Protein Family IF08738

Metagenome Isolate
156 Members
69 Samples
131 Scaffolds
436.29 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_025336|Ga0466735_025336_1052_2329
Length
416 aa
Sequence
VGKSTLFNRLTKSRRAIVNEQAGTTRDRQYGKSDWNGQEFSVIDTGGWVVNSTDVFEDEIKRQVQLAIEEADSLLFLVDVQNGITDFDEEVARILRQTKKPVFLVANKADTFDAQYLVAEFYKLGLGEPMPISAVNGLGTGDLLDKIVEIFPENERIAFVGRPNVGKSSIINAFLGEDRTIVTDIAGTTRDSIYVRFNKFGHDFYFVDTAGIRKKAKVNEDLEYYSVVRSIRAIENSDVCVLMLDATRGIEGQDLSIFSLIQKNRKGLVVCVNKWDLVESKENKDVKHFESAIRERLAPFVDFPIVFTSALNKQRILKVIELASAVYENKSRKVQTAKLNELFLPLIENYPPPALKGKYVKIKYVTQLPNTQVPTFVFFANLPQYIKEPYQRFLENKLRAEWEFTGTPVQLFFRNK

πŸ“Š Sample Types

Isolate 16.0%
Metagenome 84.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 30.4%
Termitidae 23.2%
Kalotermitidae 18.8%
Unclassified 8.7%
Rhinotermitidae 5.8%
Termopsidae 5.8%
Passalidae 4.3%
Hodotermitidae 1.4%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2923982719 Parabacteroides sp. 52 Isolate Blattidae
2 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
3 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
4 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
17 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
18 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
19 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
20 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
31 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
32 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
33 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
34 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
35 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
44 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
45 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
46 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
47 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
49 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
53 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
54 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
55 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
56 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
57 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
58 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
59 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
60 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
61 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
63 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
64 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
65 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
66 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
67 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
68 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
69 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_376420 3300042601 Bacteria 22118
2 Ga0466713_119439 3300042602 Bacteria 22009
3 Ga0466714_111320 3300042603 Bacteria 185233
4 Ga0466711_016653 3300042615 Bacteria 16569
5 Ga0466715_318605 3300042616 Bacteria 4562
6 Ga0466718_033204 3300042617 Bacteria 1769
7 Ga0466726_385768 3300042619 Unclassified 4367
8 Ga0466692_128376 3300042591 Bacteria 43265
9 Ga0466691_015892 3300042593 Bacteria 9356
10 Ga0466696_443206 3300042596 Bacteria 17122
11 Ga0466735_025336 3300042624 Bacteria 2557
12 Ga0466703_070580 3300042636 Bacteria 7354
13 Ga0466703_246946 3300042636 Bacteria 14388
14 JGI24702J35022_10031564 3300002462 Bacteria 2838
15 Ga0068305_10014153 3300005083 Bacteria 6017
16 Ga0466705_342178 3300042612 Bacteria 42153
17 Ga0466716_028167 3300042605 Bacteria 22705
