Protein Family IF08745

Metagenome Isolate
273 Members
98 Samples
237 Scaffolds
323.79 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_045784|Ga0466735_045784_807_1910
Length
367 aa
Sequence
MINPVPAIAQLGETKNYTVSLCLPRSGGTSVVISKIVNKNQMKTFNEISQIIETELAAINWHREPYGLYAPVEYVLSLGGKRIRPALVLMGCNLFTDNVLPALKPAVGVEIFHNFTLLHDDIMDKAPVRRGKPTVHLKWNENAAILSGDLMQIEAYKYIAAAPQNVLKQVIDAFSQTAAEVCEGQQMDMDFEKRDSITEVEYLEMIRLKTAVLLGGALKIGAFVGNSEFDDIEQLEKFGTNIGMAFQLKDDLLDVYGDEQTFGKQIGGDILCNKKTLLLIYALELAKNADAEKLTELLNNHKDKFSPSEKISAVTDIYNKLKIRALCEEKMNFYFEQALKNLEEVKVENVKKTELLSLAKKLMCRID

πŸ“Š Sample Types

Isolate 13.2%
Metagenome 86.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 28.3%
Blattidae 21.7%
Kalotermitidae 15.2%
Unclassified 12.0%
Termopsidae 4.3%
Rhinotermitidae 4.3%
Drosophilidae 3.3%
Passalidae 3.3%
Elmidae 1.1%
Formicidae 1.1%
Armadillidiidae 1.1%
Hodotermitidae 1.1%
Bombycidae 1.1%
Culicidae 1.1%
Apidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 261
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
2 2898741527 Sphingobacterium sp. xlx-73 Isolate
3 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
4 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
5 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
6 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2896321640 Sphingobacterium sp. xlx-130 Isolate
18 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
26 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
27 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
28 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
29 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
30 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 2864836148 Arcicella rosea S00070 Isolate Elmidae
38 2896330536 Sphingobacterium sp. xlx-96 Isolate
39 2920168565 Paludibacter sp. 221 Isolate Blattidae
40 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
41 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
42 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
43 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
44 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
45 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
46 2896350215 Sphingobacterium sp. xlx-183 Isolate
47 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
48 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
49 3004667792 Bacteroides sp. 519 Isolate Blattidae
50 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
51 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
54 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
55 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
56 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
57 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
58 2923982719 Parabacteroides sp. 52 Isolate Blattidae
59 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
60 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
61 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
62 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
63 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
64 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
65 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
66 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
67 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
68 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
69 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
70 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
71 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
72 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
73 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
74 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
75 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
76 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
77 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
78 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
79 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
80 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
81 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
