Protein Family IF08757
Metagenome
Isolate
141
Members
49
Samples
136
Scaffolds
180.21
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_065961|Ga0466735_065961_1191_1883
- Length
- 204 aa
- Sequence
- MNNLRIAISGKSGCGNTTVSRLTAEALGLRFVNFTFRNLAQEQGLELVDLLGLAAKDDAWDREVDSRQIALARGGVAAAGGPNTEVSGATCEAAGCVLGSRLAIWMLPEADIKVYLKARPETRTKRIIRREGGTLEEVAAFTAERDRQDRERYLRIYNIDNDDYAFADLIIDTDDIAPEEIVRLIAEKAAYMAADVVPHGASPA
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.7%
Kalotermitidae
29.8%
Unclassified
8.5%
Rhinotermitidae
8.5%
Termopsidae
6.4%
Hodotermitidae
2.1%
Taxonomy
Archaea
1
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 25 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_409828 | 3300042590 | Bacteria | 1716 |
| 2 | Ga0466699_174915 | 3300042597 | Bacteria | 2153 |
| 3 | Ga0123353_10512021 | 3300010167 | Bacteria | 1744 |
| 4 | Ga0466720_158217 | 3300042607 | Bacteria | 1124 |
| 5 | Ga0466721_236687 | 3300042608 | Bacteria | 3275 |
| 6 | Ga0466726_183752 | 3300042619 | Bacteria | 4342 |
| 7 | Ga0466703_049399 | 3300042636 | Bacteria | 26515 |
| 8 | Ga0466704_302485 | 3300042643 | Bacteria | 8053 |
| 9 | JGI24698J34947_10001753 | 3300002449 | Bacteria | 11562 |
| 10 | JGI24698J34947_10023807 | 3300002449 | Bacteria | 3274 |
| 11 | JGI24698J34947_10029904 | 3300002449 | Unclassified | 2875 |
| 12 | JGI24698J34947_10080437 | 3300002449 | Bacteria | 1531 |
| 13 | JGI24695J34938_10018502 | 3300002450 | Unclassified | 3478 |
| 14 | JGI24695J34938_10063283 | 3300002450 | Bacteria | 1569 |
| 15 | Ga0072941_1019378 | 3300005201 | Bacteria | 5689 |
| 16 | Ga0466693_146536 | 3300042592 | Bacteria | 3320 |
| 17 | Ga0466699_103184 | 3300042597 | Bacteria | 50050 |
| 18 | Ga0466699_110405 | 3300042597 | Bacteria | 1113 |
| 19 | Ga0123357_10235386 | 3300009784 | Bacteria | 1996 |
| 20 | Ga0466700_192708 | 3300042600 | Bacteria | 1004 |
| 21 | Ga0466698_514428 | 3300042610 | Bacteria | 11096 |
| 22 | Ga0466718_076755 | 3300042617 | Bacteria | 6302 |
| 23 | Ga0466731_028947 | 3300042622 | Bacteria | 1525 |
| 24 | Ga0466702_054306 | 3300042635 | Bacteria | 4958 |
| 25 | Ga0466708_153665 | 3300042652 | Bacteria | 9204 |
| 26 | JGI24695J34938_10001318 | 3300002450 | Bacteria | 21600 |
| 27 | JGI24695J34938_10006506 | 3300002450 | Bacteria | 6992 |
| 28 | Ga0074263_109186 | 3300005485 | Bacteria | 1672 |
| 29 | Ga0264413_100818 | 3300024493 | Bacteria | 38955 |
| 30 | Ga0264413_110361 | 3300024493 | Bacteria | 33077 |
| 31 | Ga0466690_151907 | 3300042590 | Bacteria | 18937 |
| 32 | Ga0123353_11596989 | 3300010167 | Bacteria | 824 |
| 33 | Ga0466722_015129 | 3300042609 | Bacteria | 2922 |
| 34 | Ga0466711_328033 | 3300042615 | Bacteria | 2503 |
| 35 | Ga0466718_051031 | 3300042617 | Bacteria | 1598 |
