Protein Family IF08754
Metagenome
Isolate
123
Members
53
Samples
117
Scaffolds
115.74
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_060781|Ga0466735_060781_1588_1998
- Length
- 136 aa
- Sequence
- VEKLFLSCIFGMNYYYRKQDMKRSDWKERLDVVYSTNPNFHYETASDNEVLTTLASGKQTLRVLLDKKNRGGKMVTLVTGFVGTEEDLKELGKLLKVKCGVGGAIKNGEIIIQGDFRQRVSELLKKEGYDKTKIVG
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.5%
Kalotermitidae
26.9%
Unclassified
15.4%
Passalidae
5.8%
Rhinotermitidae
5.8%
Termopsidae
5.8%
Culicidae
1.9%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
2
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 5 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 13 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 36 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 37 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 38 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 39 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_143850 | 3300042612 | Bacteria | 38978 |
| 2 | Ga0466705_276645 | 3300042612 | Bacteria | 17562 |
| 3 | Ga0466735_001834 | 3300042624 | Bacteria | 1136 |
| 4 | Ga0466703_150283 | 3300042636 | Bacteria | 2603 |
| 5 | Ga0466709_375607 | 3300042648 | Bacteria | 6562 |
| 6 | Ga0466708_051692 | 3300042652 | Bacteria | 11048 |
| 7 | Ga0466727_102955 | 3300042655 | Bacteria | 4906 |
| 8 | Ga0160458_100060 | 3300012832 | Bacteria | 140698 |
| 9 | Ga0466657_070511 | 3300042582 | Bacteria | 1163 |
| 10 | Ga0123354_10191248 | 3300010882 | Unclassified | 2290 |
| 11 | Ga0466711_212383 | 3300042615 | Bacteria | 31353 |
| 12 | Ga0466726_010869 | 3300042619 | Bacteria | 2896 |
| 13 | Ga0466700_110178 | 3300042600 | Bacteria | 1220 |
| 14 | Ga0466700_155855 | 3300042600 | Bacteria | 5333 |
| 15 | Ga0466707_347714 | 3300042601 | Bacteria | 4915 |
| 16 | 2227531889 | 2225789004 | Bacteria | 630 |
| 17 | IMNBL1DRAFT_c0001731 | 3300000062 | Bacteria | 16021 |
| 18 | Ga0466734_003070 | 3300042623 | Bacteria | 1373 |
| 19 | Ga0466735_061169 | 3300042624 | Bacteria | 3565 |
| 20 | Ga0466735_187504 | 3300042624 | Bacteria | 1450 |
| 21 | Ga0466735_210716 | 3300042624 | Unclassified | 1026 |
| 22 | Ga0466735_232293 | 3300042624 | Bacteria | 2750 |
| 23 | Ga0466703_267681 | 3300042636 | Bacteria | 6963 |
| 24 | Ga0466724_46733 | 3300042649 | Bacteria | 1217 |
| 25 | Ga0466708_052202 | 3300042652 | Bacteria | 4494 |
| 26 | Ga0466725_320152 | 3300042654 | Bacteria | 12291 |
| 27 | Ga0123357_10392690 | 3300009784 | Bacteria | 1273 |
| 28 | Ga0123354_10100820 | 3300010882 | Bacteria | 3905 |
| 29 | Ga0466715_098533 | 3300042616 | Bacteria | 22041 |
| 30 | Ga0466723_075605 | 3300042618 | Bacteria | 4634 |
| 31 | Ga0466726_028521 | 3300042619 | Bacteria | 6285 |
| 32 | Ga0466701_027323 | 3300042598 | Bacteria | 1964 |