82 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
83 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
84 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
85 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
86 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
87 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
88 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
89 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
90 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
91 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
92 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
93 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
94 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
95 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
96 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
97 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
98 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_005554 3300042659 Bacteria 5236
2 Ga0466733_186177 3300042659 Bacteria 18387
3 Ga0466733_217934 3300042659 Bacteria 2835
4 Ga0466711_333670 3300042615 Bacteria 2397
5 Ga0466711_517535 3300042615 Bacteria 2401
6 Ga0466715_507556 3300042616 Bacteria 8325
7 Ga0466726_005153 3300042619 Bacteria 16947
8 Ga0466726_341381 3300042619 Bacteria 1791
9 Ga0466728_129505 3300042620 Bacteria 6012
10 Ga0466728_244893 3300042620 Bacteria 24303
11 Ga0123353_10000067 3300010167 Bacteria 114305
12 IMNBL1DRAFT_c0003807 3300000062 Bacteria 9410
13 Ga0068305_10005585 3300005083 Bacteria 21211
14 Ga0068305_10017836 3300005083 Bacteria 19003
15 Ga0068305_10624827 3300005083 Bacteria 2981
16 Ga0103267_1000692 3300007190 Bacteria 9247
17 Ga0466690_402356 3300042590 Bacteria 64397
18 Ga0466692_015079 3300042591 Bacteria 1732
19 Ga0466691_045847 3300042593 Bacteria 49393
20 Ga0466706_126637 3300042599 Bacteria 4190
21 Ga0466706_165313 3300042599 Bacteria 60368
22 Ga0466707_198027 3300042601 Bacteria 2976
23 Ga0466716_041136 3300042605 Bacteria 2794
24 Ga0466716_209321 3300042605 Bacteria 10671
25 Ga0466719_068358 3300042606 Bacteria 7078
26 Ga0466719_496268 3300042606 Bacteria 6314
27 Ga0466735_204754 3300042624 Bacteria 1350
28 Ga0466704_393392 3300042643 Bacteria 8481
29 Ga0466724_20547 3300042649 Unclassified 7700
30 Ga0466708_172242 3300042652 Bacteria 10802
31 Ga0466705_027581 3300042612 Bacteria 2971
32 Ga0466733_078798 3300042659 Bacteria 2423
33 Ga0466710_240403 3300042613 Bacteria 2091
34 Ga0466711_147124 3300042615 Bacteria 8613
35 Ga0466711_265420 3300042615 Bacteria 8423
36 Ga0466711_398384 3300042615 Bacteria 15110
37 Ga0466711_517683 3300042615 Bacteria 6340
38 Ga0466715_341409 3300042616 Bacteria 7051
39 Ga0466723_200901 3300042618 Bacteria 13167
40 Ga0466729_065684 3300042621 Bacteria 3451
41 Ga0123356_10023826 3300010049 Bacteria 5760
42 Ga0160466_100046 3300012809 Bacteria 160488
43 2227205792 2225789004 Bacteria 7707
44 JGI24702J35022_10000138 3300002462 Bacteria 36376
45 JGI24705J35276_12237129 3300002504 Unclassified 9922
46 Ga0068305_10002622 3300005083 Bacteria 23954
47 Ga0068305_10019732 3300005083 Bacteria 5522
48 Ga0466656_337745 3300042550 Bacteria 2322
49 Ga0466692_088175 3300042591 Archaea 4314
50 Ga0466696_030834 3300042596 Bacteria 11783
51 Ga0466714_030140 3300042603 Bacteria 39149
52 Ga0466716_471309 3300042605 Bacteria 4850
53 Ga0466734_108484 3300042623 Bacteria 3746
54 Ga0466703_254148 3300042636 Bacteria 23220
55 Ga0466704_080074 3300042643 Bacteria 18633
56 Ga0466704_325172 3300042643 Bacteria 7320
57 Ga0466704_334934 3300042643 Bacteria 2284
58 Ga0466709_101953 3300042648 Bacteria 13846
59 Ga0466709_297313 3300042648 Bacteria 3466
60 Ga0466724_14560 3300042649 Bacteria 6718
61 Ga0466708_076108 3300042652 Bacteria 112124
62 Ga0466705_042664 3300042612 Bacteria 9928
63 Ga0466705_280937 3300042612 Bacteria 8395
64 Ga0466711_373737 3300042615 Bacteria 78112
65 Ga0466711_395801 3300042615 Bacteria 1676
66 Ga0466715_106265 3300042616 Bacteria 12571
67 Ga0466715_292125 3300042616 Bacteria 7456
68 Ga0466723_016908 3300042618 Bacteria 23913