18 Ga0466705_520056 3300042612 Bacteria 9333
19 Ga0466710_044875 3300042613 Bacteria 3769
20 Ga0466711_095269 3300042615 Bacteria 10475
21 Ga0466715_098299 3300042616 Bacteria 65486
22 Ga0466723_194429 3300042618 Bacteria 44464
23 Ga0466690_312691 3300042590 Bacteria 6428
24 Ga0466691_028303 3300042593 Bacteria 6908
25 Ga0466729_287966 3300042621 Unclassified 2170
26 Ga0466735_003895 3300042624 Bacteria 3803
27 Ga0466735_185456 3300042624 Bacteria 4680
28 Ga0466708_329889 3300042652 Bacteria 7408
29 Ga0466727_086387 3300042655 Bacteria 3160
30 2227561852 2225789004 Bacteria 2714
31 JGI24699J35502_11134185 3300002509 Bacteria 47737
32 Ga0466705_096235 3300042612 Unclassified 3714
33 Ga0466706_089075 3300042599 Bacteria 35431
34 Ga0466706_203302 3300042599 Bacteria 74431
35 Ga0466713_003855 3300042602 Bacteria 6926
36 Ga0466713_028370 3300042602 Bacteria 12991
37 Ga0466716_221991 3300042605 Bacteria 25521
38 Ga0466723_272360 3300042618 Bacteria 11837
39 Ga0466729_005970 3300042621 Bacteria 14969
40 Ga0466690_049826 3300042590 Bacteria 9496
41 Ga0466735_204079 3300042624 Bacteria 4713
42 Ga0466704_192237 3300042643 Bacteria 19929
43 Ga0466704_229795 3300042643 Unclassified 17391
44 Ga0466704_415947 3300042643 Bacteria 4660
45 Ga0466704_431598 3300042643 Bacteria 4479
46 Ga0466704_512121 3300042643 Unclassified 6998
47 Ga0466709_034964 3300042648 Bacteria 9366
48 Ga0466727_124154 3300042655 Bacteria 1909
49 Ga0466727_329273 3300042655 Bacteria 45796
50 IMNBL1DRAFT_c0006299 3300000062 Bacteria 6508
51 Ga0068305_10134032 3300005083 Unclassified 2198
52 Ga0466697_258576 3300042611 Bacteria 357278
53 Ga0562377_0004 3300056842 Bacteria 3525959
54 Ga0466706_000283 3300042599 Bacteria 1400
55 Ga0466706_004369 3300042599 Bacteria 14417
56 Ga0466706_018876 3300042599 Bacteria 5472
57 Ga0466706_193053 3300042599 Bacteria 20372
58 Ga0466707_411122 3300042601 Bacteria 1492
59 Ga0466713_149457 3300042602 Bacteria 12707
60 Ga0466722_172548 3300042609 Bacteria 5057
61 Ga0466715_072353 3300042616 Bacteria 9199
62 Ga0466715_085911 3300042616 Bacteria 54416
63 Ga0466726_247770 3300042619 Bacteria 31730
64 Ga0466728_110625 3300042620 Bacteria 42471
65 Ga0466691_179116 3300042593 Bacteria 10445
66 Ga0466703_250498 3300042636 Bacteria 17409
67 Ga0466704_180263 3300042643 Bacteria 6243
68 2227400259 2225789004 Bacteria 5781
69 JGI24702J35022_10004274 3300002462 Bacteria 8519
70 JGI24702J35022_10010727 3300002462 Bacteria 5117
71 Ga0123357_10004008 3300009784 Bacteria 17120
72 Ga0123356_10271725 3300010049 Bacteria 1785
73 Ga0466706_082212 3300042599 Bacteria 2130
74 Ga0466711_030287 3300042615 Bacteria 18879
75 Ga0466696_131706 3300042596 Bacteria 3051
76 Ga0466696_248241 3300042596 Bacteria 3345
77 Ga0466703_061591 3300042636 Bacteria 26544
78 Ga0466725_185075 3300042654 Bacteria 6984
79 Ga0466727_065656 3300042655 Bacteria 6217
80 2227552969 2225789004 Bacteria 2825
81 Ga0068302_10148722 3300005071 Bacteria 3341
82 Ga0466705_189441 3300042612 Bacteria 18281
83 Ga0466733_103433 3300042659 Bacteria 33641
84 Ga0466733_185397 3300042659 Bacteria 2265
85 Ga0466707_061953 3300042601 Bacteria 4450
86 Ga0466707_158401 3300042601 Bacteria 7458
87 Ga0466713_065595 3300042602 Bacteria 4349
88 Ga0466713_110270 3300042602 Bacteria 25871
89 Ga0466713_129716 3300042602 Bacteria 104954
90 Ga0466710_278710 3300042613 Bacteria 16262
91 Ga0466711_040380 3300042615 Bacteria 15149
92 Ga0466715_411770 3300042616 Bacteria 6079
93 Ga0466723_230208 3300042618 Bacteria 14199
94 Ga0466656_080769 3300042550 Bacteria 19535
95 Ga0466690_103895 3300042590 Bacteria 13537
