Protein Family IF08743

Metagenome Isolate
131 Members
52 Samples
120 Scaffolds
253.7 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_039712|Ga0466735_039712_8406_9329
Length
307 aa
Sequence
LTKEDIVSTLFSAEVELPTQSSSLARASVVLMMLIGDISKTAVKHIDWRICFGKIEMKIVSWNVNGIRAIYKKNFTIWFKNENADIVCVQETKADETQFPKDIKEIDGYNFYCSSAEKKGYSGVAIWSKINPDFVSSSIENKIFDNEGRILRLDFKDFILFNIYFPNGGASQERLKHKMKFYDYLIKYLKQFENKTVLMCGDYNTAHFSIDLARSKENEKVSGFMPEEREKLDNLISSGFIDTFRYFNKEPGNYTWWDYKTAARSRNIGWRIDYFFMSQHSVKHLKSADIKKSVSGSDHCPISITVF

📊 Sample Types

Isolate 8.4%
Metagenome 91.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.4%
Kalotermitidae 27.5%
Unclassified 23.5%
Rhinotermitidae 5.9%
Termopsidae 5.9%
Hodotermitidae 2.0%
Dytiscidae 2.0%
Passalidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
8 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
25 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
32 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
38 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
43 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
44 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
45 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
48 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10086422 3300009784 Bacteria 4103
2 Ga0466735_042633 3300042624 Bacteria 8408
3 Ga0466735_053542 3300042624 Bacteria 20278
4 Ga0466735_074220 3300042624 Bacteria 8208
5 Ga0466703_250320 3300042636 Bacteria 592480
6 Ga0466704_020563 3300042643 Bacteria 1465
7 Ga0466709_292660 3300042648 Bacteria 19708
8 Ga0466690_185760 3300042590 Unclassified 2599
9 Ga0466706_094524 3300042599 Bacteria 6978
10 Ga0466707_257889 3300042601 Bacteria 4618
11 Ga0466720_007811 3300042607 Bacteria 1976
12 Ga0466705_499814 3300042612 Unclassified 3505
13 Ga0466711_384441 3300042615 Bacteria 3085
14 Ga0466723_123392 3300042618 Bacteria 27024
15 Ga0466729_133904 3300042621 Bacteria 10657
16 IMNBL1DRAFT_c0015898 3300000062 Bacteria 3242
17 Ga0068305_10001548 3300005083 Unclassified 7056
18 Ga0123355_10088143 3300009826 Bacteria 4930
19 Ga0123353_10000218 3300010167 Unclassified 72534
20 Ga0466735_045722 3300042624 Bacteria 5529
21 Ga0466735_225814 3300042624 Bacteria 5319
22 Ga0466704_079423 3300042643 Bacteria 74491
23 Ga0466727_266831 3300042655 Bacteria 1068
24 Ga0466690_198783 3300042590 Bacteria 25547
25 Ga0466692_134733 3300042591 Bacteria 1254
26 Ga0466691_034029 3300042593 Unclassified 1875
27 Ga0466699_239938 3300042597 Bacteria 1117
28 Ga0466699_335891 3300042597 Bacteria 2894
29 Ga0466707_057336 3300042601 Bacteria 145123
30 Ga0466722_127529 3300042609 Bacteria 1960
31 Ga0466710_417049 3300042613 Unclassified 1049
32 Ga0466711_117944 3300042615 Bacteria 215972
33 Ga0466711_157498 3300042615 Bacteria 313285
34 Ga0466723_289367 3300042618 Bacteria 62014
35 Ga0466728_204525 3300042620 Bacteria 24884
36 JGI24696J40584_12958036 3300002834 Bacteria 3843
37 Ga0068305_10000168 3300005083 Bacteria 304006
38 Ga0068305_10000968 3300005083 Bacteria 34979
39 Ga0072941_1556960 3300005201 Bacteria 1238
40 Ga0123356_10001429 3300010049 Unclassified 26418
41 Ga0123356_10430464 3300010049 Bacteria 1464
42 Ga0123353_10419877 3300010167 Bacteria 1982
43 Ga0466735_150628 3300042624 Unclassified 30908
44 Ga0466735_181430 3300042624 Bacteria 4642
