Protein Family IF08751

Metagenome Isolate
126 Members
44 Samples
121 Scaffolds
255.7 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_052902|Ga0466735_052902_883_1806
Length
307 aa
Sequence
MNSIMVELFSSQNADFSVKKWLKERFNFMKNTNVELAGLEGCPRNALSGNTKAGVGKSRLAVRLIAGLCCLFSLLAAGCQKKGEGYQIATDTTFAPFEFQNSVKQYVGIDIDLLAAIAKDQSIEYTLKPLGFNAAVAALEAGQADGVIAGMSITEQRQKKYDFSQPYYDSGVVMAIKADNMDIKGYGDLAGKRVAVKTGTEGAVFAESIKDQYKFTIAYFDESPFMYEEVKTGNSAACFEDYPVMGYGISQNNGLKMVTGMEKGSSYGFAVLKGKNAELLAKFNAGLANIRENGKYQEIIDRYIKTE

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.7%
Kalotermitidae 33.3%
Unclassified 14.3%
Rhinotermitidae 9.5%
Termopsidae 7.1%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
12 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
31 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
32 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
41 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_123292 3300024493 Bacteria 1183
2 Ga0466690_271758 3300042590 Bacteria 1991
3 Ga0466699_102106 3300042597 Unclassified 1064
4 Ga0466716_495923 3300042605 Bacteria 1644
5 Ga0466719_064888 3300042606 Bacteria 3033
6 Ga0466720_152124 3300042607 Bacteria 6725
7 Ga0466722_097367 3300042609 Bacteria 7864
8 Ga0466722_192394 3300042609 Bacteria 7949
9 Ga0466698_464700 3300042610 Bacteria 1614
10 Ga0123356_10111178 3300010049 Bacteria 2647
11 Ga0123356_10194841 3300010049 Bacteria 2061
12 Ga0466703_104120 3300042636 Bacteria 9653
13 Ga0466708_180930 3300042652 Bacteria 28002
14 Ga0466715_214202 3300042616 Bacteria 2742
15 Ga0466715_507184 3300042616 Bacteria 2742
16 Ga0466726_259954 3300042619 Bacteria 4021
17 Ga0466726_298654 3300042619 Bacteria 23143
18 Ga0466728_033589 3300042620 Bacteria 1928
19 Ga0466692_191856 3300042591 Bacteria 2301
20 Ga0466694_138110 3300042594 Bacteria 15002
21 Ga0466694_309042 3300042594 Bacteria 1520
22 Ga0466699_142849 3300042597 Bacteria 4479
23 Ga0466699_191850 3300042597 Bacteria 3294
24 Ga0466707_217416 3300042601 Bacteria 2011
25 Ga0466707_268979 3300042601 Bacteria 22067
26 Ga0466714_158976 3300042603 Bacteria 1158
27 Ga0466719_061304 3300042606 Bacteria 5649
28 Ga0123354_10089333 3300010882 Bacteria 4277
29 JGI24698J34947_10012765 3300002449 Bacteria 4598
30 JGI24698J34947_10161508 3300002449 Bacteria 917
31 Ga0466704_469463 3300042643 Unclassified 14987
32 Ga0466712_006249 3300042614 Bacteria 1538
33 Ga0466715_024097 3300042616 Bacteria 6234
34 Ga0466723_128858 3300042618 Bacteria 4381
35 Ga0466728_092724 3300042620 Bacteria 1695
36 Ga0466691_006161 3300042593 Bacteria 6021
37 Ga0466699_169003 3300042597 Bacteria 3120
38 Ga0466707_387157 3300042601 Bacteria 1150
39 Ga0466716_320733 3300042605 Bacteria 1131
40 Ga0466719_395369 3300042606 Bacteria 2760
41 Ga0466722_151770 3300042609 Bacteria 4118
42 Ga0466698_363132 3300042610 Bacteria 3184
43 JGI24698J34947_10000834 3300002449 Bacteria 15444
