Protein Family IF08757

Metagenome Isolate
141 Members
49 Samples
136 Scaffolds
180.21 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_065961|Ga0466735_065961_1191_1883
Length
204 aa
Sequence
MNNLRIAISGKSGCGNTTVSRLTAEALGLRFVNFTFRNLAQEQGLELVDLLGLAAKDDAWDREVDSRQIALARGGVAAAGGPNTEVSGATCEAAGCVLGSRLAIWMLPEADIKVYLKARPETRTKRIIRREGGTLEEVAAFTAERDRQDRERYLRIYNIDNDDYAFADLIIDTDDIAPEEIVRLIAEKAAYMAADVVPHGASPA

📊 Sample Types

Isolate 2.8%
Metagenome 97.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.7%
Kalotermitidae 29.8%
Unclassified 8.5%
Rhinotermitidae 8.5%
Termopsidae 6.4%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
25 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
30 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_409828 3300042590 Bacteria 1716
2 Ga0466699_174915 3300042597 Bacteria 2153
3 Ga0123353_10512021 3300010167 Bacteria 1744
4 Ga0466720_158217 3300042607 Bacteria 1124
5 Ga0466721_236687 3300042608 Bacteria 3275
6 Ga0466726_183752 3300042619 Bacteria 4342
7 Ga0466703_049399 3300042636 Bacteria 26515
8 Ga0466704_302485 3300042643 Bacteria 8053
9 JGI24698J34947_10001753 3300002449 Bacteria 11562
10 JGI24698J34947_10023807 3300002449 Bacteria 3274
11 JGI24698J34947_10029904 3300002449 Unclassified 2875
12 JGI24698J34947_10080437 3300002449 Bacteria 1531
13 JGI24695J34938_10018502 3300002450 Unclassified 3478
14 JGI24695J34938_10063283 3300002450 Bacteria 1569
15 Ga0072941_1019378 3300005201 Bacteria 5689
16 Ga0466693_146536 3300042592 Bacteria 3320
17 Ga0466699_103184 3300042597 Bacteria 50050
18 Ga0466699_110405 3300042597 Bacteria 1113
19 Ga0123357_10235386 3300009784 Bacteria 1996
20 Ga0466700_192708 3300042600 Bacteria 1004
21 Ga0466698_514428 3300042610 Bacteria 11096
22 Ga0466718_076755 3300042617 Bacteria 6302
23 Ga0466731_028947 3300042622 Bacteria 1525
24 Ga0466702_054306 3300042635 Bacteria 4958
25 Ga0466708_153665 3300042652 Bacteria 9204
26 JGI24695J34938_10001318 3300002450 Bacteria 21600
27 JGI24695J34938_10006506 3300002450 Bacteria 6992
28 Ga0074263_109186 3300005485 Bacteria 1672
29 Ga0264413_100818 3300024493 Bacteria 38955
30 Ga0264413_110361 3300024493 Bacteria 33077
31 Ga0466690_151907 3300042590 Bacteria 18937
32 Ga0123353_11596989 3300010167 Bacteria 824
33 Ga0466722_015129 3300042609 Bacteria 2922
34 Ga0466711_328033 3300042615 Bacteria 2503
35 Ga0466718_051031 3300042617 Bacteria 1598
36 Ga0466718_077173 3300042617 Bacteria 5323
37 Ga0466729_162323 3300042621 Bacteria 1469
38 Ga0466735_065961 3300042624 Bacteria 3652
39 Ga0466709_000526 3300042648 Bacteria 10476
40 JGI24695J34938_10005773 3300002450 Bacteria 7620
41 Ga0072941_1073391 3300005201 Bacteria 3019
42 Ga0072941_1101066 3300005201 Archaea 1874
43 Ga0466693_047521 3300042592 Bacteria 1568
44 Ga0466696_276288 3300042596 Bacteria 4805
45 Ga0466696_283144 3300042596 Bacteria 3828
46 Ga0466706_064804 3300042599 Bacteria 1323
47 Ga0466719_053151 3300042606 Bacteria 5908
48 Ga0466712_041387 3300042614 Bacteria 51755
49 Ga0466711_077645 3300042615 Bacteria 24912
50 Ga0466718_055554 3300042617 Bacteria 2268
51 Ga0466718_065764 3300042617 Bacteria 2299
52 Ga0466728_104531 3300042620 Bacteria 5358
53 Ga0466731_212179 3300042622 Bacteria 1019