| 36 | Ga0466718_077173 | 3300042617 | Bacteria | 5323 |
| 37 | Ga0466729_162323 | 3300042621 | Bacteria | 1469 |
| 38 | Ga0466735_065961 | 3300042624 | Bacteria | 3652 |
| 39 | Ga0466709_000526 | 3300042648 | Bacteria | 10476 |
| 40 | JGI24695J34938_10005773 | 3300002450 | Bacteria | 7620 |
| 41 | Ga0072941_1073391 | 3300005201 | Bacteria | 3019 |
| 42 | Ga0072941_1101066 | 3300005201 | Archaea | 1874 |
| 43 | Ga0466693_047521 | 3300042592 | Bacteria | 1568 |
| 44 | Ga0466696_276288 | 3300042596 | Bacteria | 4805 |
| 45 | Ga0466696_283144 | 3300042596 | Bacteria | 3828 |
| 46 | Ga0466706_064804 | 3300042599 | Bacteria | 1323 |
| 47 | Ga0466719_053151 | 3300042606 | Bacteria | 5908 |
| 48 | Ga0466712_041387 | 3300042614 | Bacteria | 51755 |
| 49 | Ga0466711_077645 | 3300042615 | Bacteria | 24912 |
| 50 | Ga0466718_055554 | 3300042617 | Bacteria | 2268 |
| 51 | Ga0466718_065764 | 3300042617 | Bacteria | 2299 |
| 52 | Ga0466728_104531 | 3300042620 | Bacteria | 5358 |
| 53 | Ga0466731_212179 | 3300042622 | Bacteria | 1019 |
| 54 | Ga0466731_256189 | 3300042622 | Bacteria | 1254 |
| 55 | Ga0466727_084085 | 3300042655 | Bacteria | 4979 |
| 56 | Ga0456237_0000773 | 3300041968 | Bacteria | 4962 |
| 57 | Ga0466690_096133 | 3300042590 | Bacteria | 10685 |
| 58 | Ga0466693_170633 | 3300042592 | Bacteria | 9429 |
| 59 | Ga0466691_136635 | 3300042593 | Bacteria | 3125 |
| 60 | Ga0466716_167230 | 3300042605 | Bacteria | 1242 |
| 61 | Ga0466719_564605 | 3300042606 | Unclassified | 1074 |
| 62 | Ga0466722_132403 | 3300042609 | Bacteria | 1617 |
| 63 | Ga0466722_191829 | 3300042609 | Bacteria | 2043 |
| 64 | Ga0466712_228681 | 3300042614 | Bacteria | 33247 |
| 65 | Ga0466715_330493 | 3300042616 | Bacteria | 21938 |
| 66 | Ga0466718_020320 | 3300042617 | Bacteria | 6618 |
| 67 | Ga0466723_084037 | 3300042618 | Bacteria | 1646 |
| 68 | Ga0466726_144885 | 3300042619 | Bacteria | 1991 |
| 69 | Ga0466728_387061 | 3300042620 | Bacteria | 14937 |
| 70 | Ga0466702_229243 | 3300042635 | Bacteria | 14965 |
| 71 | JGI24698J34947_10032165 | 3300002449 | Unclassified | 2756 |
| 72 | JGI24698J34947_10056418 | 3300002449 | Bacteria | 1953 |
| 73 | JGI24695J34938_10168676 | 3300002450 | Bacteria | 902 |
| 74 | Ga0072941_1083423 | 3300005201 | Bacteria | 3550 |
| 75 | Ga0466732_367648 | 3300042656 | Bacteria | 5480 |
| 76 | Ga0466694_220570 | 3300042594 | Bacteria | 23857 |
| 77 | Ga0466699_190979 | 3300042597 | Bacteria | 9895 |
| 78 | Ga0123356_10039110 | 3300010049 | Bacteria | 4420 |
| 79 | Ga0123356_11084642 | 3300010049 | Bacteria | 969 |
| 80 | Ga0466712_002934 | 3300042614 | Unclassified | 1729 |
| 81 | Ga0466712_027725 | 3300042614 | Bacteria | 34997 |
| 82 | Ga0466712_263031 | 3300042614 | Bacteria | 2586 |