96 Ga0466690_158972 3300042590 Bacteria 37920
97 Ga0466691_013990 3300042593 Bacteria 39551
98 Ga0466703_118254 3300042636 Bacteria 6505
99 Ga0466704_291813 3300042643 Bacteria 20152
100 Ga0466727_137474 3300042655 Bacteria 5657
101 2227111381 2225789004 Bacteria 9393
102 2227623524 2225789004 Bacteria 2171
103 IMNBL1DRAFT_c0000203 3300000062 Bacteria 52380
104 Ga0466700_174611 3300042600 Bacteria 29560
105 Ga0466707_420035 3300042601 Bacteria 14009
106 Ga0466716_356608 3300042605 Bacteria 21145
107 Ga0466715_385280 3300042616 Bacteria 24407
108 Ga0466723_354543 3300042618 Bacteria 2220
109 Ga0466726_180129 3300042619 Bacteria 17840
110 Ga0466728_066997 3300042620 Bacteria 13179
111 Ga0466693_394919 3300042592 Bacteria 2187
112 Ga0466709_215380 3300042648 Bacteria 33059
113 Ga0466727_169553 3300042655 Bacteria 9366
114 IMNBL1DRAFT_c0002690 3300000062 Bacteria 12135
115 JGI24702J35022_10001519 3300002462 Bacteria 14409
116 Ga0466733_138740 3300042659 Bacteria 4001
117 Ga0123353_10000278 3300010167 Bacteria 63177
118 Ga0466701_069735 3300042598 Bacteria 6655
119 Ga0466706_078960 3300042599 Bacteria 10873
120 Ga0466713_008802 3300042602 Bacteria 69616
121 Ga0466716_260561 3300042605 Bacteria 3203
122 Ga0466711_048662 3300042615 Bacteria 31707
123 Ga0466715_486406 3300042616 Bacteria 9310
124 Ga0466715_613764 3300042616 Bacteria 6180
125 Ga0466728_302977 3300042620 Bacteria 25242
126 Ga0466729_065241 3300042621 Bacteria 21132
127 Ga0466657_294566 3300042582 Unclassified 2943
128 Ga0466657_337380 3300042582 Bacteria 20451
129 Ga0466703_036888 3300042636 Bacteria 17604
130 Ga0466703_100821 3300042636 Bacteria 10628
131 2226999807 2225789003 Bacteria 6347

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042582 Ga0466657_294566 Ga0466657_294566_1781_2932 383
2 3300042624 Ga0466735_025336 Ga0466735_025336_1052_2329 416
3 3300042602 Ga0466713_028370 Ga0466713_028370_8741_10054 424
4 3300042655 Ga0466727_086387 Ga0466727_086387_1811_3124 424
5 3300005083 Ga0068305_10014153 Ga0068305_100141534 425
6 3300042599 Ga0466706_000283 Ga0466706_000283_43_1320 425
7 3300042599 Ga0466706_203302 Ga0466706_203302_18101_19378 425
8 3300042615 Ga0466711_016653 Ga0466711_016653_11832_13109 425
9 3300042643 Ga0466704_415947 Ga0466704_415947_2200_3477 425
10 3300042550 Ga0466656_080769 Ga0466656_080769_13674_14981 435
11 3300042598 Ga0466701_069735 Ga0466701_069735_4938_6245 435
12 3300042603 Ga0466714_111320 Ga0466714_111320_68093_69400 435
13 3300002462 JGI24702J35022_10010727 JGI24702J35022_100107274 436
14 3300010167 Ga0123353_10000278 Ga0123353_1000027831 436
15 3300042592 Ga0466693_394919 Ga0466693_394919_240_1550 436
16 3300042602 Ga0466713_110270 Ga0466713_110270_13769_15079 436
17 3300042609 Ga0466722_172548 Ga0466722_172548_1334_2644 436
18 3300042616 Ga0466715_098299 Ga0466715_098299_22916_24226 436
19 3300042617 Ga0466718_033204 Ga0466718_033204_418_1728 436
20 3300042619 Ga0466726_180129 Ga0466726_180129_13622_14932 436
21 3300042655 Ga0466727_124154 Ga0466727_124154_490_1800 436
22 iso_pr_bacteria 2923982719 2923983236 436
23 iso_pr_bacteria 2940202316 2940205397 436
24 iso_pr_bacteria 2940371297 2940373335 436
25 2225789003 2226999807 2227353400 437
26 2225789004 2227111381 2227500418 437
27 2225789004 2227400259 2227843717 437
28 2225789004 2227552969 2228083982 437
29 2225789004 2227561852 2228099268 437
30 2225789004 2227623524 2228203637 437
31 3300002462 JGI24702J35022_10001519 JGI24702J35022_100015196 437
32 3300002462 JGI24702J35022_10004274 JGI24702J35022_100042745 437