54 Ga0466731_256189 3300042622 Bacteria 1254
55 Ga0466727_084085 3300042655 Bacteria 4979
56 Ga0456237_0000773 3300041968 Bacteria 4962
57 Ga0466690_096133 3300042590 Bacteria 10685
58 Ga0466693_170633 3300042592 Bacteria 9429
59 Ga0466691_136635 3300042593 Bacteria 3125
60 Ga0466716_167230 3300042605 Bacteria 1242
61 Ga0466719_564605 3300042606 Unclassified 1074
62 Ga0466722_132403 3300042609 Bacteria 1617
63 Ga0466722_191829 3300042609 Bacteria 2043
64 Ga0466712_228681 3300042614 Bacteria 33247
65 Ga0466715_330493 3300042616 Bacteria 21938
66 Ga0466718_020320 3300042617 Bacteria 6618
67 Ga0466723_084037 3300042618 Bacteria 1646
68 Ga0466726_144885 3300042619 Bacteria 1991
69 Ga0466728_387061 3300042620 Bacteria 14937
70 Ga0466702_229243 3300042635 Bacteria 14965
71 JGI24698J34947_10032165 3300002449 Unclassified 2756
72 JGI24698J34947_10056418 3300002449 Bacteria 1953
73 JGI24695J34938_10168676 3300002450 Bacteria 902
74 Ga0072941_1083423 3300005201 Bacteria 3550
75 Ga0466732_367648 3300042656 Bacteria 5480
76 Ga0466694_220570 3300042594 Bacteria 23857
77 Ga0466699_190979 3300042597 Bacteria 9895
78 Ga0123356_10039110 3300010049 Bacteria 4420
79 Ga0123356_11084642 3300010049 Bacteria 969
80 Ga0466712_002934 3300042614 Unclassified 1729
81 Ga0466712_027725 3300042614 Bacteria 34997
82 Ga0466712_263031 3300042614 Bacteria 2586
83 Ga0466712_297965 3300042614 Bacteria 4078
84 Ga0466718_039873 3300042617 Bacteria 2718
85 Ga0466726_222169 3300042619 Bacteria 24411
86 Ga0466731_301419 3300042622 Bacteria 1200
87 Ga0466704_167597 3300042643 Bacteria 1418
88 Ga0466708_314781 3300042652 Bacteria 2808
89 Ga0466727_342820 3300042655 Bacteria 1059
90 JGI24698J34947_10000007 3300002449 Bacteria 54610
91 JGI24698J34947_10000364 3300002449 Bacteria 20304
92 JGI24695J34938_10000682 3300002450 Bacteria 32027
93 JGI24702J35022_10000258 3300002462 Bacteria 30271
94 Ga0072940_1036171 3300005200 Bacteria 1975
95 Ga0072941_1011779 3300005201 Bacteria 29388
96 Ga0466732_269501 3300042656 Bacteria 3305
97 Ga0466690_044997 3300042590 Bacteria 10540
98 Ga0466690_259565 3300042590 Bacteria 5837
99 Ga0466692_043164 3300042591 Bacteria 13863
100 Ga0466691_220225 3300042593 Bacteria 12266
101 Ga0466699_338698 3300042597 Bacteria 62334
102 Ga0466722_137689 3300042609 Bacteria 4080
103 Ga0466712_067298 3300042614 Bacteria 6159
104 Ga0466715_069646 3300042616 Bacteria 4579
105 Ga0466715_292434 3300042616 Bacteria 3746
106 Ga0466726_003203 3300042619 Bacteria 2621
107 Ga0466726_147134 3300042619 Bacteria 1879
108 Ga0466729_122367 3300042621 Bacteria 1435
109 Ga0466731_292101 3300042622 Bacteria 1166
110 Ga0466731_301266 3300042622 Bacteria 2463
111 Ga0466702_107435 3300042635 Bacteria 3210
112 Ga0466704_066263 3300042643 Bacteria 3594
113 Ga0466709_322584 3300042648 Bacteria 1444
114 Ga0466727_237242 3300042655 Bacteria 1113
115 JGI24695J34938_10003266 3300002450 Unclassified 11460
116 JGI24695J34938_10005187 3300002450 Bacteria 8228
117 Ga0466705_011443 3300042612 Bacteria 5195
118 Ga0466705_151667 3300042612 Bacteria 14762
119 Ga0415639_004451 3300038395 Bacteria 7993
120 Ga0466692_105300 3300042591 Bacteria 4865
121 Ga0466693_195521 3300042592 Bacteria 30403
122 Ga0466699_050425 3300042597 Bacteria 17032