69 Ga0466723_354948 3300042618 Bacteria 23912
70 Ga0123357_10176686 3300009784 Bacteria 2508
71 Ga0123353_10217419 3300010167 Bacteria 2992
72 Ga0123353_10277995 3300010167 Bacteria 2574
73 Ga0123353_10928458 3300010167 Unclassified 1181
74 2227330804 2225789004 Unclassified 6326
75 2227536338 2225789004 Bacteria 3062
76 Ga0068305_10130866 3300005083 Unclassified 8094
77 Ga0104045_1082483 3300007085 Bacteria 1052
78 Ga0104019_1002925 3300007150 Bacteria 5230
79 Ga0103267_1000516 3300007190 Bacteria 11714
80 Ga0415639_017097 3300038395 Bacteria 1497
81 Ga0466656_169295 3300042550 Bacteria 1645
82 Ga0466690_305294 3300042590 Bacteria 13677
83 Ga0466694_214993 3300042594 Bacteria 1606
84 Ga0466695_290486 3300042595 Bacteria 5398
85 Ga0466696_229205 3300042596 Bacteria 18722
86 Ga0466713_137499 3300042602 Bacteria 46639
87 Ga0466735_081009 3300042624 Bacteria 11986
88 Ga0466730_054806 3300042625 Bacteria 801523
89 Ga0466703_001595 3300042636 Bacteria 18307
90 Ga0466704_247905 3300042643 Bacteria 30308
91 Ga0466704_533188 3300042643 Bacteria 20326
92 Ga0466727_179059 3300042655 Bacteria 12208
93 Ga0466727_198937 3300042655 Bacteria 6813
94 Ga0466732_258064 3300042656 Bacteria 2846
95 Ga0123355_10000217 3300009826 Bacteria 72204
96 IMNBL1DRAFT_c0000935 3300000062 Bacteria 22566
97 JGI24702J35022_10000916 3300002462 Bacteria 18359
98 JGI24702J35022_10004055 3300002462 Bacteria 8770
99 JGI24702J35022_10007653 3300002462 Bacteria 6174
100 JGI24702J35022_10108932 3300002462 Bacteria 1522
101 JGI24696J40584_12957290 3300002834 Bacteria 3442
102 Ga0466656_039996 3300042550 Bacteria 11141
103 Ga0466656_122777 3300042550 Bacteria 11394
104 Ga0466657_073923 3300042582 Bacteria 2571
105 Ga0466690_019839 3300042590 Bacteria 17453
106 Ga0466700_038513 3300042600 Bacteria 4276
107 Ga0466713_047540 3300042602 Bacteria 17647
108 Ga0466713_066524 3300042602 Bacteria 14976
109 Ga0466714_127121 3300042603 Bacteria 69480
110 Ga0466719_306511 3300042606 Bacteria 3848
111 Ga0466704_086945 3300042643 Bacteria 1387
112 Ga0466725_089078 3300042654 Bacteria 11624
113 Ga0466725_167604 3300042654 Bacteria 14927
114 Ga0466705_077990 3300042612 Bacteria 24079
115 Ga0466710_082395 3300042613 Bacteria 9632
116 Ga0466711_285989 3300042615 Bacteria 7430
117 Ga0466715_173384 3300042616 Bacteria 14345
118 Ga0466715_204293 3300042616 Bacteria 67582
119 Ga0466728_440090 3300042620 Bacteria 2873
120 Ga0123353_10202185 3300010167 Bacteria 3124
121 Ga0123353_10485465 3300010167 Bacteria 1806
122 JGI24702J35022_10114788 3300002462 Bacteria 1483
123 JGI24705J35276_12236165 3300002504 Bacteria 7586
124 Ga0123357_10000239 3300009784 Bacteria 52222
125 Ga0160467_100441 3300012829 Bacteria 41404
126 Ga0466657_005592 3300042582 Bacteria 12517
127 Ga0466706_022783 3300042599 Bacteria 4271
128 Ga0466707_379726 3300042601 Bacteria 3108
129 Ga0466719_296592 3300042606 Bacteria 8836
130 Ga0466722_057340 3300042609 Bacteria 10007
131 Ga0466722_180609 3300042609 Bacteria 4462
132 Ga0466734_103983 3300042623 Bacteria 1821
133 Ga0466703_048823 3300042636 Bacteria 16130
134 Ga0466703_237479 3300042636 Bacteria 23006
135 Ga0466704_485863 3300042643 Bacteria 9424
136 Ga0466724_24755 3300042649 Bacteria 72335
137 Ga0466708_372311 3300042652 Bacteria 12035
138 Ga0466727_040337 3300042655 Bacteria 31698
139 Ga0466733_002151 3300042659 Bacteria 71476
140 Ga0466733_010056 3300042659 Bacteria 20477
141 Ga0466715_350734 3300042616 Bacteria 3205
142 Ga0466715_376227 3300042616 Bacteria 52075
143 Ga0466715_496574 3300042616 Bacteria 33816
144 Ga0466715_591652 3300042616 Bacteria 5296
145 Ga0466726_441539 3300042619 Bacteria 2873
146 Ga0466728_082650 3300042620 Bacteria 29100
147 Ga0466729_175636 3300042621 Bacteria 14158
148 Ga0123355_10500493 3300009826 Bacteria 1499
149 Ga0123356_10233289 3300010049 Bacteria 1906
150 Ga0123354_10001081 3300010882 Bacteria 31466
151 2227035903 2225789003 Bacteria 22328
152 2227087775 2225789004 Bacteria 1848
153 JGI24702J35022_10004904 3300002462 Bacteria 7888
154 Ga0104050_1002980 3300007153 Bacteria 8380
155 Ga0466690_389175 3300042590 Bacteria 15062