45 Ga0466704_017715 3300042643 Unclassified 114027
46 Ga0466708_058201 3300042652 Bacteria 21023
47 Ga0466706_078972 3300042599 Bacteria 13090
48 Ga0466706_156116 3300042599 Bacteria 30046
49 Ga0466706_280526 3300042599 Bacteria 19466
50 Ga0466716_267239 3300042605 Bacteria 10620
51 Ga0466719_040767 3300042606 Bacteria 242892
52 Ga0466711_115691 3300042615 Bacteria 24467
53 Ga0466705_171019 3300042612 Bacteria 78873
54 JGI24702J35022_10019168 3300002462 Bacteria 3724
55 Ga0466735_039712 3300042624 Bacteria 14788
56 Ga0466735_058218 3300042624 Bacteria 21250
57 Ga0466703_205020 3300042636 Bacteria 117626
58 Ga0466690_130973 3300042590 Bacteria 51329
59 Ga0466691_050213 3300042593 Bacteria 33690
60 Ga0466696_267306 3300042596 Bacteria 8041
61 Ga0466707_292421 3300042601 Bacteria 3143
62 Ga0466713_016474 3300042602 Bacteria 5746
63 Ga0466719_524336 3300042606 Bacteria 382683
64 Ga0466711_189352 3300042615 Bacteria 31754
65 Ga0466711_363021 3300042615 Bacteria 4046
66 Ga0466715_098538 3300042616 Bacteria 131452
67 Ga0466723_257900 3300042618 Bacteria 18387
68 IMNBL1DRAFT_c0011110 3300000062 Unclassified 4235
69 JGI24698J34947_10006294 3300002449 Bacteria 6523
70 Ga0068305_10000090 3300005083 Bacteria 152414
71 Ga0123355_10004968 3300009826 Bacteria 19362
72 Ga0466735_155572 3300042624 Bacteria 6504
73 Ga0466703_284201 3300042636 Bacteria 2193
74 Ga0466693_395415 3300042592 Bacteria 2559
75 Ga0466696_031130 3300042596 Bacteria 6796
76 Ga0466701_007620 3300042598 Bacteria 1789
77 Ga0466706_258877 3300042599 Bacteria 4257
78 Ga0466707_096029 3300042601 Bacteria 9378
79 Ga0466719_102704 3300042606 Bacteria 110867
80 Ga0466711_190502 3300042615 Unclassified 6598
81 Ga0466711_250588 3300042615 Bacteria 6638
82 Ga0466715_421227 3300042616 Bacteria 22521
83 Ga0466726_406075 3300042619 Unclassified 2972
84 Ga0466728_237086 3300042620 Bacteria 4094
85 Ga0466705_062226 3300042612 Bacteria 3186
86 Ga0466735_094707 3300042624 Bacteria 17973
87 Ga0466704_125943 3300042643 Bacteria 12098
88 Ga0466709_082573 3300042648 Bacteria 19141
89 Ga0466690_028352 3300042590 Bacteria 80670
90 Ga0466694_154049 3300042594 Bacteria 3059
91 Ga0466707_127454 3300042601 Bacteria 2217
92 Ga0466713_042171 3300042602 Bacteria 29656
93 Ga0466722_016913 3300042609 Bacteria 12977
94 Ga0466698_173849 3300042610 Bacteria 2954
95 Ga0466715_250662 3300042616 Bacteria 24658
96 Ga0466726_090277 3300042619 Bacteria 2908
97 Ga0466726_437684 3300042619 Bacteria 18840
98 Ga0466728_003045 3300042620 Bacteria 90142
99 Ga0466728_138454 3300042620 Bacteria 82446
100 Ga0123353_10545338 3300010167 Bacteria 1674
101 Ga0466690_145457 3300042590 Unclassified 20000
102 Ga0466691_123502 3300042593 Unclassified 2040
103 Ga0466714_164394 3300042603 Bacteria 6239
104 Ga0466717_187036 3300042604 Bacteria 1144
105 Ga0466719_005767 3300042606 Bacteria 2095
106 Ga0466719_227278 3300042606 Unclassified 7301
107 Ga0466705_388248 3300042612 Bacteria 16143
108 Ga0466726_057733 3300042619 Bacteria 7920
109 Ga0466728_213365 3300042620 Bacteria 4747
110 Ga0466728_265513 3300042620 Bacteria 44529
111 Ga0466705_163322 3300042612 Bacteria 155241
112 Ga0068305_10647953 3300005083 Bacteria 5498
113 Ga0123353_10051095 3300010167 Bacteria 6595
114 Ga0466692_053244 3300042591 Bacteria 12730