| 33 | 2227465475 | 2225789004 | Bacteria | 5186 |
| 34 | IMNBL1DRAFT_c0004194 | 3300000062 | Bacteria | 8759 |
| 35 | JGI24702J35022_10251366 | 3300002462 | Bacteria | 1029 |
| 36 | Ga0072941_1786251 | 3300005201 | Bacteria | 1020 |
| 37 | Ga0466704_192435 | 3300042643 | Bacteria | 41126 |
| 38 | Ga0466690_023569 | 3300042590 | Bacteria | 17608 |
| 39 | Ga0466690_121011 | 3300042590 | Bacteria | 1436 |
| 40 | Ga0466692_101863 | 3300042591 | Bacteria | 1243 |
| 41 | Ga0466691_084465 | 3300042593 | Bacteria | 1035 |
| 42 | Ga0466695_030485 | 3300042595 | Bacteria | 1172 |
| 43 | Ga0123353_10855889 | 3300010167 | Bacteria | 1245 |
| 44 | Ga0466710_319996 | 3300042613 | Bacteria | 2852 |
| 45 | Ga0466728_209794 | 3300042620 | Bacteria | 4602 |
| 46 | Ga0466719_266865 | 3300042606 | Bacteria | 11683 |
| 47 | 2227080812 | 2225789004 | Bacteria | 39684 |
| 48 | 2227524342 | 2225789004 | Bacteria | 3277 |
| 49 | IMNBL1DRAFT_c0140907 | 3300000062 | Bacteria | 623 |
| 50 | JGI24702J35022_10002198 | 3300002462 | Bacteria | 12011 |
| 51 | JGI24702J35022_10076296 | 3300002462 | Bacteria | 1811 |
| 52 | JGI24705J35276_12233685 | 3300002504 | Viruses | 4991 |
| 53 | JGI24699J35502_11134036 | 3300002509 | Bacteria | 25896 |
| 54 | Ga0466734_078398 | 3300042623 | Bacteria | 1806 |
| 55 | Ga0466735_000069 | 3300042624 | Bacteria | 1919 |
| 56 | Ga0466735_042311 | 3300042624 | Bacteria | 2710 |
| 57 | Ga0466704_125322 | 3300042643 | Bacteria | 12471 |
| 58 | Ga0466704_202502 | 3300042643 | Bacteria | 2297 |
| 59 | Ga0466692_114443 | 3300042591 | Bacteria | 25719 |
| 60 | Ga0123357_10164195 | 3300009784 | Bacteria | 2651 |
| 61 | Ga0123356_13640384 | 3300010049 | Bacteria | 533 |
| 62 | Ga0466711_118278 | 3300042615 | Bacteria | 21306 |
| 63 | Ga0466723_144191 | 3300042618 | Bacteria | 11301 |
| 64 | Ga0466713_077113 | 3300042602 | Bacteria | 10235 |
| 65 | JGI24699J35502_11134186 | 3300002509 | Bacteria | 47913 |
| 66 | Ga0123357_10001873 | 3300009784 | Bacteria | 22846 |
| 67 | Ga0466704_106814 | 3300042643 | Bacteria | 18291 |
| 68 | Ga0466724_19292 | 3300042649 | Bacteria | 1708 |
| 69 | Ga0466691_044327 | 3300042593 | Bacteria | 5364 |
| 70 | Ga0466691_090212 | 3300042593 | Bacteria | 5815 |
| 71 | Ga0466691_183157 | 3300042593 | Bacteria | 11262 |
| 72 | Ga0466694_220359 | 3300042594 | Viruses | 1147 |
| 73 | Ga0466696_321318 | 3300042596 | Bacteria | 1980 |
| 74 | Ga0123357_10025040 | 3300009784 | Bacteria | 8044 |
| 75 | Ga0123354_10008354 | 3300010882 | Bacteria | 15731 |
| 76 | Ga0466728_111487 | 3300042620 | Bacteria | 4500 |
| 77 | Ga0466728_210785 | 3300042620 | Bacteria | 15229 |
| 78 | Ga0466728_397205 | 3300042620 | Bacteria | 7898 |
| 79 | Ga0466707_009633 | 3300042601 | Bacteria | 35190 |
| 80 | 2227507962 | 2225789004 | Bacteria | 64470 |
| 81 | JGI24699J35502_10718139 | 3300002509 | Bacteria | 784 |