156 Ga0466691_016788 3300042593 Bacteria 2359
157 Ga0466691_085284 3300042593 Bacteria 13430
158 Ga0466694_124331 3300042594 Bacteria 1346
159 Ga0466696_014642 3300042596 Bacteria 5725
160 Ga0466696_474988 3300042596 Bacteria 2029
161 Ga0466713_037887 3300042602 Bacteria 30344
162 Ga0466713_043076 3300042602 Bacteria 16335
163 Ga0466716_264353 3300042605 Bacteria 37115
164 Ga0466697_039823 3300042611 Unclassified 1263
165 Ga0466731_343280 3300042622 Bacteria 1801
166 Ga0466703_209026 3300042636 Bacteria 32874
167 Ga0466704_553498 3300042643 Bacteria 9951
168 Ga0466708_010169 3300042652 Bacteria 14357
169 Ga0466727_139768 3300042655 Bacteria 4090
170 Ga0466705_079919 3300042612 Unclassified 2558
171 Ga0466733_048728 3300042659 Bacteria 24602
172 Ga0466733_049047 3300042659 Bacteria 7269
173 Ga0466733_131111 3300042659 Bacteria 2118
174 Ga0466711_151335 3300042615 Bacteria 6386
175 Ga0466715_270348 3300042616 Unclassified 1898
176 Ga0466723_030264 3300042618 Bacteria 6780
177 Ga0466723_093881 3300042618 Bacteria 35007
178 Ga0466729_086294 3300042621 Bacteria 7760
179 Ga0068302_10096935 3300005071 Bacteria 2357
180 Ga0068302_10259973 3300005071 Unclassified 2035
181 Ga0068305_10029560 3300005083 Bacteria 6769
182 Ga0103267_1000220 3300007190 Bacteria 22231
183 Ga0160436_1006175 3300012861 Bacteria 2791
184 Ga0466690_425264 3300042590 Bacteria 16300
185 Ga0466691_202614 3300042593 Bacteria 19692
186 Ga0466696_485651 3300042596 Bacteria 2233
187 Ga0466701_005018 3300042598 Bacteria 22866
188 Ga0466706_054670 3300042599 Bacteria 52813
189 Ga0466706_094705 3300042599 Bacteria 26280
190 Ga0466706_095663 3300042599 Bacteria 79833
191 Ga0466706_222726 3300042599 Bacteria 13277
192 Ga0466713_051835 3300042602 Bacteria 22498
193 Ga0466719_141427 3300042606 Bacteria 2527
194 Ga0466735_033779 3300042624 Bacteria 1755
195 Ga0466735_045784 3300042624 Bacteria 2085
196 Ga0466704_003070 3300042643 Bacteria 12245
197 Ga0466709_346172 3300042648 Bacteria 19067
198 Ga0466708_450992 3300042652 Bacteria 19920
199 Ga0466705_019476 3300042612 Bacteria 24974
200 Ga0466710_275720 3300042613 Bacteria 8260
201 Ga0466711_053834 3300042615 Bacteria 10425
202 Ga0466711_154251 3300042615 Bacteria 6424
203 Ga0466723_163253 3300042618 Unclassified 7610
204 Ga0466726_140521 3300042619 Bacteria 4869
205 Ga0123355_10000161 3300009826 Bacteria 81946
206 Ga0123353_10000120 3300010167 Bacteria 93172
207 2227596036 2225789004 Bacteria 2379
208 IMNBL1DRAFT_c0029107 3300000062 Unclassified 2049
209 Ga0072940_1206393 3300005200 Bacteria 2226
210 Ga0072941_1563818 3300005201 Bacteria 1572
211 Ga0466690_039968 3300042590 Bacteria 9494
212 Ga0466690_165311 3300042590 Bacteria 2432
213 Ga0466690_165346 3300042590 Bacteria 12704
214 Ga0466690_310023 3300042590 Bacteria 1051
215 Ga0466691_006630 3300042593 Bacteria 10750
216 Ga0466691_127886 3300042593 Bacteria 16442
217 Ga0466696_061891 3300042596 Bacteria 14268
218 Ga0466696_215903 3300042596 Bacteria 16708
219 Ga0466701_075975 3300042598 Bacteria 4602
220 Ga0466706_113167 3300042599 Bacteria 48207
221 Ga0466706_113743 3300042599 Bacteria 22186
222 Ga0466706_225634 3300042599 Bacteria 10986
223 Ga0466707_146944 3300042601 Bacteria 2483
224 Ga0466707_379163 3300042601 Bacteria 4317
225 Ga0466713_068335 3300042602 Bacteria 13426
226 Ga0466716_484837 3300042605 Bacteria 30730
227 Ga0466719_119717 3300042606 Bacteria 17932
228 Ga0466719_191287 3300042606 Bacteria 3003
229 Ga0466719_569291 3300042606 Bacteria 10269
230 Ga0466703_013553 3300042636 Bacteria 20328
231 Ga0466703_019525 3300042636 Bacteria 29012
232 Ga0466703_098615 3300042636 Bacteria 2714
233 Ga0466703_202519 3300042636 Bacteria 22773
234 Ga0466703_356965 3300042636 Bacteria 5558
235 Ga0466724_47341 3300042649 Bacteria 42552
236 Ga0466708_066300 3300042652 Bacteria 36627
237 Ga0466708_299188 3300042652 Bacteria 34210

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007190 Ga0103267_1000692 Ga0103267_10006924 270
2 3300042596 Ga0466696_014642 Ga0466696_014642_400_1233 277
3 3300042618 Ga0466723_093881 Ga0466723_093881_23678_24511 277