44 JGI24702J35022_10014065 3300002462 Bacteria 4422
45 Ga0072940_1030942 3300005200 Bacteria 2729
46 Ga0072941_1017540 3300005201 Bacteria 12981
47 Ga0466735_135841 3300042624 Bacteria 1685
48 Ga0466704_547127 3300042643 Bacteria 3436
49 Ga0466727_050927 3300042655 Bacteria 1367
50 Ga0466723_201025 3300042618 Bacteria 5206
51 Ga0466726_413655 3300042619 Bacteria 6248
52 Ga0466729_174789 3300042621 Bacteria 3168
53 Ga0466705_247636 3300042612 Bacteria 1749
54 Ga0466732_057307 3300042656 Bacteria 2452
55 Ga0123356_10494804 3300010049 Bacteria 1378
56 JGI24695J34938_10007561 3300002450 Bacteria 6338
57 Ga0466704_465243 3300042643 Bacteria 25952
58 Ga0466709_166368 3300042648 Unclassified 5592
59 Ga0466727_134068 3300042655 Bacteria 2064
60 Ga0466712_009601 3300042614 Bacteria 1752
61 Ga0466711_188545 3300042615 Bacteria 5230
62 Ga0466718_055852 3300042617 Bacteria 6292
63 Ga0466732_100504 3300042656 Bacteria 7132
64 Ga0466691_166631 3300042593 Bacteria 5457
65 Ga0466691_222280 3300042593 Bacteria 2305
66 Ga0466694_171902 3300042594 Bacteria 3214
67 Ga0466694_342862 3300042594 Bacteria 1010
68 Ga0466703_025503 3300042636 Bacteria 1370
69 Ga0466703_041606 3300042636 Bacteria 6969
70 Ga0466708_198988 3300042652 Bacteria 7953
71 Ga0466708_448868 3300042652 Bacteria 4611
72 Ga0466705_416874 3300042612 Bacteria 7589
73 Ga0466715_362164 3300042616 Bacteria 1671
74 Ga0466718_141990 3300042617 Bacteria 1634
75 Ga0466728_137381 3300042620 Bacteria 2559
76 Ga0466696_389271 3300042596 Bacteria 12485
77 Ga0466707_369813 3300042601 Bacteria 1087
78 Ga0466720_042141 3300042607 Bacteria 3528
79 Ga0466722_069109 3300042609 Bacteria 31526
80 JGI24698J34947_10057157 3300002449 Bacteria 1937
81 Ga0466735_052902 3300042624 Bacteria 1913
82 Ga0466704_285532 3300042643 Unclassified 1709
83 Ga0466709_129731 3300042648 Bacteria 2696
84 Ga0466715_405755 3300042616 Bacteria 13194
85 Ga0466726_199249 3300042619 Bacteria 1277
86 Ga0466705_281638 3300042612 Unclassified 3274
87 Ga0456237_0005138 3300041968 Bacteria 2082
88 Ga0466690_048700 3300042590 Bacteria 4334
89 Ga0466692_007756 3300042591 Bacteria 1541
90 Ga0466691_041541 3300042593 Bacteria 6983
91 Ga0466694_031806 3300042594 Bacteria 3793
92 Ga0466696_187005 3300042596 Bacteria 3705
93 Ga0466707_070634 3300042601 Bacteria 1081
94 Ga0466719_109212 3300042606 Bacteria 39694
95 Ga0466720_125179 3300042607 Bacteria 9567
96 Ga0466722_026706 3300042609 Bacteria 11668
97 Ga0466722_062791 3300042609 Bacteria 1880
98 Ga0466722_184590 3300042609 Bacteria 7470
99 Ga0466722_245166 3300042609 Bacteria 1142
100 Ga0123356_10048380 3300010049 Bacteria 3958
101 Ga0123353_10626390 3300010167 Bacteria 1530
102 Ga0466703_205965 3300042636 Bacteria 8527
103 Ga0466709_092933 3300042648 Bacteria 51358
104 Ga0466708_092643 3300042652 Unclassified 1354
105 Ga0466712_247929 3300042614 Bacteria 1396
106 Ga0466715_075201 3300042616 Bacteria 8786