| 82 | Ga0123357_10000604 | 3300009784 | Bacteria | 35558 |
| 83 | Ga0466733_071191 | 3300042659 | Bacteria | 1635 |
| 84 | Ga0466735_058805 | 3300042624 | Bacteria | 5454 |
| 85 | Ga0466735_092940 | 3300042624 | Bacteria | 11195 |
| 86 | Ga0466735_132780 | 3300042624 | Bacteria | 2443 |
| 87 | Ga0466735_136261 | 3300042624 | Bacteria | 1997 |
| 88 | Ga0466704_242471 | 3300042643 | Bacteria | 6401 |
| 89 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 90 | Ga0123354_10001986 | 3300010882 | Bacteria | 26232 |
| 91 | Ga0466715_082318 | 3300042616 | Bacteria | 2826 |
| 92 | Ga0466697_012774 | 3300042611 | Bacteria | 1420 |
| 93 | IMNBGM34_c014472 | 3300000036 | Bacteria | 983 |
| 94 | IMNBL1DRAFT_c0025697 | 3300000062 | Bacteria | 2253 |
| 95 | Ga0068305_10218271 | 3300005083 | Bacteria | 4789 |
| 96 | Ga0072941_1366222 | 3300005201 | Bacteria | 4208 |
| 97 | Ga0466735_060781 | 3300042624 | Bacteria | 2690 |
| 98 | Ga0466696_232046 | 3300042596 | Bacteria | 8567 |
| 99 | Ga0123357_10225289 | 3300009784 | Bacteria | 2069 |
| 100 | Ga0123357_10321564 | 3300009784 | Bacteria | 1527 |
| 101 | Ga0466726_079747 | 3300042619 | Unclassified | 1242 |
| 102 | Ga0466700_153254 | 3300042600 | Bacteria | 4514 |
| 103 | Ga0466707_179989 | 3300042601 | Bacteria | 30155 |
| 104 | Ga0466714_167113 | 3300042603 | Bacteria | 3699 |
| 105 | Ga0466722_015800 | 3300042609 | Unclassified | 5468 |
| 106 | IMNBL1DRAFT_c0000559 | 3300000062 | Bacteria | 30050 |
| 107 | Ga0466725_237159 | 3300042654 | Bacteria | 13903 |
| 108 | Ga0123353_10534630 | 3300010167 | Bacteria | 1696 |
| 109 | Ga0123354_10001302 | 3300010882 | Bacteria | 29724 |
| 110 | Ga0466715_005641 | 3300042616 | Bacteria | 12118 |
| 111 | Ga0466700_358534 | 3300042600 | Bacteria | 1188 |
| 112 | Ga0466700_445390 | 3300042600 | Bacteria | 6480 |
| 113 | Ga0466707_254121 | 3300042601 | Bacteria | 9455 |
| 114 | Ga0466716_537235 | 3300042605 | Bacteria | 22300 |
| 115 | Ga0466698_087059 | 3300042610 | Bacteria | 2027 |
| 116 | IMNBGM34_c003812 | 3300000036 | Bacteria | 2069 |
| 117 | JGI24699J35502_11134193 | 3300002509 | Bacteria | 50742 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042603 | Ga0466714_167113 | Ga0466714_167113_3242_3562 | 106 |
| 2 | 3300042619 | Ga0466726_028521 | Ga0466726_028521_645_989 | 109 |
| 3 | 3300042612 | Ga0466705_143850 | Ga0466705_143850_24857_25189 | 110 |
| 4 | 3300010167 | Ga0123353_10855889 | Ga0123353_108558892 | 111 |
| 5 | 3300042643 | Ga0466704_242471 | Ga0466704_242471_5112_5447 | 111 |
| 6 | 3300042591 | Ga0466692_114443 | Ga0466692_114443_3752_4090 | 112 |
| 7 | 3300042593 | Ga0466691_090212 | Ga0466691_090212_3482_3820 | 112 |
| 8 | 3300042649 | Ga0466724_46733 | Ga0466724_46733_81_419 | 112 |
| 9 | 3300042596 | Ga0466696_232046 | Ga0466696_232046_4627_4968 | 113 |