115 Ga0466696_327163 3300042596 Bacteria 3410
116 Ga0466696_483744 3300042596 Bacteria 1157
117 Ga0466713_079335 3300042602 Bacteria 100418
118 Ga0466713_119990 3300042602 Bacteria 15178
119 Ga0466723_054457 3300042618 Bacteria 34645
120 Ga0466723_197211 3300042618 Bacteria 2263

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_437684 Ga0466726_437684_12899_13660 247
2 3300042606 Ga0466719_040767 Ga0466719_040767_84132_84878 248
3 3300042599 Ga0466706_258877 Ga0466706_258877_3352_4101 249
4 3300002449 JGI24698J34947_10006294 JGI24698J34947_100062942 250
5 3300042615 Ga0466711_384441 Ga0466711_384441_1686_2438 250
6 iso_pr_bacteria 2873584433 2873584945 250
7 3300042590 Ga0466690_130973 Ga0466690_130973_32042_32797 251
8 3300042590 Ga0466690_145457 Ga0466690_145457_3187_3942 251
9 3300042590 Ga0466690_185760 Ga0466690_185760_1514_2269 251
10 3300042590 Ga0466690_198783 Ga0466690_198783_2743_3498 251
11 3300042591 Ga0466692_134733 Ga0466692_134733_302_1057 251
12 3300042593 Ga0466691_034029 Ga0466691_034029_782_1537 251
13 3300042593 Ga0466691_050213 Ga0466691_050213_28845_29600 251
14 3300042593 Ga0466691_123502 Ga0466691_123502_906_1661 251
15 3300042596 Ga0466696_031130 Ga0466696_031130_6020_6775 251
16 3300042596 Ga0466696_327163 Ga0466696_327163_2213_2968 251
17 3300042596 Ga0466696_483744 Ga0466696_483744_168_923 251
18 3300042599 Ga0466706_078972 Ga0466706_078972_800_1555 251
19 3300042599 Ga0466706_094524 Ga0466706_094524_4672_5427 251
20 3300042601 Ga0466707_057336 Ga0466707_057336_46865_47620 251
21 3300042601 Ga0466707_096029 Ga0466707_096029_1483_2238 251
22 3300042601 Ga0466707_127454 Ga0466707_127454_1168_1923 251
23 3300042601 Ga0466707_257889 Ga0466707_257889_527_1282 251
24 3300042601 Ga0466707_292421 Ga0466707_292421_743_1498 251
25 3300042602 Ga0466713_016474 Ga0466713_016474_3601_4356 251
26 3300042602 Ga0466713_042171 Ga0466713_042171_26877_27632 251
27 3300042602 Ga0466713_079335 Ga0466713_079335_17452_18207 251
28 3300042602 Ga0466713_119990 Ga0466713_119990_11880_12635 251
29 3300042603 Ga0466714_164394 Ga0466714_164394_592_1347 251
30 3300042605 Ga0466716_267239 Ga0466716_267239_2821_3576 251
31 3300042606 Ga0466719_102704 Ga0466719_102704_76024_76779 251
32 3300042606 Ga0466719_227278 Ga0466719_227278_6197_6952 251
33 3300042609 Ga0466722_127529 Ga0466722_127529_1143_1898 251
34 3300042612 Ga0466705_062226 Ga0466705_062226_346_1101 251
35 3300042612 Ga0466705_163322 Ga0466705_163322_113836_114591 251
36 3300042612 Ga0466705_171019 Ga0466705_171019_47136_47891 251
37 3300042612 Ga0466705_388248 Ga0466705_388248_735_1490 251
38 3300042612 Ga0466705_499814 Ga0466705_499814_141_896 251
39 3300042615 Ga0466711_115691 Ga0466711_115691_12382_13137 251
40 3300042615 Ga0466711_117944 Ga0466711_117944_24838_25593 251
41 3300042615 Ga0466711_157498 Ga0466711_157498_186000_186755 251
42 3300042615 Ga0466711_190502 Ga0466711_190502_2414_3169 251
43 3300042615 Ga0466711_250588 Ga0466711_250588_359_1114 251
44 3300042616 Ga0466715_098538 Ga0466715_098538_39680_40435 251
45 3300042616 Ga0466715_250662 Ga0466715_250662_12632_13387 251
46 3300042616 Ga0466715_421227 Ga0466715_421227_13778_14533 251
47 3300042618 Ga0466723_054457 Ga0466723_054457_29628_30383 251
48 3300042618 Ga0466723_123392 Ga0466723_123392_10760_11515 251