4 3300010167 Ga0123353_10000120 Ga0123353_1000012034 289
5 3300010882 Ga0123354_10001081 Ga0123354_100010818 289
6 3300007153 Ga0104050_1002980 Ga0104050_10029806 290
7 3300042550 Ga0466656_337745 Ga0466656_337745_1381_2253 290
8 3300042613 Ga0466710_275720 Ga0466710_275720_7378_8250 290
9 3300042602 Ga0466713_043076 Ga0466713_043076_7157_8035 292
10 3300042590 Ga0466690_425264 Ga0466690_425264_7978_8955 294
11 3300042620 Ga0466728_129505 Ga0466728_129505_998_1975 296
12 3300042643 Ga0466704_533188 Ga0466704_533188_13557_14534 298
13 3300042582 Ga0466657_073923 Ga0466657_073923_1162_2127 302
14 3300042619 Ga0466726_005153 Ga0466726_005153_1496_2407 303
15 3300042590 Ga0466690_310023 Ga0466690_310023_114_1028 304
16 3300042618 Ga0466723_200901 Ga0466723_200901_7035_8009 304
17 3300042652 Ga0466708_450992 Ga0466708_450992_16369_17346 305
18 3300010167 Ga0123353_10202185 Ga0123353_102021853 308
19 3300042590 Ga0466690_165346 Ga0466690_165346_390_1364 309
20 2225789004 2227087775 2227465333 311
21 2225789004 2227536338 2228054352 311
22 3300005083 Ga0068305_10029560 Ga0068305_100295608 311
23 3300042636 Ga0466703_254148 Ga0466703_254148_12340_13314 312
24 3300042593 Ga0466691_085284 Ga0466691_085284_9753_10736 314
25 3300042601 Ga0466707_198027 Ga0466707_198027_241_1212 314
26 3300010049 Ga0123356_10023826 Ga0123356_100238263 316
27 3300042609 Ga0466722_180609 Ga0466722_180609_2458_3411 317
28 3300042636 Ga0466703_356965 Ga0466703_356965_927_1880 317
29 3300042659 Ga0466733_186177 Ga0466733_186177_7410_8369 319
30 3300007085 Ga0104045_1082483 Ga0104045_10824831 321
31 3300010167 Ga0123353_10217419 Ga0123353_102174193 321
32 3300042582 Ga0466657_005592 Ga0466657_005592_1426_2391 321
33 3300042591 Ga0466692_015079 Ga0466692_015079_636_1601 321
34 3300042591 Ga0466692_088175 Ga0466692_088175_177_1142 321
35 3300042613 Ga0466710_082395 Ga0466710_082395_7499_8464 321
36 3300042618 Ga0466723_163253 Ga0466723_163253_1197_2162 321
37 3300042619 Ga0466726_341381 Ga0466726_341381_681_1646 321
38 3300042621 Ga0466729_086294 Ga0466729_086294_1935_2900 321
39 3300042622 Ga0466731_343280 Ga0466731_343280_817_1782 321
40 3300042623 Ga0466734_103983 Ga0466734_103983_320_1285 321
41 3300042652 Ga0466708_172242 Ga0466708_172242_227_1192 321
42 3300007190 Ga0103267_1000516 Ga0103267_10005167 322
43 3300012861 Ga0160436_1006175 Ga0160436_10061753 322
44 3300042598 Ga0466701_005018 Ga0466701_005018_17107_18075 322
45 3300042599 Ga0466706_113743 Ga0466706_113743_17732_18700 322
46 3300042611 Ga0466697_039823 Ga0466697_039823_200_1168 322
47 3300042613 Ga0466710_240403 Ga0466710_240403_1101_2069 322
48 3300042624 Ga0466735_081009 Ga0466735_081009_4429_5397 322
49 3300042625 Ga0466730_054806 Ga0466730_054806_682712_683680 322
50 3300042649 Ga0466724_14560 Ga0466724_14560_3415_4383 322
51 3300042649 Ga0466724_20547 Ga0466724_20547_3439_4407 322
52 3300042649 Ga0466724_24755 Ga0466724_24755_49557_50525 322
53 iso_pr_bacteria 2820785563 2820786125 322
54 iso_pr_bacteria 2820788205 2820788629 322
55 3300007190 Ga0103267_1000220 Ga0103267_10002204 323
56 3300009826 Ga0123355_10000161 Ga0123355_1000016110 323
57 3300009826 Ga0123355_10000217 Ga0123355_1000021753 323
58 3300009826 Ga0123355_10500493 Ga0123355_105004932 323
59 3300012809 Ga0160466_100046 Ga0160466_10004688 323
60 3300012829 Ga0160467_100441 Ga0160467_10044133 323
61 3300038395 Ga0415639_017097 Ga0415639_017097_29_1000 323
62 3300042550 Ga0466656_169295 Ga0466656_169295_215_1186 323
63 3300042595 Ga0466695_290486 Ga0466695_290486_2419_3390 323
64 3300042598 Ga0466701_075975 Ga0466701_075975_761_1732 323
65 3300042599 Ga0466706_113167 Ga0466706_113167_20629_21600 323
66 3300042602 Ga0466713_068335 Ga0466713_068335_11151_12122 323
67 3300042603 Ga0466714_030140 Ga0466714_030140_16554_17525 323
68 3300042623 Ga0466734_108484 Ga0466734_108484_764_1735 323
69 iso_pr_bacteria 2820737921 2820739467 323
70 iso_pr_bacteria 2820746860 2820746953 323
71 iso_pr_bacteria 2820770630 2820771007 323
72 iso_pr_bacteria 2864836148 2864840230 323
73 iso_pr_bacteria 2920168565 2920168632 323