123 Ga0123356_10066533 3300010049 Bacteria 3374
124 Ga0466716_226871 3300042605 Bacteria 2282
125 Ga0466712_220701 3300042614 Unclassified 17289
126 Ga0466712_295969 3300042614 Bacteria 10682
127 Ga0466711_008388 3300042615 Bacteria 30567
128 Ga0466718_119078 3300042617 Bacteria 2651
129 Ga0466723_116293 3300042618 Bacteria 6197
130 Ga0466726_124671 3300042619 Bacteria 2722
131 Ga0466703_184563 3300042636 Bacteria 11891
132 Ga0466704_141981 3300042643 Bacteria 11856
133 Ga0466704_299566 3300042643 Bacteria 6443
134 Ga0466704_503145 3300042643 Bacteria 11664
135 JGI24698J34947_10000157 3300002449 Bacteria 26130
136 JGI24698J34947_10017259 3300002449 Bacteria 3914

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_003203 Ga0466726_003203_2115_2582 155
2 3300042648 Ga0466709_322584 Ga0466709_322584_706_1236 159
3 3300042605 Ga0466716_226871 Ga0466716_226871_417_962 170
4 3300042590 Ga0466690_096133 Ga0466690_096133_3024_3545 173
5 3300042596 Ga0466696_276288 Ga0466696_276288_3127_3648 173
6 3300042636 Ga0466703_184563 Ga0466703_184563_6445_6966 173
7 3300042655 Ga0466727_237242 Ga0466727_237242_390_911 173
8 3300042607 Ga0466720_158217 Ga0466720_158217_151_678 175
9 3300042614 Ga0466712_220701 Ga0466712_220701_10123_10650 175
10 3300042617 Ga0466718_055554 Ga0466718_055554_1079_1606 175
11 3300042617 Ga0466718_119078 Ga0466718_119078_43_570 175
12 3300042619 Ga0466726_147134 Ga0466726_147134_1059_1601 175
13 3300002450 JGI24695J34938_10001318 JGI24695J34938_1000131813 176
14 3300002450 JGI24695J34938_10063283 JGI24695J34938_100632832 176
15 3300005201 Ga0072941_1011779 Ga0072941_101177912 176
16 3300024493 Ga0264413_110361 Ga0264413_11036112 176
17 3300038395 Ga0415639_004451 Ga0415639_004451_2298_2828 176
18 3300042592 Ga0466693_047521 Ga0466693_047521_520_1050 176
19 3300042597 Ga0466699_050425 Ga0466699_050425_15574_16104 176
20 3300042597 Ga0466699_190979 Ga0466699_190979_6276_6806 176
21 3300042599 Ga0466706_064804 Ga0466706_064804_695_1225 176
22 3300042608 Ga0466721_236687 Ga0466721_236687_958_1488 176
23 3300042610 Ga0466698_514428 Ga0466698_514428_4567_5097 176
24 3300042614 Ga0466712_002934 Ga0466712_002934_248_778 176
25 3300042614 Ga0466712_041387 Ga0466712_041387_31258_31788 176
26 3300042614 Ga0466712_067298 Ga0466712_067298_406_936 176
27 3300042614 Ga0466712_263031 Ga0466712_263031_947_1477 176
28 3300042614 Ga0466712_295969 Ga0466712_295969_9645_10175 176
29 3300042614 Ga0466712_297965 Ga0466712_297965_743_1273 176
30 3300042621 Ga0466729_122367 Ga0466729_122367_498_1028 176
31 3300042622 Ga0466731_028947 Ga0466731_028947_83_613 176
32 3300042622 Ga0466731_292101 Ga0466731_292101_12_542 176
33 3300042635 Ga0466702_054306 Ga0466702_054306_185_715 176
34 3300042635 Ga0466702_107435 Ga0466702_107435_209_739 176
35 3300042635 Ga0466702_229243 Ga0466702_229243_13177_13707 176
36 iso_pr_bacteria 2781125637 2781282689 176
37 iso_pr_bacteria 2781125649 2781307285 176
38 3300002449 JGI24698J34947_10000157 JGI24698J34947_1000015717 177
39 3300002449 JGI24698J34947_10000364 JGI24698J34947_1000036420 177
40 3300002449 JGI24698J34947_10001753 JGI24698J34947_100017532 177
41 3300002449 JGI24698J34947_10017259 JGI24698J34947_100172593 177