49 3300042618 Ga0466723_197211 Ga0466723_197211_1334_2089 251
50 3300042618 Ga0466723_257900 Ga0466723_257900_11462_12217 251
51 3300042618 Ga0466723_289367 Ga0466723_289367_31041_31796 251
52 3300042619 Ga0466726_406075 Ga0466726_406075_1334_2089 251
53 3300042620 Ga0466728_003045 Ga0466728_003045_13847_14602 251
54 3300042620 Ga0466728_138454 Ga0466728_138454_38588_39343 251
55 3300042620 Ga0466728_204525 Ga0466728_204525_18863_19618 251
56 3300042620 Ga0466728_265513 Ga0466728_265513_40724_41479 251
57 3300042624 Ga0466735_042633 Ga0466735_042633_3393_4148 251
58 3300042624 Ga0466735_045722 Ga0466735_045722_19_774 251
59 3300042624 Ga0466735_053542 Ga0466735_053542_2304_3059 251
60 3300042624 Ga0466735_058218 Ga0466735_058218_5819_6574 251
61 3300042624 Ga0466735_074220 Ga0466735_074220_3499_4254 251
62 3300042624 Ga0466735_150628 Ga0466735_150628_4019_4774 251
63 3300042624 Ga0466735_155572 Ga0466735_155572_3484_4239 251
64 3300042624 Ga0466735_181430 Ga0466735_181430_3031_3786 251
65 3300042624 Ga0466735_225814 Ga0466735_225814_3628_4383 251
66 3300042636 Ga0466703_284201 Ga0466703_284201_1277_2032 251
67 3300042643 Ga0466704_017715 Ga0466704_017715_110579_111334 251
68 3300042643 Ga0466704_079423 Ga0466704_079423_21256_22011 251
69 3300042643 Ga0466704_125943 Ga0466704_125943_10114_10869 251
70 3300042648 Ga0466709_082573 Ga0466709_082573_6708_7463 251
71 3300042652 Ga0466708_058201 Ga0466708_058201_2261_3016 251
72 3300042655 Ga0466727_266831 Ga0466727_266831_123_878 251
73 iso_pr_bacteria 2754412482 2755216228 251
74 iso_pr_bacteria 2772190891 2773434578 251
75 iso_pr_bacteria 2772190894 2773440157 251
76 iso_pr_bacteria 642555172 642790788 251
77 3300005083 Ga0068305_10000090 Ga0068305_1000009052 252
78 3300005083 Ga0068305_10000168 Ga0068305_10000168134 252
79 3300005083 Ga0068305_10000968 Ga0068305_1000096827 252
80 3300005083 Ga0068305_10001548 Ga0068305_100015486 252
81 3300010049 Ga0123356_10001429 Ga0123356_1000142925 252
82 3300042606 Ga0466719_524336 Ga0466719_524336_282080_282838 252
83 3300042636 Ga0466703_205020 Ga0466703_205020_73791_74549 252
84 3300042643 Ga0466704_020563 Ga0466704_020563_368_1126 252
85 iso_pr_bacteria 2754412483 2755216595 252
86 iso_pr_bacteria 2772190892 2773435793 252
87 iso_pr_bacteria 2772190893 2773438217 252
88 3300009784 Ga0123357_10086422 Ga0123357_100864225 253
89 3300010167 Ga0123353_10000218 Ga0123353_1000021823 253
90 3300042598 Ga0466701_007620 Ga0466701_007620_645_1406 253
91 3300042599 Ga0466706_280526 Ga0466706_280526_18125_18886 253
92 3300042648 Ga0466709_292660 Ga0466709_292660_13959_14720 253
93 3300000062 IMNBL1DRAFT_c0011110 IMNBL1DRAFT_00111102 254
94 3300042592 Ga0466693_395415 Ga0466693_395415_256_1020 254
95 3300042594 Ga0466694_154049 Ga0466694_154049_180_944 254
96 3300042596 Ga0466696_267306 Ga0466696_267306_4766_5530 254
97 3300042597 Ga0466699_239938 Ga0466699_239938_48_812 254
98 3300042609 Ga0466722_016913 Ga0466722_016913_8654_9418 254
99 3300042610 Ga0466698_173849 Ga0466698_173849_1556_2320 254
100 iso_pr_bacteria 2820737921 2820738251 254
101 iso_pr_bacteria 2820737921 2820739774 254
102 3300002462 JGI24702J35022_10019168 JGI24702J35022_100191683 255
103 3300005083 Ga0068305_10647953 Ga0068305_106479534 255