| 83 | Ga0466712_297965 | 3300042614 | Bacteria | 4078 |
| 84 | Ga0466718_039873 | 3300042617 | Bacteria | 2718 |
| 85 | Ga0466726_222169 | 3300042619 | Bacteria | 24411 |
| 86 | Ga0466731_301419 | 3300042622 | Bacteria | 1200 |
| 87 | Ga0466704_167597 | 3300042643 | Bacteria | 1418 |
| 88 | Ga0466708_314781 | 3300042652 | Bacteria | 2808 |
| 89 | Ga0466727_342820 | 3300042655 | Bacteria | 1059 |
| 90 | JGI24698J34947_10000007 | 3300002449 | Bacteria | 54610 |
| 91 | JGI24698J34947_10000364 | 3300002449 | Bacteria | 20304 |
| 92 | JGI24695J34938_10000682 | 3300002450 | Bacteria | 32027 |
| 93 | JGI24702J35022_10000258 | 3300002462 | Bacteria | 30271 |
| 94 | Ga0072940_1036171 | 3300005200 | Bacteria | 1975 |
| 95 | Ga0072941_1011779 | 3300005201 | Bacteria | 29388 |
| 96 | Ga0466732_269501 | 3300042656 | Bacteria | 3305 |
| 97 | Ga0466690_044997 | 3300042590 | Bacteria | 10540 |
| 98 | Ga0466690_259565 | 3300042590 | Bacteria | 5837 |
| 99 | Ga0466692_043164 | 3300042591 | Bacteria | 13863 |
| 100 | Ga0466691_220225 | 3300042593 | Bacteria | 12266 |
| 101 | Ga0466699_338698 | 3300042597 | Bacteria | 62334 |
| 102 | Ga0466722_137689 | 3300042609 | Bacteria | 4080 |
| 103 | Ga0466712_067298 | 3300042614 | Bacteria | 6159 |
| 104 | Ga0466715_069646 | 3300042616 | Bacteria | 4579 |
| 105 | Ga0466715_292434 | 3300042616 | Bacteria | 3746 |
| 106 | Ga0466726_003203 | 3300042619 | Bacteria | 2621 |
| 107 | Ga0466726_147134 | 3300042619 | Bacteria | 1879 |
| 108 | Ga0466729_122367 | 3300042621 | Bacteria | 1435 |
| 109 | Ga0466731_292101 | 3300042622 | Bacteria | 1166 |
| 110 | Ga0466731_301266 | 3300042622 | Bacteria | 2463 |
| 111 | Ga0466702_107435 | 3300042635 | Bacteria | 3210 |
| 112 | Ga0466704_066263 | 3300042643 | Bacteria | 3594 |
| 113 | Ga0466709_322584 | 3300042648 | Bacteria | 1444 |
| 114 | Ga0466727_237242 | 3300042655 | Bacteria | 1113 |
| 115 | JGI24695J34938_10003266 | 3300002450 | Unclassified | 11460 |
| 116 | JGI24695J34938_10005187 | 3300002450 | Bacteria | 8228 |
| 117 | Ga0466705_011443 | 3300042612 | Bacteria | 5195 |
| 118 | Ga0466705_151667 | 3300042612 | Bacteria | 14762 |
| 119 | Ga0415639_004451 | 3300038395 | Bacteria | 7993 |
| 120 | Ga0466692_105300 | 3300042591 | Bacteria | 4865 |
| 121 | Ga0466693_195521 | 3300042592 | Bacteria | 30403 |
| 122 | Ga0466699_050425 | 3300042597 | Bacteria | 17032 |
| 123 | Ga0123356_10066533 | 3300010049 | Bacteria | 3374 |
| 124 | Ga0466716_226871 | 3300042605 | Bacteria | 2282 |
| 125 | Ga0466712_220701 | 3300042614 | Unclassified | 17289 |
| 126 | Ga0466712_295969 | 3300042614 | Bacteria | 10682 |
| 127 | Ga0466711_008388 | 3300042615 | Bacteria | 30567 |
| 128 | Ga0466718_119078 | 3300042617 | Bacteria | 2651 |
