Protein Family IF08767

Metagenome Isolate
141 Members
51 Samples
130 Scaffolds
399.74 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_072428|Ga0466735_072428_29439_30809
Length
456 aa
Sequence
MVGIYLQKILAIIKKIDKLWRKSSEKYKNKITFIAILSFIGSVVKQQNLNQSKMAKRKTLMEQKRVYLDNSATTVVDSEVIKEMQPYFFAIYGNASSFHYFGRQAKIALDNARKKTAMLLNSSSEEIFFTGCGTESDNIAIFGILNAYGEKGHIITSKIEHHAVLYSCKHLEANGYEVTYLDVDEDGVVSVEDFKKAVKDNTLLVTIMHANNEVGSIQPIEKIAAELKKINRKRKKKIYFHTDAVQTAGKLYLDVKKLGIDLLAISAHKFNGPKGVGALYIKNGTNILPIAFGGHHENGIRPGTENIPYISGLAKALEISNSKIEEYNKHVFALREKLKEGILNTIPDVIINGSSNRTVSNILNASFNYIEGEALLLMLDMKGIAVSTGSACASGSSGPSHVLSAMGVNPITSQGAIRFSFGYHNTEEDVDYVLKVLPKVISSLRSMSPVWNQKNT

📊 Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.4%
Unclassified 27.5%
Kalotermitidae 27.5%
Termopsidae 7.8%
Rhinotermitidae 3.9%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
2 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
3 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
21 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
36 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
46 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_359349 3300042590 Bacteria 12962
2 Ga0466691_027651 3300042593 Bacteria 5816
3 Ga0466711_446261 3300042615 Bacteria 4222
4 Ga0466715_328438 3300042616 Bacteria 5655
5 Ga0466723_343684 3300042618 Bacteria 61643
6 Ga0466726_387678 3300042619 Bacteria 397429
7 Ga0466729_004750 3300042621 Bacteria 61034
8 Ga0466731_119994 3300042622 Bacteria 2780
9 Ga0466735_097271 3300042624 Bacteria 11796
10 Ga0466703_030596 3300042636 Unclassified 50415
11 Ga0466708_249803 3300042652 Bacteria 1635
12 Ga0466707_307964 3300042601 Bacteria 56092
13 Ga0466719_116654 3300042606 Bacteria 2829
14 Ga0466719_350969 3300042606 Bacteria 16465
15 Ga0068305_10001964 3300005083 Bacteria 66110
16 Ga0466705_100041 3300042612 Bacteria 4137
17 Ga0466692_051642 3300042591 Bacteria 5106
18 Ga0466696_267759 3300042596 Unclassified 15141
19 Ga0466711_161772 3300042615 Bacteria 3110
20 Ga0466715_063937 3300042616 Bacteria 69304
21 Ga0466715_111049 3300042616 Unclassified 10088
22 Ga0466715_457561 3300042616 Bacteria 3298
23 Ga0466718_000322 3300042617 Bacteria 24130
24 Ga0123356_10015443 3300010049 Unclassified 7320
25 Ga0123353_10270022 3300010167 Bacteria 2621
26 Ga0466707_042381 3300042601 Bacteria 20569
27 Ga0466713_128712 3300042602 Bacteria 12608
28 Ga0466716_085544 3300042605 Bacteria 17970
29 Ga0466716_346216 3300042605 Bacteria 4178
30 Ga0466716_472635 3300042605 Unclassified 4765
31 Ga0466719_473160 3300042606 Bacteria 7030
32 Ga0466698_220452 3300042610 Bacteria 1248
33 Ga0068302_10039338 3300005071 Unclassified 2034
34 Ga0415639_009210 3300038395 Bacteria 10528
35 Ga0466711_001984 3300042615 Bacteria 177943
36 Ga0466726_249452 3300042619 Bacteria 4015
37 Ga0466726_439489 3300042619 Bacteria 24596
38 Ga0466729_057294 3300042621 Unclassified 3838
39 Ga0466729_100968 3300042621 Bacteria 3751
40 Ga0466729_125979 3300042621 Bacteria 12819
41 Ga0123356_10131093 3300010049 Bacteria 2456
42 Ga0123353_10172439 3300010167 Bacteria 3432
43 Ga0466734_007446 3300042623 Bacteria 3268
44 Ga0466735_072428 3300042624 Bacteria 37832
45 Ga0466703_153390 3300042636 Bacteria 18790