74 iso_pr_bacteria 3004667792 3004667966 323
75 2225789004 2227205792 2227632921 324
76 3300009784 Ga0123357_10176686 Ga0123357_101766863 324
77 3300010167 Ga0123353_10000067 Ga0123353_100000676 324
78 3300010167 Ga0123353_10928458 Ga0123353_109284581 324
79 3300042550 Ga0466656_039996 Ga0466656_039996_8543_9517 324
80 3300042590 Ga0466690_305294 Ga0466690_305294_1840_2814 324
81 3300042590 Ga0466690_402356 Ga0466690_402356_53354_54328 324
82 3300042593 Ga0466691_016788 Ga0466691_016788_431_1405 324
83 3300042594 Ga0466694_124331 Ga0466694_124331_261_1235 324
84 3300042596 Ga0466696_215903 Ga0466696_215903_3583_4557 324
85 3300042596 Ga0466696_474988 Ga0466696_474988_212_1186 324
86 3300042596 Ga0466696_485651 Ga0466696_485651_924_1898 324
87 3300042599 Ga0466706_054670 Ga0466706_054670_42470_43444 324
88 3300042599 Ga0466706_094705 Ga0466706_094705_23246_24220 324
89 3300042599 Ga0466706_095663 Ga0466706_095663_42778_43752 324
90 3300042599 Ga0466706_126637 Ga0466706_126637_1879_2853 324
91 3300042599 Ga0466706_222726 Ga0466706_222726_1797_2771 324
92 3300042599 Ga0466706_225634 Ga0466706_225634_8216_9190 324
93 3300042603 Ga0466714_127121 Ga0466714_127121_63105_64079 324
94 3300042605 Ga0466716_484837 Ga0466716_484837_16224_17198 324
95 3300042606 Ga0466719_141427 Ga0466719_141427_1308_2282 324
96 3300042612 Ga0466705_027581 Ga0466705_027581_1151_2125 324
97 3300042612 Ga0466705_077990 Ga0466705_077990_11062_12036 324
98 3300042612 Ga0466705_079919 Ga0466705_079919_735_1709 324
99 3300042615 Ga0466711_053834 Ga0466711_053834_8339_9313 324
100 3300042615 Ga0466711_151335 Ga0466711_151335_2826_3800 324
101 3300042615 Ga0466711_154251 Ga0466711_154251_1761_2735 324
102 3300042615 Ga0466711_265420 Ga0466711_265420_3769_4743 324
103 3300042615 Ga0466711_333670 Ga0466711_333670_603_1577 324
104 3300042615 Ga0466711_398384 Ga0466711_398384_6760_7734 324
105 3300042615 Ga0466711_517535 Ga0466711_517535_605_1579 324
106 3300042616 Ga0466715_106265 Ga0466715_106265_4922_5896 324
107 3300042616 Ga0466715_292125 Ga0466715_292125_5261_6235 324
108 3300042616 Ga0466715_350734 Ga0466715_350734_2197_3171 324
109 3300042616 Ga0466715_376227 Ga0466715_376227_44183_45157 324
110 3300042616 Ga0466715_496574 Ga0466715_496574_24210_25184 324
111 3300042616 Ga0466715_591652 Ga0466715_591652_2168_3142 324
112 3300042618 Ga0466723_354948 Ga0466723_354948_5113_6087 324
113 3300042620 Ga0466728_082650 Ga0466728_082650_12900_13874 324
114 3300042620 Ga0466728_440090 Ga0466728_440090_1362_2336 324
115 3300042621 Ga0466729_065684 Ga0466729_065684_1362_2336 324
116 3300042621 Ga0466729_175636 Ga0466729_175636_11183_12157 324
117 3300042624 Ga0466735_033779 Ga0466735_033779_174_1148 324
118 3300042624 Ga0466735_204754 Ga0466735_204754_295_1269 324
119 3300042636 Ga0466703_001595 Ga0466703_001595_4614_5588 324
120 3300042636 Ga0466703_048823 Ga0466703_048823_1998_2972 324
121 3300042636 Ga0466703_202519 Ga0466703_202519_4409_5383 324
122 3300042636 Ga0466703_237479 Ga0466703_237479_9325_10299 324
123 3300042643 Ga0466704_003070 Ga0466704_003070_8154_9128 324
124 3300042643 Ga0466704_080074 Ga0466704_080074_2584_3558 324
125 3300042643 Ga0466704_086945 Ga0466704_086945_49_1023 324
126 3300042643 Ga0466704_325172 Ga0466704_325172_1313_2287 324
127 3300042643 Ga0466704_334934 Ga0466704_334934_49_1023 324
128 3300042643 Ga0466704_485863 Ga0466704_485863_6632_7606 324
129 3300042643 Ga0466704_553498 Ga0466704_553498_7659_8633 324
130 3300042648 Ga0466709_297313 Ga0466709_297313_1158_2132 324
131 3300042652 Ga0466708_076108 Ga0466708_076108_60939_61913 324
132 3300042652 Ga0466708_372311 Ga0466708_372311_1721_2695 324
133 3300042654 Ga0466725_167604 Ga0466725_167604_5338_6312 324
134 3300042659 Ga0466733_005554 Ga0466733_005554_1268_2242 324
135 3300042659 Ga0466733_078798 Ga0466733_078798_766_1740 324
136 3300042659 Ga0466733_131111 Ga0466733_131111_886_1860 324
137 3300042659 Ga0466733_217934 Ga0466733_217934_1225_2199 324
138 iso_pr_bacteria 2609459943 2610743129 324
139 iso_pr_bacteria 2820776227 2820776378 324
140 iso_pr_bacteria 2830041218 2830041341 324