| 129 | Ga0466723_116293 | 3300042618 | Bacteria | 6197 |
| 130 | Ga0466726_124671 | 3300042619 | Bacteria | 2722 |
| 131 | Ga0466703_184563 | 3300042636 | Bacteria | 11891 |
| 132 | Ga0466704_141981 | 3300042643 | Bacteria | 11856 |
| 133 | Ga0466704_299566 | 3300042643 | Bacteria | 6443 |
| 134 | Ga0466704_503145 | 3300042643 | Bacteria | 11664 |
| 135 | JGI24698J34947_10000157 | 3300002449 | Bacteria | 26130 |
| 136 | JGI24698J34947_10017259 | 3300002449 | Bacteria | 3914 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_003203 | Ga0466726_003203_2115_2582 | 155 |
| 2 | 3300042648 | Ga0466709_322584 | Ga0466709_322584_706_1236 | 159 |
| 3 | 3300042605 | Ga0466716_226871 | Ga0466716_226871_417_962 | 170 |
| 4 | 3300042590 | Ga0466690_096133 | Ga0466690_096133_3024_3545 | 173 |
| 5 | 3300042596 | Ga0466696_276288 | Ga0466696_276288_3127_3648 | 173 |
| 6 | 3300042636 | Ga0466703_184563 | Ga0466703_184563_6445_6966 | 173 |
| 7 | 3300042655 | Ga0466727_237242 | Ga0466727_237242_390_911 | 173 |
| 8 | 3300042607 | Ga0466720_158217 | Ga0466720_158217_151_678 | 175 |
| 9 | 3300042614 | Ga0466712_220701 | Ga0466712_220701_10123_10650 | 175 |
| 10 | 3300042617 | Ga0466718_055554 | Ga0466718_055554_1079_1606 | 175 |
| 11 | 3300042617 | Ga0466718_119078 | Ga0466718_119078_43_570 | 175 |
| 12 | 3300042619 | Ga0466726_147134 | Ga0466726_147134_1059_1601 | 175 |
| 13 | 3300002450 | JGI24695J34938_10001318 | JGI24695J34938_1000131813 | 176 |
| 14 | 3300002450 | JGI24695J34938_10063283 | JGI24695J34938_100632832 | 176 |
| 15 | 3300005201 | Ga0072941_1011779 | Ga0072941_101177912 | 176 |
| 16 | 3300024493 | Ga0264413_110361 | Ga0264413_11036112 | 176 |
| 17 | 3300038395 | Ga0415639_004451 | Ga0415639_004451_2298_2828 | 176 |
| 18 | 3300042592 | Ga0466693_047521 | Ga0466693_047521_520_1050 | 176 |
| 19 | 3300042597 | Ga0466699_050425 | Ga0466699_050425_15574_16104 | 176 |
| 20 | 3300042597 | Ga0466699_190979 | Ga0466699_190979_6276_6806 | 176 |
| 21 | 3300042599 | Ga0466706_064804 | Ga0466706_064804_695_1225 | 176 |
| 22 | 3300042608 | Ga0466721_236687 | Ga0466721_236687_958_1488 | 176 |
| 23 | 3300042610 | Ga0466698_514428 | Ga0466698_514428_4567_5097 | 176 |
| 24 | 3300042614 | Ga0466712_002934 | Ga0466712_002934_248_778 | 176 |
| 25 | 3300042614 | Ga0466712_041387 | Ga0466712_041387_31258_31788 | 176 |
| 26 | 3300042614 | Ga0466712_067298 | Ga0466712_067298_406_936 | 176 |
| 27 | 3300042614 | Ga0466712_263031 | Ga0466712_263031_947_1477 | 176 |
| 28 | 3300042614 | Ga0466712_295969 | Ga0466712_295969_9645_10175 | 176 |
| 29 | 3300042614 | Ga0466712_297965 | Ga0466712_297965_743_1273 | 176 |
| 30 | 3300042621 | Ga0466729_122367 | Ga0466729_122367_498_1028 | 176 |