46 Ga0466704_224220 3300042643 Bacteria 8740
47 Ga0466706_029308 3300042599 Bacteria 1936
48 Ga0466716_353646 3300042605 Bacteria 6995
49 Ga0466719_127211 3300042606 Bacteria 279481
50 Ga0466690_266367 3300042590 Unclassified 1811
51 Ga0466691_014514 3300042593 Unclassified 1878
52 Ga0466711_270442 3300042615 Bacteria 79052
53 Ga0466726_378994 3300042619 Bacteria 129768
54 Ga0466728_454633 3300042620 Bacteria 31354
55 Ga0466729_011567 3300042621 Bacteria 40528
56 Ga0466729_106778 3300042621 Bacteria 3334
57 Ga0123356_10049178 3300010049 Unclassified 3925
58 Ga0123356_10068494 3300010049 Bacteria 3325
59 Ga0123353_10000583 3300010167 Bacteria 44559
60 Ga0123353_10508828 3300010167 Bacteria 1752
61 Ga0466735_029396 3300042624 Bacteria 12755
62 Ga0466735_039781 3300042624 Bacteria 11475
63 Ga0466703_033478 3300042636 Bacteria 6660
64 Ga0466704_095429 3300042643 Bacteria 32723
65 Ga0466704_244076 3300042643 Bacteria 8715
66 Ga0466704_420369 3300042643 Bacteria 3350
67 Ga0466727_255871 3300042655 Bacteria 1953
68 Ga0466706_019380 3300042599 Bacteria 325727
69 Ga0466707_039748 3300042601 Bacteria 11754
70 Ga0466714_005261 3300042603 Bacteria 19984
71 Ga0068305_10000886 3300005083 Bacteria 103801
72 Ga0466692_184925 3300042591 Bacteria 6931
73 Ga0466691_136766 3300042593 Bacteria 1878
74 Ga0466694_055471 3300042594 Bacteria 1342
75 Ga0466711_065153 3300042615 Bacteria 7378
76 Ga0466711_496480 3300042615 Bacteria 39663
77 Ga0123356_10076414 3300010049 Bacteria 3156
78 Ga0123353_10000622 3300010167 Bacteria 43414
79 Ga0466735_016225 3300042624 Bacteria 17417
80 Ga0466704_306732 3300042643 Bacteria 7957
81 Ga0466708_201570 3300042652 Bacteria 5216
82 Ga0466700_144792 3300042600 Bacteria 3554
83 Ga0466700_228741 3300042600 Bacteria 4236
84 Ga0466707_015911 3300042601 Bacteria 5133
85 Ga0466707_070275 3300042601 Bacteria 3007
86 Ga0466717_186991 3300042604 Bacteria 3381
87 Ga0466716_000351 3300042605 Bacteria 1419
88 Ga0466719_110047 3300042606 Bacteria 2780
89 Ga0466698_323632 3300042610 Bacteria 8698
90 Ga0466690_268040 3300042590 Unclassified 1298
91 Ga0466693_329699 3300042592 Bacteria 1204
92 Ga0466695_149844 3300042595 Bacteria 2337
93 Ga0466696_207477 3300042596 Bacteria 11495
94 Ga0466711_372501 3300042615 Bacteria 489210
95 Ga0466723_050332 3300042618 Unclassified 14275
96 Ga0466723_066610 3300042618 Bacteria 8258
97 Ga0466723_080534 3300042618 Bacteria 2220
98 Ga0466729_120945 3300042621 Bacteria 4178
99 Ga0123355_10220300 3300009826 Unclassified 2730
100 Ga0123356_10032258 3300010049 Bacteria 4901
101 Ga0466704_205252 3300042643 Bacteria 4156
102 Ga0466709_305056 3300042648 Bacteria 2241
103 Ga0466727_193700 3300042655 Bacteria 75615
104 Ga0466706_006636 3300042599 Bacteria 217881
105 Ga0466707_216666 3300042601 Bacteria 5007
106 Ga0466713_140430 3300042602 Bacteria 4966
107 Ga0466719_524336 3300042606 Bacteria 382683
108 JGI24695J34938_10025893 3300002450 Bacteria 2796
109 Ga0466726_092873 3300042619 Bacteria 39334
110 Ga0466726_249824 3300042619 Archaea 1851
111 Ga0123355_10000822 3300009826 Bacteria 42541
112 Ga0123353_10000316 3300010167 Bacteria 59704
113 Ga0123353_10016969 3300010167 Bacteria 10672