107 Ga0466726_257145 3300042619 Bacteria 2299
108 Ga0466705_201057 3300042612 Bacteria 6233
109 Ga0466705_215773 3300042612 Bacteria 1619
110 Ga0466705_224922 3300042612 Bacteria 13402
111 Ga0466692_088750 3300042591 Bacteria 6215
112 Ga0466696_022567 3300042596 Bacteria 14413
113 Ga0466707_026242 3300042601 Bacteria 3544
114 Ga0466714_013378 3300042603 Bacteria 2128
115 Ga0466719_022138 3300042606 Bacteria 1746
116 Ga0466704_349868 3300042643 Bacteria 1407
117 Ga0466708_211848 3300042652 Bacteria 2017
118 Ga0466708_274857 3300042652 Bacteria 29137
119 Ga0466711_226610 3300042615 Bacteria 2976
120 Ga0466711_317196 3300042615 Bacteria 22629
121 Ga0466718_140986 3300042617 Bacteria 3936

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300041968 Ga0456237_0005138 Ga0456237_0005138_1311_2051 246
2 3300042655 Ga0466727_134068 Ga0466727_134068_986_1726 246
3 3300042593 Ga0466691_166631 Ga0466691_166631_718_1461 247
4 3300042607 Ga0466720_125179 Ga0466720_125179_3430_4176 248
5 3300042652 Ga0466708_180930 Ga0466708_180930_3272_4045 248
6 3300042594 Ga0466694_342862 Ga0466694_342862_250_999 249
7 3300042605 Ga0466716_495923 Ga0466716_495923_734_1483 249
8 3300042609 Ga0466722_245166 Ga0466722_245166_380_1129 249
9 3300042643 Ga0466704_469463 Ga0466704_469463_451_1242 249
10 3300042652 Ga0466708_211848 Ga0466708_211848_269_1018 249
11 3300042655 Ga0466727_050927 Ga0466727_050927_379_1128 249
12 3300042606 Ga0466719_064888 Ga0466719_064888_1775_2527 250
13 3300042606 Ga0466719_395369 Ga0466719_395369_108_860 250
14 3300042614 Ga0466712_247929 Ga0466712_247929_206_958 250
15 3300042590 Ga0466690_048700 Ga0466690_048700_2421_3227 251
16 3300042596 Ga0466696_389271 Ga0466696_389271_10088_10843 251
17 3300042597 Ga0466699_102106 Ga0466699_102106_185_940 251
18 3300042609 Ga0466722_026706 Ga0466722_026706_7073_7828 251
19 3300042610 Ga0466698_464700 Ga0466698_464700_57_812 251
20 3300042614 Ga0466712_006249 Ga0466712_006249_384_1139 251
21 3300002449 JGI24698J34947_10012765 JGI24698J34947_100127653 252
22 3300042594 Ga0466694_138110 Ga0466694_138110_9247_10005 252
23 3300042606 Ga0466719_022138 Ga0466719_022138_884_1642 252
24 3300042606 Ga0466719_109212 Ga0466719_109212_10609_11367 252
25 3300042616 Ga0466715_024097 Ga0466715_024097_824_1582 252
26 3300042616 Ga0466715_075201 Ga0466715_075201_2539_3297 252
27 3300042616 Ga0466715_507184 Ga0466715_507184_1696_2454 252
28 3300042617 Ga0466718_140986 Ga0466718_140986_1707_2465 252
29 3300042609 Ga0466722_184590 Ga0466722_184590_6215_6976 253
30 3300042609 Ga0466722_192394 Ga0466722_192394_7120_7881 253
31 3300042612 Ga0466705_416874 Ga0466705_416874_4085_4846 253
32 3300042614 Ga0466712_009601 Ga0466712_009601_728_1489 253
33 3300042619 Ga0466726_413655 Ga0466726_413655_1821_2582 253
34 3300042620 Ga0466728_137381 Ga0466728_137381_1104_1865 253