141 iso_pr_bacteria 2923982719 2923982874 324
142 iso_pr_bacteria 2940195863 2940196487 324
143 iso_pr_bacteria 2940199050 2940202089 324
144 iso_pr_bacteria 2940202316 2940204312 324
145 iso_pr_bacteria 2940346213 2940348796 324
146 iso_pr_bacteria 2940371297 2940372921 324
147 2225789004 2227596036 2228158700 325
148 3300000062 IMNBL1DRAFT_c0000935 IMNBL1DRAFT_00009354 325
149 3300000062 IMNBL1DRAFT_c0003807 IMNBL1DRAFT_000380710 325
150 3300002462 JGI24702J35022_10000916 JGI24702J35022_1000091616 325
151 3300002462 JGI24702J35022_10108932 JGI24702J35022_101089322 325
152 3300002462 JGI24702J35022_10114788 JGI24702J35022_101147882 325
153 3300002504 JGI24705J35276_12236165 JGI24705J35276_122361657 325
154 3300002504 JGI24705J35276_12237129 JGI24705J35276_122371298 325
155 3300005071 Ga0068302_10096935 Ga0068302_100969352 325
156 3300005083 Ga0068305_10002622 Ga0068305_1000262216 325
157 3300005083 Ga0068305_10624827 Ga0068305_106248272 325
158 3300005200 Ga0072940_1206393 Ga0072940_12063932 325
159 3300009784 Ga0123357_10000239 Ga0123357_1000023919 325
160 3300010049 Ga0123356_10233289 Ga0123356_102332892 325
161 3300010167 Ga0123353_10485465 Ga0123353_104854652 325
162 3300042590 Ga0466690_039968 Ga0466690_039968_3984_4961 325
163 3300042590 Ga0466690_389175 Ga0466690_389175_8131_9108 325
164 3300042593 Ga0466691_006630 Ga0466691_006630_7671_8648 325
165 3300042593 Ga0466691_045847 Ga0466691_045847_5340_6317 325
166 3300042593 Ga0466691_127886 Ga0466691_127886_13812_14789 325
167 3300042594 Ga0466694_214993 Ga0466694_214993_422_1399 325
168 3300042596 Ga0466696_030834 Ga0466696_030834_9367_10344 325
169 3300042596 Ga0466696_061891 Ga0466696_061891_4226_5203 325
170 3300042596 Ga0466696_229205 Ga0466696_229205_15290_16267 325
171 3300042599 Ga0466706_022783 Ga0466706_022783_2820_3797 325
172 3300042599 Ga0466706_165313 Ga0466706_165313_14368_15345 325
173 3300042600 Ga0466700_038513 Ga0466700_038513_480_1457 325
174 3300042601 Ga0466707_146944 Ga0466707_146944_1367_2344 325
175 3300042601 Ga0466707_379163 Ga0466707_379163_2930_3907 325
176 3300042602 Ga0466713_037887 Ga0466713_037887_23728_24705 325
177 3300042602 Ga0466713_047540 Ga0466713_047540_9530_10507 325
178 3300042602 Ga0466713_137499 Ga0466713_137499_29741_30718 325
179 3300042605 Ga0466716_041136 Ga0466716_041136_1706_2683 325
180 3300042605 Ga0466716_471309 Ga0466716_471309_605_1582 325
181 3300042606 Ga0466719_068358 Ga0466719_068358_5898_6875 325
182 3300042606 Ga0466719_119717 Ga0466719_119717_4308_5285 325
183 3300042606 Ga0466719_496268 Ga0466719_496268_4229_5206 325
184 3300042606 Ga0466719_569291 Ga0466719_569291_7952_8929 325
185 3300042612 Ga0466705_019476 Ga0466705_019476_18716_19693 325
186 3300042615 Ga0466711_147124 Ga0466711_147124_1231_2208 325
187 3300042615 Ga0466711_517683 Ga0466711_517683_4815_5792 325
188 3300042616 Ga0466715_173384 Ga0466715_173384_7562_8539 325
189 3300042616 Ga0466715_270348 Ga0466715_270348_827_1804 325
190 3300042618 Ga0466723_030264 Ga0466723_030264_3420_4397 325
191 3300042619 Ga0466726_140521 Ga0466726_140521_1829_2806 325
192 3300042619 Ga0466726_441539 Ga0466726_441539_905_1882 325
193 3300042620 Ga0466728_244893 Ga0466728_244893_7690_8667 325
194 3300042636 Ga0466703_098615 Ga0466703_098615_1095_2072 325
195 3300042648 Ga0466709_101953 Ga0466709_101953_9118_10095 325
196 3300042652 Ga0466708_066300 Ga0466708_066300_25678_26655 325
197 3300042654 Ga0466725_089078 Ga0466725_089078_3973_4950 325
198 3300042655 Ga0466727_139768 Ga0466727_139768_1487_2464 325
199 3300042655 Ga0466727_179059 Ga0466727_179059_3958_4935 325
200 3300042655 Ga0466727_198937 Ga0466727_198937_4527_5504 325
201 3300042659 Ga0466733_048728 Ga0466733_048728_12319_13296 325
202 iso_pr_bacteria 2820751898 2820753494 325
203 iso_pr_bacteria 2896321640 2896323347 325
204 iso_pr_bacteria 2896330536 2896332256 325
205 iso_pr_bacteria 2896350215 2896352067 325
206 iso_pr_bacteria 2898741527 2898743598 325
207 3300002462 JGI24702J35022_10000138 JGI24702J35022_100001385 326
208 3300002462 JGI24702J35022_10004055 JGI24702J35022_100040557 326