| 31 | 3300042622 | Ga0466731_028947 | Ga0466731_028947_83_613 | 176 |
| 32 | 3300042622 | Ga0466731_292101 | Ga0466731_292101_12_542 | 176 |
| 33 | 3300042635 | Ga0466702_054306 | Ga0466702_054306_185_715 | 176 |
| 34 | 3300042635 | Ga0466702_107435 | Ga0466702_107435_209_739 | 176 |
| 35 | 3300042635 | Ga0466702_229243 | Ga0466702_229243_13177_13707 | 176 |
| 36 | iso_pr_bacteria | 2781125637 | 2781282689 | 176 |
| 37 | iso_pr_bacteria | 2781125649 | 2781307285 | 176 |
| 38 | 3300002449 | JGI24698J34947_10000157 | JGI24698J34947_1000015717 | 177 |
| 39 | 3300002449 | JGI24698J34947_10000364 | JGI24698J34947_1000036420 | 177 |
| 40 | 3300002449 | JGI24698J34947_10001753 | JGI24698J34947_100017532 | 177 |
| 41 | 3300002449 | JGI24698J34947_10017259 | JGI24698J34947_100172593 | 177 |
| 42 | 3300002449 | JGI24698J34947_10023807 | JGI24698J34947_100238073 | 177 |
| 43 | 3300002449 | JGI24698J34947_10029904 | JGI24698J34947_100299043 | 177 |
| 44 | 3300002449 | JGI24698J34947_10032165 | JGI24698J34947_100321652 | 177 |
| 45 | 3300002449 | JGI24698J34947_10080437 | JGI24698J34947_100804372 | 177 |
| 46 | 3300002450 | JGI24695J34938_10005773 | JGI24695J34938_100057737 | 177 |
| 47 | 3300005200 | Ga0072940_1036171 | Ga0072940_10361713 | 177 |
| 48 | 3300005201 | Ga0072941_1073391 | Ga0072941_10733913 | 177 |
| 49 | 3300024493 | Ga0264413_100818 | Ga0264413_10081819 | 177 |
| 50 | 3300042597 | Ga0466699_103184 | Ga0466699_103184_43684_44217 | 177 |
| 51 | 3300042597 | Ga0466699_174915 | Ga0466699_174915_810_1343 | 177 |
| 52 | 3300042612 | Ga0466705_011443 | Ga0466705_011443_148_681 | 177 |
| 53 | 3300042614 | Ga0466712_027725 | Ga0466712_027725_2415_2948 | 177 |
| 54 | 3300042614 | Ga0466712_067298 | Ga0466712_067298_2181_2714 | 177 |
| 55 | 3300042614 | Ga0466712_228681 | Ga0466712_228681_5327_5860 | 177 |
| 56 | 3300042615 | Ga0466711_077645 | Ga0466711_077645_6368_6901 | 177 |
| 57 | 3300042617 | Ga0466718_020320 | Ga0466718_020320_1533_2066 | 177 |
| 58 | 3300042617 | Ga0466718_065764 | Ga0466718_065764_1694_2227 | 177 |
| 59 | 3300042617 | Ga0466718_076755 | Ga0466718_076755_670_1203 | 177 |
| 60 | 3300042643 | Ga0466704_141981 | Ga0466704_141981_1352_1885 | 177 |
| 61 | 3300042655 | Ga0466727_084085 | Ga0466727_084085_1794_2327 | 177 |
| 62 | 3300002449 | JGI24698J34947_10000007 | JGI24698J34947_1000000746 | 178 |
| 63 | 3300002449 | JGI24698J34947_10056418 | JGI24698J34947_100564182 | 178 |
| 64 | 3300005201 | Ga0072941_1083423 | Ga0072941_10834232 | 178 |
| 65 | 3300042617 | Ga0466718_039873 | Ga0466718_039873_1038_1574 | 178 |
| 66 | 3300042617 | Ga0466718_051031 | Ga0466718_051031_602_1138 | 178 |
| 67 | 3300042617 | Ga0466718_077173 | Ga0466718_077173_2794_3330 | 178 |
| 68 | 3300042618 | Ga0466723_084037 | Ga0466723_084037_258_794 | 178 |