35 3300042643 Ga0466704_349868 Ga0466704_349868_380_1174 253
36 3300002449 JGI24698J34947_10000834 JGI24698J34947_100008343 254
37 3300005201 Ga0072941_1017540 Ga0072941_101754013 254
38 3300042593 Ga0466691_041541 Ga0466691_041541_3908_4672 254
39 3300042594 Ga0466694_031806 Ga0466694_031806_1064_1828 254
40 3300042594 Ga0466694_309042 Ga0466694_309042_355_1119 254
41 3300042601 Ga0466707_217416 Ga0466707_217416_788_1552 254
42 3300042607 Ga0466720_152124 Ga0466720_152124_4637_5401 254
43 3300042609 Ga0466722_069109 Ga0466722_069109_11352_12116 254
44 3300042609 Ga0466722_151770 Ga0466722_151770_286_1050 254
45 3300042610 Ga0466698_363132 Ga0466698_363132_425_1189 254
46 3300042617 Ga0466718_055852 Ga0466718_055852_688_1452 254
47 3300042648 Ga0466709_092933 Ga0466709_092933_15359_16123 254
48 3300042656 Ga0466732_100504 Ga0466732_100504_2181_2945 254
49 iso_pr_bacteria 2781125651 2781310109 254
50 iso_pr_bacteria 2781125687 2781421083 254
51 3300002450 JGI24695J34938_10007561 JGI24695J34938_100075615 255
52 3300005200 Ga0072940_1030942 Ga0072940_10309422 255
53 3300010049 Ga0123356_10048380 Ga0123356_100483802 255
54 3300010882 Ga0123354_10089333 Ga0123354_100893333 255
55 3300042594 Ga0466694_171902 Ga0466694_171902_375_1142 255
56 3300042597 Ga0466699_191850 Ga0466699_191850_2322_3089 255
57 3300042609 Ga0466722_062791 Ga0466722_062791_579_1346 255
58 3300042609 Ga0466722_097367 Ga0466722_097367_6893_7660 255
59 3300042616 Ga0466715_405755 Ga0466715_405755_7787_8554 255
60 3300042619 Ga0466726_257145 Ga0466726_257145_77_844 255
61 3300042619 Ga0466726_259954 Ga0466726_259954_2174_2941 255
62 3300042636 Ga0466703_205965 Ga0466703_205965_7298_8065 255
63 3300042652 Ga0466708_274857 Ga0466708_274857_15290_16057 255
64 iso_pr_bacteria 2781125696 2781441200 255
65 3300002449 JGI24698J34947_10057157 JGI24698J34947_100571572 256
66 3300002462 JGI24702J35022_10014065 JGI24702J35022_100140652 256
67 3300010049 Ga0123356_10111178 Ga0123356_101111782 256
68 3300024493 Ga0264413_123292 Ga0264413_1232922 256
69 3300042591 Ga0466692_191856 Ga0466692_191856_1419_2189 256
70 3300042601 Ga0466707_387157 Ga0466707_387157_278_1048 256
71 3300042603 Ga0466714_013378 Ga0466714_013378_492_1262 256
72 3300042605 Ga0466716_320733 Ga0466716_320733_111_881 256
73 3300042607 Ga0466720_042141 Ga0466720_042141_1097_1867 256
74 3300042617 Ga0466718_141990 Ga0466718_141990_775_1545 256
75 3300042619 Ga0466726_199249 Ga0466726_199249_337_1107 256
76 3300042643 Ga0466704_465243 Ga0466704_465243_432_1202 256
77 3300042656 Ga0466732_057307 Ga0466732_057307_1665_2435 256
78 iso_pr_bacteria 2781125631 2781268651 256
79 iso_pr_bacteria 2781125686 2781418422 256
80 3300002449 JGI24698J34947_10161508 JGI24698J34947_101615081 257
81 3300010049 Ga0123356_10194841 Ga0123356_101948413 257
82 3300010049 Ga0123356_10494804 Ga0123356_104948042 257
83 3300042590 Ga0466690_271758 Ga0466690_271758_151_924 257