114 Ga0123353_10025829 3300010167 Unclassified 8958
115 Ga0466727_146761 3300042655 Bacteria 1627
116 Ga0466707_295106 3300042601 Bacteria 9466
117 JGI24702J35022_10000214 3300002462 Bacteria 32197
118 Ga0068302_10246553 3300005071 Bacteria 2535
119 Ga0466705_158297 3300042612 Bacteria 33941
120 Ga0466690_141050 3300042590 Bacteria 22929
121 Ga0466696_222800 3300042596 Bacteria 4170
122 Ga0466711_234694 3300042615 Bacteria 52796
123 Ga0466728_090296 3300042620 Bacteria 19091
124 Ga0123353_10001611 3300010167 Bacteria 27817
125 Ga0123353_10101540 3300010167 Bacteria 4637
126 Ga0466729_256739 3300042621 Bacteria 2084
127 Ga0466708_073321 3300042652 Bacteria 12359
128 Ga0466707_175941 3300042601 Bacteria 5052
129 Ga0466707_232660 3300042601 Bacteria 30117
130 Ga0068305_10000004 3300005083 Bacteria 52322

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042610 Ga0466698_220452 Ga0466698_220452_135_1232 365
2 3300042592 Ga0466693_329699 Ga0466693_329699_37_1140 367
3 3300042606 Ga0466719_110047 Ga0466719_110047_91_1281 375
4 3300042600 Ga0466700_144792 Ga0466700_144792_2022_3239 379
5 iso_pr_bacteria 2820171952 2820172709 379
6 3300042606 Ga0466719_473160 Ga0466719_473160_4230_5429 380
7 3300042624 Ga0466735_029396 Ga0466735_029396_6288_7478 381
8 3300042601 Ga0466707_042381 Ga0466707_042381_432_1580 382
9 3300010167 Ga0123353_10016969 Ga0123353_100169694 384
10 3300042655 Ga0466727_255871 Ga0466727_255871_628_1794 388
11 3300009826 Ga0123355_10220300 Ga0123355_102203003 389
12 3300042615 Ga0466711_270442 Ga0466711_270442_60705_61874 389
13 3300002450 JGI24695J34938_10025893 JGI24695J34938_100258933 390
14 3300042591 Ga0466692_051642 Ga0466692_051642_3786_4958 390
15 3300042606 Ga0466719_127211 Ga0466719_127211_231574_232746 390
16 3300042617 Ga0466718_000322 Ga0466718_000322_1797_2972 391
17 3300042621 Ga0466729_004750 Ga0466729_004750_59317_60492 391
18 3300042599 Ga0466706_006636 Ga0466706_006636_125562_126761 392
19 3300042594 Ga0466694_055471 Ga0466694_055471_63_1247 394
20 3300010167 Ga0123353_10000622 Ga0123353_1000062212 395
21 3300042590 Ga0466690_141050 Ga0466690_141050_13260_14447 395
22 3300042590 Ga0466690_268040 Ga0466690_268040_33_1220 395
23 3300042601 Ga0466707_070275 Ga0466707_070275_548_1735 395
24 3300042604 Ga0466717_186991 Ga0466717_186991_1574_2761 395
25 3300042610 Ga0466698_323632 Ga0466698_323632_2033_3220 395
26 3300042612 Ga0466705_158297 Ga0466705_158297_3296_4483 395
27 3300042615 Ga0466711_446261 Ga0466711_446261_577_1764 395
28 3300042616 Ga0466715_063937 Ga0466715_063937_65814_67001 395
29 3300042618 Ga0466723_343684 Ga0466723_343684_2304_3491 395
30 3300042619 Ga0466726_092873 Ga0466726_092873_27485_28672 395
31 3300042619 Ga0466726_249824 Ga0466726_249824_549_1736 395
32 3300042621 Ga0466729_106778 Ga0466729_106778_1741_2928 395
33 3300042655 Ga0466727_146761 Ga0466727_146761_248_1435 395
34 3300042655 Ga0466727_193700 Ga0466727_193700_8482_9669 395
35 3300005071 Ga0068302_10039338 Ga0068302_100393381 396
36 3300009826 Ga0123355_10000822 Ga0123355_1000082229 396
37 3300042599 Ga0466706_019380 Ga0466706_019380_44811_46001 396
38 3300042615 Ga0466711_372501 Ga0466711_372501_393151_394341 396