| 69 | 3300042656 | Ga0466732_269501 | Ga0466732_269501_2721_3257 | 178 |
| 70 | 3300042656 | Ga0466732_367648 | Ga0466732_367648_3017_3553 | 178 |
| 71 | 3300002450 | JGI24695J34938_10003266 | JGI24695J34938_100032665 | 179 |
| 72 | 3300005201 | Ga0072941_1019378 | Ga0072941_10193786 | 179 |
| 73 | 3300042590 | Ga0466690_259565 | Ga0466690_259565_3498_4037 | 179 |
| 74 | 3300042591 | Ga0466692_105300 | Ga0466692_105300_1956_2495 | 179 |
| 75 | 3300042609 | Ga0466722_132403 | Ga0466722_132403_652_1191 | 179 |
| 76 | 3300042612 | Ga0466705_151667 | Ga0466705_151667_13884_14423 | 179 |
| 77 | 3300042615 | Ga0466711_328033 | Ga0466711_328033_1776_2315 | 179 |
| 78 | 3300042620 | Ga0466728_387061 | Ga0466728_387061_1243_1782 | 179 |
| 79 | 3300042622 | Ga0466731_301266 | Ga0466731_301266_1697_2236 | 179 |
| 80 | 3300002450 | JGI24695J34938_10018502 | JGI24695J34938_100185024 | 180 |
| 81 | 3300041968 | Ga0456237_0000773 | Ga0456237_0000773_1118_1660 | 180 |
| 82 | 3300042591 | Ga0466692_043164 | Ga0466692_043164_11278_11820 | 180 |
| 83 | 3300042609 | Ga0466722_191829 | Ga0466722_191829_1155_1697 | 180 |
| 84 | 3300042643 | Ga0466704_299566 | Ga0466704_299566_944_1486 | 180 |
| 85 | 3300042643 | Ga0466704_302485 | Ga0466704_302485_844_1386 | 180 |
| 86 | 3300010167 | Ga0123353_11596989 | Ga0123353_115969891 | 181 |
| 87 | 3300042596 | Ga0466696_283144 | Ga0466696_283144_2264_2809 | 181 |
| 88 | 3300042597 | Ga0466699_338698 | Ga0466699_338698_16221_16766 | 181 |
| 89 | 3300042605 | Ga0466716_167230 | Ga0466716_167230_380_925 | 181 |
| 90 | 3300042609 | Ga0466722_015129 | Ga0466722_015129_1381_1926 | 181 |
| 91 | 3300042615 | Ga0466711_008388 | Ga0466711_008388_22711_23256 | 181 |
| 92 | 3300042622 | Ga0466731_256189 | Ga0466731_256189_650_1195 | 181 |
| 93 | 3300042655 | Ga0466727_342820 | Ga0466727_342820_61_606 | 181 |
| 94 | 3300002450 | JGI24695J34938_10000682 | JGI24695J34938_100006827 | 182 |
| 95 | 3300002450 | JGI24695J34938_10005187 | JGI24695J34938_100051876 | 182 |
| 96 | 3300002450 | JGI24695J34938_10168676 | JGI24695J34938_101686761 | 182 |
| 97 | 3300042592 | Ga0466693_146536 | Ga0466693_146536_2386_2934 | 182 |
| 98 | 3300042597 | Ga0466699_110405 | Ga0466699_110405_365_913 | 182 |
| 99 | 3300042622 | Ga0466731_301419 | Ga0466731_301419_463_1011 | 182 |
| 100 | iso_pr_bacteria | 2781125690 | 2781428554 | 182 |
| 101 | 3300010049 | Ga0123356_10066533 | Ga0123356_100665334 | 183 |
| 102 | 3300010049 | Ga0123356_11084642 | Ga0123356_110846423 | 183 |
| 103 | 3300042592 | Ga0466693_195521 | Ga0466693_195521_24789_25340 | 183 |
| 104 | 3300042594 | Ga0466694_220570 | Ga0466694_220570_4001_4552 | 183 |
| 105 | 3300042600 | Ga0466700_192708 | Ga0466700_192708_363_914 | 183 |