209 3300002834 JGI24696J40584_12957290 JGI24696J40584_129572902 326
210 3300005071 Ga0068302_10259973 Ga0068302_102599732 326
211 3300005083 Ga0068305_10019732 Ga0068305_100197323 326
212 3300005201 Ga0072941_1563818 Ga0072941_15638182 326
213 3300007150 Ga0104019_1002925 Ga0104019_10029252 326
214 3300010167 Ga0123353_10277995 Ga0123353_102779953 326
215 3300042602 Ga0466713_051835 Ga0466713_051835_4072_5052 326
216 3300042606 Ga0466719_306511 Ga0466719_306511_223_1203 326
217 3300042615 Ga0466711_373737 Ga0466711_373737_27244_28224 326
218 3300042616 Ga0466715_204293 Ga0466715_204293_4737_5717 326
219 3300042618 Ga0466723_016908 Ga0466723_016908_19721_20701 326
220 3300042636 Ga0466703_013553 Ga0466703_013553_14279_15259 326
221 3300042636 Ga0466703_209026 Ga0466703_209026_11609_12589 326
222 3300042643 Ga0466704_247905 Ga0466704_247905_25657_26637 326
223 3300042656 Ga0466732_258064 Ga0466732_258064_929_1909 326
224 3300042659 Ga0466733_002151 Ga0466733_002151_29912_30892 326
225 3300042659 Ga0466733_010056 Ga0466733_010056_4374_5354 326
226 3300005083 Ga0068305_10005585 Ga0068305_1000558538 327
227 3300005083 Ga0068305_10130866 Ga0068305_1013086610 327
228 3300042602 Ga0466713_066524 Ga0466713_066524_447_1430 327
229 3300042609 Ga0466722_057340 Ga0466722_057340_6444_7427 327
230 3300042616 Ga0466715_341409 Ga0466715_341409_2935_3918 327
231 3300042643 Ga0466704_393392 Ga0466704_393392_3624_4607 327
232 3300042652 Ga0466708_010169 Ga0466708_010169_8278_9261 327
233 3300042655 Ga0466727_040337 Ga0466727_040337_3885_4868 327
234 3300042605 Ga0466716_209321 Ga0466716_209321_1287_2273 328
235 3300042648 Ga0466709_346172 Ga0466709_346172_14293_15309 328
236 3300042605 Ga0466716_264353 Ga0466716_264353_8059_9048 329
237 iso_pr_bacteria 8065497608 8065498802 329
238 3300042550 Ga0466656_122777 Ga0466656_122777_3588_4580 330
239 3300042615 Ga0466711_285989 Ga0466711_285989_1018_2010 330
240 3300042636 Ga0466703_019525 Ga0466703_019525_9155_10147 330
241 3300042649 Ga0466724_47341 Ga0466724_47341_8660_9652 330
242 iso_pr_bacteria 2579779088 2582236719 330
243 3300005083 Ga0068305_10017836 Ga0068305_1001783611 332
244 2225789003 2227035903 2227396078 334
245 2225789004 2227330804 2227778882 334
246 3300042590 Ga0466690_165311 Ga0466690_165311_275_1279 334
247 3300042593 Ga0466691_202614 Ga0466691_202614_9009_10013 334
248 3300042612 Ga0466705_042664 Ga0466705_042664_581_1588 335
249 3300042590 Ga0466690_019839 Ga0466690_019839_7856_8866 336
250 iso_pr_bacteria 2940205530 2940206052 336
251 iso_pr_bacteria 2940212447 2940212967 336
252 iso_pr_bacteria 2940298504 2940299024 336
253 iso_pr_bacteria 2940302308 2940302904 336
254 iso_pr_bacteria 2940306115 2940306313 336
255 iso_pr_bacteria 2940309933 2940310055 336
256 iso_pr_bacteria 2940313741 2940313864 336
257 iso_pr_bacteria 2940317558 2940317755 336
258 iso_pr_bacteria 2940321370 2940321493 336
259 iso_pr_bacteria 2940325180 2940325776 336
260 iso_pr_bacteria 2940328985 2940329582 336
261 iso_pr_bacteria 2940332795 2940332993 336
262 3300000062 IMNBL1DRAFT_c0029107 IMNBL1DRAFT_00291072 337
263 3300002462 JGI24702J35022_10004904 JGI24702J35022_100049048 337
264 3300042601 Ga0466707_379726 Ga0466707_379726_997_2010 337
265 3300042606 Ga0466719_296592 Ga0466719_296592_2994_4010 338
266 3300042615 Ga0466711_395801 Ga0466711_395801_495_1529 344
267 3300002462 JGI24702J35022_10007653 JGI24702J35022_100076531 350
268 3300042606 Ga0466719_191287 Ga0466719_191287_295_1359 354
269 3300042652 Ga0466708_299188 Ga0466708_299188_12611_13678 355
270 3300042616 Ga0466715_507556 Ga0466715_507556_3573_4649 358
271 3300042659 Ga0466733_049047 Ga0466733_049047_4651_5730 359
272 3300042612 Ga0466705_280937 Ga0466705_280937_3983_5065 360
273 3300042624 Ga0466735_045784 Ga0466735_045784_807_1910 367

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00348 polyprenyl_synt Polyprenyl synthetase 68 304 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00348 GO:0008299 isoprenoid biosynthetic process BP

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.