| 10 | 3300042623 | Ga0466734_078398 | Ga0466734_078398_953_1294 | 113 |
| 11 | 3300042654 | Ga0466725_320152 | Ga0466725_320152_4737_5078 | 113 |
| 12 | 2225789004 | 2227507962 | 2227998970 | 114 |
| 13 | 2225789004 | 2227524342 | 2228030533 | 114 |
| 14 | 3300000036 | IMNBGM34_c003812 | IMNBGM34_0038122 | 114 |
| 15 | 3300000036 | IMNBGM34_c014472 | IMNBGM34_0144722 | 114 |
| 16 | 3300042582 | Ga0466657_070511 | Ga0466657_070511_121_465 | 114 |
| 17 | 3300042590 | Ga0466690_023569 | Ga0466690_023569_11001_11345 | 114 |
| 18 | 3300042590 | Ga0466690_121011 | Ga0466690_121011_525_869 | 114 |
| 19 | 3300042590 | Ga0466690_381813 | Ga0466690_381813_17485_17829 | 114 |
| 20 | 3300042591 | Ga0466692_101863 | Ga0466692_101863_497_841 | 114 |
| 21 | 3300042593 | Ga0466691_044327 | Ga0466691_044327_3335_3679 | 114 |
| 22 | 3300042593 | Ga0466691_084465 | Ga0466691_084465_533_877 | 114 |
| 23 | 3300042595 | Ga0466695_030485 | Ga0466695_030485_737_1081 | 114 |
| 24 | 3300042596 | Ga0466696_321318 | Ga0466696_321318_1258_1602 | 114 |
| 25 | 3300042601 | Ga0466707_009633 | Ga0466707_009633_14275_14619 | 114 |
| 26 | 3300042601 | Ga0466707_179989 | Ga0466707_179989_13666_14010 | 114 |
| 27 | 3300042601 | Ga0466707_347714 | Ga0466707_347714_110_454 | 114 |
| 28 | 3300042605 | Ga0466716_537235 | Ga0466716_537235_16683_17027 | 114 |
| 29 | 3300042609 | Ga0466722_015800 | Ga0466722_015800_4539_4883 | 114 |
| 30 | 3300042613 | Ga0466710_319996 | Ga0466710_319996_1684_2028 | 114 |
| 31 | 3300042615 | Ga0466711_118278 | Ga0466711_118278_5287_5631 | 114 |
| 32 | 3300042615 | Ga0466711_212383 | Ga0466711_212383_17184_17528 | 114 |
| 33 | 3300042616 | Ga0466715_005641 | Ga0466715_005641_5335_5679 | 114 |
| 34 | 3300042616 | Ga0466715_082318 | Ga0466715_082318_587_931 | 114 |
| 35 | 3300042616 | Ga0466715_098533 | Ga0466715_098533_13672_14016 | 114 |
| 36 | 3300042618 | Ga0466723_075605 | Ga0466723_075605_2877_3221 | 114 |
| 37 | 3300042620 | Ga0466728_111487 | Ga0466728_111487_3598_3942 | 114 |
| 38 | 3300042620 | Ga0466728_210785 | Ga0466728_210785_7935_8279 | 114 |
| 39 | 3300042620 | Ga0466728_397205 | Ga0466728_397205_2487_2831 | 114 |
| 40 | 3300042624 | Ga0466735_092940 | Ga0466735_092940_8551_8895 | 114 |
| 41 | 3300042624 | Ga0466735_132780 | Ga0466735_132780_207_551 | 114 |
| 42 | 3300042636 | Ga0466703_150283 | Ga0466703_150283_418_762 | 114 |
| 43 | 3300042636 | Ga0466703_267681 | Ga0466703_267681_5880_6224 | 114 |
| 44 | 3300042643 | Ga0466704_106814 | Ga0466704_106814_12080_12424 | 114 |
| 45 | 3300042643 | Ga0466704_202502 | Ga0466704_202502_465_809 | 114 |
| 46 | 3300042648 | Ga0466709_375607 | Ga0466709_375607_1118_1462 | 114 |
| 47 | 3300042654 | Ga0466725_237159 | Ga0466725_237159_6028_6372 | 114 |