39 3300042619 Ga0466726_249452 Ga0466726_249452_2710_3900 396
40 3300042621 Ga0466729_057294 Ga0466729_057294_2104_3294 396
41 3300042621 Ga0466729_120945 Ga0466729_120945_77_1267 396
42 3300042621 Ga0466729_256739 Ga0466729_256739_532_1722 396
43 3300042624 Ga0466735_039781 Ga0466735_039781_3164_4354 396
44 3300042643 Ga0466704_244076 Ga0466704_244076_3519_4709 396
45 3300042652 Ga0466708_073321 Ga0466708_073321_2705_3895 396
46 3300042596 Ga0466696_222800 Ga0466696_222800_468_1661 397
47 3300042605 Ga0466716_353646 Ga0466716_353646_2169_3362 397
48 3300042619 Ga0466726_387678 Ga0466726_387678_245736_246929 397
49 iso_pr_bacteria 2772190894 2773439086 397
50 iso_pr_bacteria 2820178484 2820178487 397
51 3300002462 JGI24702J35022_10000214 JGI24702J35022_100002147 398
52 3300042590 Ga0466690_359349 Ga0466690_359349_3801_4997 398
53 3300042601 Ga0466707_015911 Ga0466707_015911_1237_2433 398
54 3300042601 Ga0466707_039748 Ga0466707_039748_10228_11424 398
55 3300042601 Ga0466707_216666 Ga0466707_216666_1370_2566 398
56 3300042603 Ga0466714_005261 Ga0466714_005261_10078_11274 398
57 3300042615 Ga0466711_001984 Ga0466711_001984_118486_119718 398
58 3300042620 Ga0466728_090296 Ga0466728_090296_9005_10201 398
59 iso_pr_bacteria 2754412483 2755217563 398
60 iso_pr_bacteria 2772190892 2773436512 398
61 3300010167 Ga0123353_10000583 Ga0123353_100005833 399
62 3300010167 Ga0123353_10001611 Ga0123353_1000161117 399
63 3300042599 Ga0466706_029308 Ga0466706_029308_133_1332 399
64 3300042600 Ga0466700_228741 Ga0466700_228741_2848_4047 399
65 3300042615 Ga0466711_161772 Ga0466711_161772_757_1956 399
66 3300042616 Ga0466715_328438 Ga0466715_328438_1049_2248 399
67 3300042619 Ga0466726_378994 Ga0466726_378994_35457_36656 399
68 3300042621 Ga0466729_100968 Ga0466729_100968_2013_3212 399
69 3300005083 Ga0068305_10000886 Ga0068305_1000088683 400
70 3300042601 Ga0466707_232660 Ga0466707_232660_5330_6532 400
71 3300042601 Ga0466707_307964 Ga0466707_307964_29964_31166 400
72 3300042624 Ga0466735_097271 Ga0466735_097271_4761_5963 400
73 iso_pr_bacteria 2754412482 2755215782 400
74 iso_pr_bacteria 2772190891 2773435078 400
75 iso_pr_bacteria 2820180635 2820182041 400
76 iso_pr_bacteria 642555172 642791312 400
77 3300005071 Ga0068302_10246553 Ga0068302_102465531 401
78 3300005083 Ga0068305_10001964 Ga0068305_1000196416 401
79 3300010049 Ga0123356_10076414 Ga0123356_100764142 401
80 3300010167 Ga0123353_10025829 Ga0123353_100258295 401
81 3300042593 Ga0466691_027651 Ga0466691_027651_4431_5636 401
82 3300042596 Ga0466696_207477 Ga0466696_207477_8985_10190 401
83 3300042601 Ga0466707_175941 Ga0466707_175941_1296_2501 401
84 3300042605 Ga0466716_346216 Ga0466716_346216_2785_3990 401
85 3300042606 Ga0466719_116654 Ga0466719_116654_955_2160 401
86 3300042612 Ga0466705_100041 Ga0466705_100041_437_1642 401
87 3300042622 Ga0466731_119994 Ga0466731_119994_386_1591 401
88 3300042624 Ga0466735_016225 Ga0466735_016225_11136_12341 401
89 3300042643 Ga0466704_306732 Ga0466704_306732_5351_6556 401
90 3300010049 Ga0123356_10015443 Ga0123356_100154435 402
91 3300038395 Ga0415639_009210 Ga0415639_009210_2257_3465 402
92 3300042606 Ga0466719_524336 Ga0466719_524336_146961_148169 402