42 3300002449 JGI24698J34947_10023807 JGI24698J34947_100238073 177
43 3300002449 JGI24698J34947_10029904 JGI24698J34947_100299043 177
44 3300002449 JGI24698J34947_10032165 JGI24698J34947_100321652 177
45 3300002449 JGI24698J34947_10080437 JGI24698J34947_100804372 177
46 3300002450 JGI24695J34938_10005773 JGI24695J34938_100057737 177
47 3300005200 Ga0072940_1036171 Ga0072940_10361713 177
48 3300005201 Ga0072941_1073391 Ga0072941_10733913 177
49 3300024493 Ga0264413_100818 Ga0264413_10081819 177
50 3300042597 Ga0466699_103184 Ga0466699_103184_43684_44217 177
51 3300042597 Ga0466699_174915 Ga0466699_174915_810_1343 177
52 3300042612 Ga0466705_011443 Ga0466705_011443_148_681 177
53 3300042614 Ga0466712_027725 Ga0466712_027725_2415_2948 177
54 3300042614 Ga0466712_067298 Ga0466712_067298_2181_2714 177
55 3300042614 Ga0466712_228681 Ga0466712_228681_5327_5860 177
56 3300042615 Ga0466711_077645 Ga0466711_077645_6368_6901 177
57 3300042617 Ga0466718_020320 Ga0466718_020320_1533_2066 177
58 3300042617 Ga0466718_065764 Ga0466718_065764_1694_2227 177
59 3300042617 Ga0466718_076755 Ga0466718_076755_670_1203 177
60 3300042643 Ga0466704_141981 Ga0466704_141981_1352_1885 177
61 3300042655 Ga0466727_084085 Ga0466727_084085_1794_2327 177
62 3300002449 JGI24698J34947_10000007 JGI24698J34947_1000000746 178
63 3300002449 JGI24698J34947_10056418 JGI24698J34947_100564182 178
64 3300005201 Ga0072941_1083423 Ga0072941_10834232 178
65 3300042617 Ga0466718_039873 Ga0466718_039873_1038_1574 178
66 3300042617 Ga0466718_051031 Ga0466718_051031_602_1138 178
67 3300042617 Ga0466718_077173 Ga0466718_077173_2794_3330 178
68 3300042618 Ga0466723_084037 Ga0466723_084037_258_794 178
69 3300042656 Ga0466732_269501 Ga0466732_269501_2721_3257 178
70 3300042656 Ga0466732_367648 Ga0466732_367648_3017_3553 178
71 3300002450 JGI24695J34938_10003266 JGI24695J34938_100032665 179
72 3300005201 Ga0072941_1019378 Ga0072941_10193786 179
73 3300042590 Ga0466690_259565 Ga0466690_259565_3498_4037 179
74 3300042591 Ga0466692_105300 Ga0466692_105300_1956_2495 179
75 3300042609 Ga0466722_132403 Ga0466722_132403_652_1191 179
76 3300042612 Ga0466705_151667 Ga0466705_151667_13884_14423 179
77 3300042615 Ga0466711_328033 Ga0466711_328033_1776_2315 179
78 3300042620 Ga0466728_387061 Ga0466728_387061_1243_1782 179
79 3300042622 Ga0466731_301266 Ga0466731_301266_1697_2236 179
80 3300002450 JGI24695J34938_10018502 JGI24695J34938_100185024 180
81 3300041968 Ga0456237_0000773 Ga0456237_0000773_1118_1660 180
82 3300042591 Ga0466692_043164 Ga0466692_043164_11278_11820 180
83 3300042609 Ga0466722_191829 Ga0466722_191829_1155_1697 180
84 3300042643 Ga0466704_299566 Ga0466704_299566_944_1486 180
85 3300042643 Ga0466704_302485 Ga0466704_302485_844_1386 180
86 3300010167 Ga0123353_11596989 Ga0123353_115969891 181
87 3300042596 Ga0466696_283144 Ga0466696_283144_2264_2809 181
88 3300042597 Ga0466699_338698 Ga0466699_338698_16221_16766 181
89 3300042605 Ga0466716_167230 Ga0466716_167230_380_925 181
90 3300042609 Ga0466722_015129 Ga0466722_015129_1381_1926 181
91 3300042615 Ga0466711_008388 Ga0466711_008388_22711_23256 181
92 3300042622 Ga0466731_256189 Ga0466731_256189_650_1195 181
93 3300042655 Ga0466727_342820 Ga0466727_342820_61_606 181