| 48 | iso_pr_bacteria | 2820757377 | 2820758434 | 114 |
| 49 | 2225789004 | 2227080812 | 2227454888 | 115 |
| 50 | 3300000062 | IMNBL1DRAFT_c0001731 | IMNBL1DRAFT_000173112 | 115 |
| 51 | 3300000062 | IMNBL1DRAFT_c0004194 | IMNBL1DRAFT_00041942 | 115 |
| 52 | 3300000062 | IMNBL1DRAFT_c0140907 | IMNBL1DRAFT_01409071 | 115 |
| 53 | 3300002509 | JGI24699J35502_11134036 | JGI24699J35502_1113403616 | 115 |
| 54 | 3300005083 | Ga0068305_10218271 | Ga0068305_102182717 | 115 |
| 55 | 3300009784 | Ga0123357_10321564 | Ga0123357_103215642 | 115 |
| 56 | 3300010049 | Ga0123356_13640384 | Ga0123356_136403841 | 115 |
| 57 | 3300042593 | Ga0466691_183157 | Ga0466691_183157_1017_1364 | 115 |
| 58 | 3300042594 | Ga0466694_220359 | Ga0466694_220359_528_875 | 115 |
| 59 | 3300042598 | Ga0466701_027323 | Ga0466701_027323_1084_1431 | 115 |
| 60 | 3300042600 | Ga0466700_110178 | Ga0466700_110178_221_568 | 115 |
| 61 | 3300042600 | Ga0466700_153254 | Ga0466700_153254_3224_3571 | 115 |
| 62 | 3300042600 | Ga0466700_155855 | Ga0466700_155855_1869_2216 | 115 |
| 63 | 3300042600 | Ga0466700_358534 | Ga0466700_358534_134_481 | 115 |
| 64 | 3300042600 | Ga0466700_445390 | Ga0466700_445390_5069_5416 | 115 |
| 65 | 3300042601 | Ga0466707_254121 | Ga0466707_254121_1564_1911 | 115 |
| 66 | 3300042606 | Ga0466719_266865 | Ga0466719_266865_7197_7544 | 115 |
| 67 | 3300042610 | Ga0466698_087059 | Ga0466698_087059_253_600 | 115 |
| 68 | 3300042611 | Ga0466697_012774 | Ga0466697_012774_722_1069 | 115 |
| 69 | 3300042618 | Ga0466723_144191 | Ga0466723_144191_5246_5593 | 115 |
| 70 | 3300042619 | Ga0466726_010869 | Ga0466726_010869_1735_2082 | 115 |
| 71 | 3300042620 | Ga0466728_209794 | Ga0466728_209794_3915_4262 | 115 |
| 72 | 3300042623 | Ga0466734_003070 | Ga0466734_003070_384_731 | 115 |
| 73 | 3300042652 | Ga0466708_051692 | Ga0466708_051692_10284_10631 | 115 |
| 74 | 3300042652 | Ga0466708_052202 | Ga0466708_052202_935_1282 | 115 |
| 75 | 3300042655 | Ga0466727_102955 | Ga0466727_102955_4484_4831 | 115 |
| 76 | 3300042659 | Ga0466733_071191 | Ga0466733_071191_296_643 | 115 |
| 77 | iso_pr_bacteria | 2820759988 | 2820762209 | 115 |
| 78 | iso_pr_bacteria | 2820762746 | 2820764687 | 115 |
| 79 | iso_pr_bacteria | 2820778767 | 2820781655 | 115 |
| 80 | 3300000062 | IMNBL1DRAFT_c0025697 | IMNBL1DRAFT_00256972 | 116 |
| 81 | 3300002462 | JGI24702J35022_10002198 | JGI24702J35022_100021983 | 116 |
| 82 | 3300002462 | JGI24702J35022_10076296 | JGI24702J35022_100762963 | 116 |
| 83 | 3300002504 | JGI24705J35276_12233685 | JGI24705J35276_122336853 | 116 |
| 84 | 3300002509 | JGI24699J35502_10718139 | JGI24699J35502_107181392 | 116 |
| 85 | 3300002509 | JGI24699J35502_11134186 | JGI24699J35502_1113418627 | 116 |
| 86 | 3300002509 | JGI24699J35502_11134193 | JGI24699J35502_1113419323 | 116 |