104 3300010049 Ga0123356_10430464 Ga0123356_104304642 255
105 3300010167 Ga0123353_10419877 Ga0123353_104198773 255
106 3300042597 Ga0466699_335891 Ga0466699_335891_1447_2214 255
107 3300042615 Ga0466711_189352 Ga0466711_189352_348_1115 255
108 3300042615 Ga0466711_363021 Ga0466711_363021_94_861 255
109 3300042620 Ga0466728_213365 Ga0466728_213365_1147_1914 255
110 3300042620 Ga0466728_237086 Ga0466728_237086_187_954 255
111 3300042606 Ga0466719_005767 Ga0466719_005767_334_1104 256
112 3300042607 Ga0466720_007811 Ga0466720_007811_1057_1827 256
113 3300042621 Ga0466729_133904 Ga0466729_133904_8335_9105 256
114 3300042624 Ga0466735_094707 Ga0466735_094707_13445_14215 256
115 3300002834 JGI24696J40584_12958036 JGI24696J40584_129580361 257
116 3300042619 Ga0466726_090277 Ga0466726_090277_1098_1871 257
117 3300042604 Ga0466717_187036 Ga0466717_187036_39_815 258
118 3300042590 Ga0466690_028352 Ga0466690_028352_6168_6947 259
119 iso_pr_bacteria 2772190895 2773440348 259
120 3300005201 Ga0072941_1556960 Ga0072941_15569601 260
121 3300009826 Ga0123355_10004968 Ga0123355_100049687 260
122 3300042613 Ga0466710_417049 Ga0466710_417049_212_994 260
123 3300042636 Ga0466703_250320 Ga0466703_250320_426833_427621 262
124 3300009826 Ga0123355_10088143 Ga0123355_100881437 263
125 3300042591 Ga0466692_053244 Ga0466692_053244_1125_1919 264
126 3300042599 Ga0466706_156116 Ga0466706_156116_25622_26416 264
127 3300010167 Ga0123353_10051095 Ga0123353_100510953 265
128 3300042619 Ga0466726_057733 Ga0466726_057733_864_1664 266
129 3300000062 IMNBL1DRAFT_c0015898 IMNBL1DRAFT_00158982 276
130 3300010167 Ga0123353_10545338 Ga0123353_105453382 292
131 3300042624 Ga0466735_039712 Ga0466735_039712_8406_9329 307

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 60 299 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03372 GO:0003824 catalytic activity MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3g4t-assembly1.cif.gz_A Mth0212 (WT) in complex with a 7bp dsDNA 0.988 57 307
3g0r-assembly1.cif.gz_A Complex of Mth0212 and an 8bp dsDNA with distorted ends 0.988 57 307
3g91-assembly1.cif.gz_A 1.2 Angstrom structure of the exonuclease III homologue Mth0212 0.988 55 306
3w2y-assembly2.cif.gz_D Crystal structure of DNA uridine endonuclease Mth212 mutant W205S 0.986 55 307
5j8n-assembly1.cif.gz_A Exonuclease III homologue Mm3148 from Methanosarcina mazei 0.979 56 306
IDDescriptionScoreStartEndSuperfamily
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.988 55 307 3.60.10.10
4qh9A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9623 57 306 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.96 57 306 3.60.10.10
5cfeA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9556 57 307 3.60.10.10
4f1rA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9552 57 306 3.60.10.10
IDDescriptionScoreStartEndGO Terms
AF-A0A0G1WNG6-F1-model_v4 Uncharacterized/unreviewed 0.9922 200 307 GO:0003677
GO:0003906
GO:0008311
GO:0046872
GO:0008081
GO:0006284
AF-A0A258YT93-F1-model_v4 Uncharacterized/unreviewed 0.9919 200 307
AF-X1KGJ9-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9912 147 307 GO:0003906
GO:0008311
GO:0046872
GO:0008081
GO:0006284
AF-A0A4Q3F998-F1-model_v4 Uncharacterized/unreviewed 0.9905 200 307

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.