 129
132 3300002450 JGI24695J34938_10005039 JGI24695J34938_100050397 131
133 3300002449 JGI24698J34947_10008914 JGI24698J34947_100089144 132
134 3300010049 Ga0123356_11216628 Ga0123356_112166283 132
135 3300002462 JGI24702J35022_10072280 JGI24702J35022_100722802 133
136 3300042610 Ga0466698_028651 Ga0466698_028651_217_618 133
137 3300010049 Ga0123356_10556816 Ga0123356_105568162 135
138 3300002450 JGI24695J34938_10310788 JGI24695J34938_103107881 136
139 3300010049 Ga0123356_10029459 Ga0123356_100294595 136
140 3300002449 JGI24698J34947_10088558 JGI24698J34947_100885582 138
141 3300042609 Ga0466722_234855 Ga0466722_234855_142_585 147
142 3300042624 Ga0466735_074091 Ga0466735_074091_1307_1771 154

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02021 UPF0102 Uncharacterised protein family UPF0102 14 138 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.