| 87 | 3300009784 | Ga0123357_10000604 | Ga0123357_1000060424 | 116 |
| 88 | 3300009784 | Ga0123357_10001873 | Ga0123357_1000187312 | 116 |
| 89 | 3300009784 | Ga0123357_10025040 | Ga0123357_100250401 | 116 |
| 90 | 3300009784 | Ga0123357_10392690 | Ga0123357_103926902 | 116 |
| 91 | 3300010167 | Ga0123353_10534630 | Ga0123353_105346302 | 116 |
| 92 | 3300010882 | Ga0123354_10001302 | Ga0123354_1000130212 | 116 |
| 93 | 3300010882 | Ga0123354_10001986 | Ga0123354_1000198611 | 116 |
| 94 | 3300010882 | Ga0123354_10008354 | Ga0123354_100083544 | 116 |
| 95 | 3300010882 | Ga0123354_10100820 | Ga0123354_101008202 | 116 |
| 96 | 3300042612 | Ga0466705_276645 | Ga0466705_276645_3559_3909 | 116 |
| 97 | 3300042624 | Ga0466735_000069 | Ga0466735_000069_1300_1650 | 116 |
| 98 | 3300042624 | Ga0466735_001834 | Ga0466735_001834_128_478 | 116 |
| 99 | 3300042624 | Ga0466735_042311 | Ga0466735_042311_56_406 | 116 |
| 100 | 3300042624 | Ga0466735_058805 | Ga0466735_058805_1156_1506 | 116 |
| 101 | 3300042624 | Ga0466735_061169 | Ga0466735_061169_873_1223 | 116 |
| 102 | 3300042624 | Ga0466735_136261 | Ga0466735_136261_1627_1977 | 116 |
| 103 | 3300042624 | Ga0466735_187504 | Ga0466735_187504_131_481 | 116 |
| 104 | 3300042624 | Ga0466735_210716 | Ga0466735_210716_490_840 | 116 |
| 105 | 3300042624 | Ga0466735_232293 | Ga0466735_232293_1839_2189 | 116 |
| 106 | 3300042643 | Ga0466704_192435 | Ga0466704_192435_32581_32931 | 116 |
| 107 | 3300042649 | Ga0466724_19292 | Ga0466724_19292_1232_1582 | 116 |
| 108 | iso_pr_bacteria | 2609459943 | 2610740219 | 116 |
| 109 | iso_pr_bacteria | 2830041218 | 2830041599 | 116 |
| 110 | 3300000062 | IMNBL1DRAFT_c0000559 | IMNBL1DRAFT_000055921 | 117 |
| 111 | 3300002462 | JGI24702J35022_10251366 | JGI24702J35022_102513662 | 117 |
| 112 | 3300005201 | Ga0072941_1366222 | Ga0072941_13662224 | 117 |
| 113 | 3300012832 | Ga0160458_100060 | Ga0160458_10006066 | 117 |
| 114 | 3300042619 | Ga0466726_079747 | Ga0466726_079747_477_830 | 117 |
| 115 | 3300042643 | Ga0466704_125322 | Ga0466704_125322_9802_10155 | 117 |
| 116 | 3300010882 | Ga0123354_10191248 | Ga0123354_101912483 | 119 |
| 117 | 3300005201 | Ga0072941_1786251 | Ga0072941_17862512 | 123 |
| 118 | 3300042602 | Ga0466713_077113 | Ga0466713_077113_4288_4659 | 123 |
| 119 | 2225789004 | 2227531889 | 2228044674 | 132 |
| 120 | 3300009784 | Ga0123357_10164195 | Ga0123357_101641952 | 134 |
| 121 | 3300009784 | Ga0123357_10225289 | Ga0123357_102252893 | 134 |
| 122 | 3300042624 | Ga0466735_060781 | Ga0466735_060781_1588_1998 | 136 |
| 123 | 2225789004 | 2227465475 | 2227903566 | 148 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01253 | SUI1 | Translation initiation factor SUI1 | 58 | 129 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.6 | 0.78 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.