| 106 | 3300042609 | Ga0466722_137689 | Ga0466722_137689_914_1465 | 183 |
| 107 | 3300042622 | Ga0466731_212179 | Ga0466731_212179_47_598 | 183 |
| 108 | 3300042643 | Ga0466704_167597 | Ga0466704_167597_665_1216 | 183 |
| 109 | iso_pr_bacteria | 2781125632 | 2781269569 | 183 |
| 110 | 3300002450 | JGI24695J34938_10006506 | JGI24695J34938_100065064 | 184 |
| 111 | 3300005485 | Ga0074263_109186 | Ga0074263_1091861 | 184 |
| 112 | 3300009784 | Ga0123357_10235386 | Ga0123357_102353862 | 184 |
| 113 | 3300010167 | Ga0123353_10512021 | Ga0123353_105120212 | 184 |
| 114 | 3300042636 | Ga0466703_049399 | Ga0466703_049399_15226_15780 | 184 |
| 115 | 3300042616 | Ga0466715_292434 | Ga0466715_292434_1919_2476 | 185 |
| 116 | 3300042643 | Ga0466704_066263 | Ga0466704_066263_883_1440 | 185 |
| 117 | 3300042648 | Ga0466709_000526 | Ga0466709_000526_1751_2308 | 185 |
| 118 | 3300042606 | Ga0466719_564605 | Ga0466719_564605_126_686 | 186 |
| 119 | 3300042621 | Ga0466729_162323 | Ga0466729_162323_342_902 | 186 |
| 120 | 3300005201 | Ga0072941_1101066 | Ga0072941_11010662 | 187 |
| 121 | 3300042590 | Ga0466690_151907 | Ga0466690_151907_2955_3518 | 187 |
| 122 | 3300042606 | Ga0466719_053151 | Ga0466719_053151_1130_1693 | 187 |
| 123 | 3300042616 | Ga0466715_330493 | Ga0466715_330493_20333_20896 | 187 |
| 124 | 3300042618 | Ga0466723_116293 | Ga0466723_116293_1151_1714 | 187 |
| 125 | 3300042619 | Ga0466726_144885 | Ga0466726_144885_980_1561 | 187 |
| 126 | 3300002462 | JGI24702J35022_10000258 | JGI24702J35022_100002582 | 188 |
| 127 | 3300042592 | Ga0466693_170633 | Ga0466693_170633_1879_2445 | 188 |
| 128 | 3300042593 | Ga0466691_220225 | Ga0466691_220225_8912_9478 | 188 |
| 129 | 3300042619 | Ga0466726_183752 | Ga0466726_183752_2299_2865 | 188 |
| 130 | 3300042652 | Ga0466708_153665 | Ga0466708_153665_2424_2993 | 189 |
| 131 | 3300010049 | Ga0123356_10039110 | Ga0123356_100391102 | 190 |
| 132 | 3300042619 | Ga0466726_222169 | Ga0466726_222169_7194_7766 | 190 |
| 133 | 3300042593 | Ga0466691_136635 | Ga0466691_136635_2525_3100 | 191 |
| 134 | 3300042590 | Ga0466690_409828 | Ga0466690_409828_478_1056 | 192 |
| 135 | 3300042652 | Ga0466708_314781 | Ga0466708_314781_936_1514 | 192 |
| 136 | 3300042590 | Ga0466690_044997 | Ga0466690_044997_7950_8603 | 193 |
| 137 | 3300042619 | Ga0466726_124671 | Ga0466726_124671_910_1491 | 193 |
| 138 | 3300042616 | Ga0466715_069646 | Ga0466715_069646_2996_3583 | 195 |
| 139 | 3300042643 | Ga0466704_503145 | Ga0466704_503145_3983_4570 | 195 |
| 140 | 3300042620 | Ga0466728_104531 | Ga0466728_104531_4167_4781 | 204 |
| 141 | 3300042624 | Ga0466735_065961 | Ga0466735_065961_1191_1883 | 204 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.