94 3300002450 JGI24695J34938_10000682 JGI24695J34938_100006827 182
95 3300002450 JGI24695J34938_10005187 JGI24695J34938_100051876 182
96 3300002450 JGI24695J34938_10168676 JGI24695J34938_101686761 182
97 3300042592 Ga0466693_146536 Ga0466693_146536_2386_2934 182
98 3300042597 Ga0466699_110405 Ga0466699_110405_365_913 182
99 3300042622 Ga0466731_301419 Ga0466731_301419_463_1011 182
100 iso_pr_bacteria 2781125690 2781428554 182
101 3300010049 Ga0123356_10066533 Ga0123356_100665334 183
102 3300010049 Ga0123356_11084642 Ga0123356_110846423 183
103 3300042592 Ga0466693_195521 Ga0466693_195521_24789_25340 183
104 3300042594 Ga0466694_220570 Ga0466694_220570_4001_4552 183
105 3300042600 Ga0466700_192708 Ga0466700_192708_363_914 183
106 3300042609 Ga0466722_137689 Ga0466722_137689_914_1465 183
107 3300042622 Ga0466731_212179 Ga0466731_212179_47_598 183
108 3300042643 Ga0466704_167597 Ga0466704_167597_665_1216 183
109 iso_pr_bacteria 2781125632 2781269569 183
110 3300002450 JGI24695J34938_10006506 JGI24695J34938_100065064 184
111 3300005485 Ga0074263_109186 Ga0074263_1091861 184
112 3300009784 Ga0123357_10235386 Ga0123357_102353862 184
113 3300010167 Ga0123353_10512021 Ga0123353_105120212 184
114 3300042636 Ga0466703_049399 Ga0466703_049399_15226_15780 184
115 3300042616 Ga0466715_292434 Ga0466715_292434_1919_2476 185
116 3300042643 Ga0466704_066263 Ga0466704_066263_883_1440 185
117 3300042648 Ga0466709_000526 Ga0466709_000526_1751_2308 185
118 3300042606 Ga0466719_564605 Ga0466719_564605_126_686 186
119 3300042621 Ga0466729_162323 Ga0466729_162323_342_902 186
120 3300005201 Ga0072941_1101066 Ga0072941_11010662 187
121 3300042590 Ga0466690_151907 Ga0466690_151907_2955_3518 187
122 3300042606 Ga0466719_053151 Ga0466719_053151_1130_1693 187
123 3300042616 Ga0466715_330493 Ga0466715_330493_20333_20896 187
124 3300042618 Ga0466723_116293 Ga0466723_116293_1151_1714 187
125 3300042619 Ga0466726_144885 Ga0466726_144885_980_1561 187
126 3300002462 JGI24702J35022_10000258 JGI24702J35022_100002582 188
127 3300042592 Ga0466693_170633 Ga0466693_170633_1879_2445 188
128 3300042593 Ga0466691_220225 Ga0466691_220225_8912_9478 188
129 3300042619 Ga0466726_183752 Ga0466726_183752_2299_2865 188
130 3300042652 Ga0466708_153665 Ga0466708_153665_2424_2993 189
131 3300010049 Ga0123356_10039110 Ga0123356_100391102 190
132 3300042619 Ga0466726_222169 Ga0466726_222169_7194_7766 190
133 3300042593 Ga0466691_136635 Ga0466691_136635_2525_3100 191
134 3300042590 Ga0466690_409828 Ga0466690_409828_478_1056 192
135 3300042652 Ga0466708_314781 Ga0466708_314781_936_1514 192
136 3300042590 Ga0466690_044997 Ga0466690_044997_7950_8603 193
137 3300042619 Ga0466726_124671 Ga0466726_124671_910_1491 193
138 3300042616 Ga0466715_069646 Ga0466715_069646_2996_3583 195
139 3300042643 Ga0466704_503145 Ga0466704_503145_3983_4570 195
140 3300042620 Ga0466728_104531 Ga0466728_104531_4167_4781 204
141 3300042624 Ga0466735_065961 Ga0466735_065961_1191_1883 204

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13238 AAA_18 AAA domain 6 131 0.88
PF13189 Cytidylate_kin2 Cytidylate kinase-like family 6 174 0.84
PF02224 Cytidylate_kin Cytidylate kinase 103 189 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.