84 3300042593 Ga0466691_222280 Ga0466691_222280_578_1351 257
85 3300042596 Ga0466696_187005 Ga0466696_187005_787_1560 257
86 3300042597 Ga0466699_142849 Ga0466699_142849_1216_1989 257
87 3300042601 Ga0466707_070634 Ga0466707_070634_220_993 257
88 3300042612 Ga0466705_201057 Ga0466705_201057_4837_5610 257
89 3300042612 Ga0466705_215773 Ga0466705_215773_219_992 257
90 3300042612 Ga0466705_247636 Ga0466705_247636_239_1012 257
91 3300042618 Ga0466723_128858 Ga0466723_128858_1873_2646 257
92 3300042619 Ga0466726_298654 Ga0466726_298654_11914_12687 257
93 3300042620 Ga0466728_033589 Ga0466728_033589_517_1290 257
94 3300042620 Ga0466728_092724 Ga0466728_092724_826_1599 257
95 3300042624 Ga0466735_135841 Ga0466735_135841_16_789 257
96 3300042636 Ga0466703_025503 Ga0466703_025503_508_1281 257
97 3300042643 Ga0466704_285532 Ga0466704_285532_248_1021 257
98 3300042596 Ga0466696_022567 Ga0466696_022567_13029_13805 258
99 3300042601 Ga0466707_268979 Ga0466707_268979_486_1262 258
100 3300042601 Ga0466707_369813 Ga0466707_369813_108_884 258
101 3300042606 Ga0466719_061304 Ga0466719_061304_3541_4317 258
102 3300042616 Ga0466715_362164 Ga0466715_362164_827_1603 258
103 3300042636 Ga0466703_041606 Ga0466703_041606_6064_6840 258
104 3300042648 Ga0466709_129731 Ga0466709_129731_774_1550 258
105 3300042652 Ga0466708_092643 Ga0466708_092643_336_1112 258
106 3300042652 Ga0466708_198988 Ga0466708_198988_648_1424 258
107 3300042591 Ga0466692_007756 Ga0466692_007756_695_1474 259
108 3300042591 Ga0466692_088750 Ga0466692_088750_1703_2482 259
109 3300042597 Ga0466699_169003 Ga0466699_169003_992_1771 259
110 3300042612 Ga0466705_281638 Ga0466705_281638_1599_2378 259
111 3300042615 Ga0466711_226610 Ga0466711_226610_2016_2795 259
112 3300042621 Ga0466729_174789 Ga0466729_174789_2292_3071 259
113 3300042643 Ga0466704_547127 Ga0466704_547127_1597_2376 259
114 3300042615 Ga0466711_188545 Ga0466711_188545_1459_2241 260
115 3300042601 Ga0466707_026242 Ga0466707_026242_670_1455 261
116 3300042612 Ga0466705_224922 Ga0466705_224922_10968_11753 261
117 3300042615 Ga0466711_317196 Ga0466711_317196_12572_13357 261
118 3300042652 Ga0466708_448868 Ga0466708_448868_297_1130 261
119 3300042616 Ga0466715_214202 Ga0466715_214202_1429_2220 263
120 3300042648 Ga0466709_166368 Ga0466709_166368_4597_5388 263
121 3300010167 Ga0123353_10626390 Ga0123353_106263902 264
122 3300042603 Ga0466714_158976 Ga0466714_158976_311_1105 264
123 3300042593 Ga0466691_006161 Ga0466691_006161_4794_5594 266
124 3300042618 Ga0466723_201025 Ga0466723_201025_164_964 266
125 3300042636 Ga0466703_104120 Ga0466703_104120_3563_4369 268
126 3300042624 Ga0466735_052902 Ga0466735_052902_883_1806 307

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3 87 305 0.97
PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site 101 178 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.