93 3300042619 Ga0466726_439489 Ga0466726_439489_181_1413 402
94 3300042643 Ga0466704_205252 Ga0466704_205252_814_2022 402
95 3300042590 Ga0466690_266367 Ga0466690_266367_299_1510 403
96 3300042593 Ga0466691_014514 Ga0466691_014514_361_1572 403
97 3300042593 Ga0466691_136766 Ga0466691_136766_362_1573 403
98 3300042596 Ga0466696_267759 Ga0466696_267759_10315_11526 403
99 3300042605 Ga0466716_472635 Ga0466716_472635_341_1552 403
100 3300042606 Ga0466719_350969 Ga0466719_350969_10917_12128 403
101 3300042615 Ga0466711_234694 Ga0466711_234694_3236_4447 403
102 3300042616 Ga0466715_111049 Ga0466715_111049_8585_9796 403
103 3300042618 Ga0466723_050332 Ga0466723_050332_3212_4423 403
104 3300042618 Ga0466723_080534 Ga0466723_080534_907_2118 403
105 3300042636 Ga0466703_030596 Ga0466703_030596_45996_47207 403
106 3300042643 Ga0466704_224220 Ga0466704_224220_7224_8435 403
107 3300042643 Ga0466704_420369 Ga0466704_420369_1838_3049 403
108 3300042652 Ga0466708_201570 Ga0466708_201570_1808_3019 403
109 3300005083 Ga0068305_10000004 Ga0068305_1000000412 404
110 3300042605 Ga0466716_000351 Ga0466716_000351_168_1382 404
111 3300042620 Ga0466728_454633 Ga0466728_454633_12793_14007 404
112 3300010167 Ga0123353_10508828 Ga0123353_105088282 405
113 3300042602 Ga0466713_128712 Ga0466713_128712_447_1664 405
114 3300042616 Ga0466715_457561 Ga0466715_457561_1148_2365 405
115 3300042636 Ga0466703_153390 Ga0466703_153390_10923_12140 405
116 3300010049 Ga0123356_10131093 Ga0123356_101310931 406
117 3300010167 Ga0123353_10172439 Ga0123353_101724392 406
118 3300010167 Ga0123353_10270022 Ga0123353_102700221 406
119 3300042601 Ga0466707_295106 Ga0466707_295106_7307_8527 406
120 3300042615 Ga0466711_065153 Ga0466711_065153_177_1397 406
121 3300042618 Ga0466723_066610 Ga0466723_066610_5486_6706 406
122 3300042643 Ga0466704_095429 Ga0466704_095429_29220_30440 406
123 iso_pr_bacteria 2820201435 2820203768 406
124 3300042652 Ga0466708_249803 Ga0466708_249803_245_1468 407
125 3300010049 Ga0123356_10068494 Ga0123356_100684942 408
126 3300042605 Ga0466716_085544 Ga0466716_085544_341_1567 408
127 iso_pr_bacteria 2820205024 2820205541 408
128 3300010167 Ga0123353_10000316 Ga0123353_1000031629 409
129 3300042602 Ga0466713_140430 Ga0466713_140430_354_1583 409
130 3300042621 Ga0466729_125979 Ga0466729_125979_2759_3988 409
131 3300042636 Ga0466703_033478 Ga0466703_033478_3352_4581 409
132 3300010049 Ga0123356_10032258 Ga0123356_100322582 410
133 3300010167 Ga0123353_10101540 Ga0123353_101015402 410
134 3300042595 Ga0466695_149844 Ga0466695_149844_51_1286 411
135 3300042648 Ga0466709_305056 Ga0466709_305056_578_1822 414
136 3300042615 Ga0466711_496480 Ga0466711_496480_33182_34438 418
137 3300042623 Ga0466734_007446 Ga0466734_007446_1881_3140 419
138 3300042591 Ga0466692_184925 Ga0466692_184925_172_1443 423
139 3300010049 Ga0123356_10049178 Ga0123356_100491784 428
140 3300042621 Ga0466729_011567 Ga0466729_011567_22595_23884 429
141 3300042624 Ga0466735_072428 Ga0466735_072428_29439_30809 456

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00266 Aminotran_5 Aminotransferase class-V 66 433 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.