33 3300002462 JGI24702J35022_10031564 JGI24702J35022_100315642 437
34 3300005071 Ga0068302_10148722 Ga0068302_101487221 437
35 3300010049 Ga0123356_10271725 Ga0123356_102717251 437
36 3300042582 Ga0466657_337380 Ga0466657_337380_17239_18552 437
37 3300042590 Ga0466690_049826 Ga0466690_049826_3229_4542 437
38 3300042590 Ga0466690_103895 Ga0466690_103895_5780_7093 437
39 3300042590 Ga0466690_158972 Ga0466690_158972_3448_4761 437
40 3300042590 Ga0466690_312691 Ga0466690_312691_952_2265 437
41 3300042591 Ga0466692_128376 Ga0466692_128376_35204_36517 437
42 3300042593 Ga0466691_013990 Ga0466691_013990_21060_22373 437
43 3300042593 Ga0466691_015892 Ga0466691_015892_2152_3465 437
44 3300042593 Ga0466691_028303 Ga0466691_028303_4351_5664 437
45 3300042596 Ga0466696_131706 Ga0466696_131706_1539_2852 437
46 3300042596 Ga0466696_248241 Ga0466696_248241_199_1512 437
47 3300042596 Ga0466696_443206 Ga0466696_443206_10980_12293 437
48 3300042599 Ga0466706_004369 Ga0466706_004369_857_2170 437
49 3300042599 Ga0466706_018876 Ga0466706_018876_2743_4056 437
50 3300042599 Ga0466706_078960 Ga0466706_078960_2039_3352 437
51 3300042599 Ga0466706_082212 Ga0466706_082212_799_2112 437
52 3300042599 Ga0466706_089075 Ga0466706_089075_5197_6510 437
53 3300042599 Ga0466706_193053 Ga0466706_193053_10181_11494 437
54 3300042600 Ga0466700_174611 Ga0466700_174611_23423_24736 437
55 3300042601 Ga0466707_061953 Ga0466707_061953_2505_3818 437
56 3300042601 Ga0466707_158401 Ga0466707_158401_164_1477 437
57 3300042601 Ga0466707_376420 Ga0466707_376420_15494_16807 437
58 3300042601 Ga0466707_411122 Ga0466707_411122_165_1478 437
59 3300042601 Ga0466707_420035 Ga0466707_420035_7527_8840 437
60 3300042602 Ga0466713_003855 Ga0466713_003855_2744_4057 437
61 3300042602 Ga0466713_065595 Ga0466713_065595_1113_2426 437
62 3300042602 Ga0466713_119439 Ga0466713_119439_8601_9914 437
63 3300042602 Ga0466713_129716 Ga0466713_129716_78631_79944 437
64 3300042602 Ga0466713_149457 Ga0466713_149457_7921_9234 437
65 3300042605 Ga0466716_028167 Ga0466716_028167_11453_12766 437
66 3300042605 Ga0466716_221991 Ga0466716_221991_16340_17653 437
67 3300042605 Ga0466716_260561 Ga0466716_260561_1147_2460 437
68 3300042605 Ga0466716_356608 Ga0466716_356608_14806_16119 437
69 3300042611 Ga0466697_258576 Ga0466697_258576_354772_356085 437
70 3300042612 Ga0466705_096235 Ga0466705_096235_1925_3238 437
71 3300042612 Ga0466705_189441 Ga0466705_189441_151_1464 437
72 3300042612 Ga0466705_342178 Ga0466705_342178_8016_9329 437
73 3300042612 Ga0466705_520056 Ga0466705_520056_7379_8692 437
74 3300042613 Ga0466710_044875 Ga0466710_044875_1798_3111 437
75 3300042613 Ga0466710_278710 Ga0466710_278710_10595_11908 437
76 3300042615 Ga0466711_030287 Ga0466711_030287_4411_5724 437
77 3300042615 Ga0466711_040380 Ga0466711_040380_9968_11281 437
78 3300042615 Ga0466711_048662 Ga0466711_048662_19577_20890 437
79 3300042615 Ga0466711_095269 Ga0466711_095269_2359_3672 437
80 3300042616 Ga0466715_072353 Ga0466715_072353_4197_5510 437
81 3300042616 Ga0466715_085911 Ga0466715_085911_33272_34585 437
82 3300042616 Ga0466715_385280 Ga0466715_385280_2913_4226 437
83 3300042616 Ga0466715_411770 Ga0466715_411770_758_2071 437
84 3300042616 Ga0466715_486406 Ga0466715_486406_262_1575 437
85 3300042616 Ga0466715_613764 Ga0466715_613764_697_2010 437
86 3300042618 Ga0466723_194429 Ga0466723_194429_6604_7917 437
87 3300042618 Ga0466723_230208 Ga0466723_230208_4077_5390 437
88 3300042618 Ga0466723_272360 Ga0466723_272360_8707_10020 437
89 3300042618 Ga0466723_354543 Ga0466723_354543_328_1641 437
90 3300042619 Ga0466726_247770 Ga0466726_247770_8851_10164 437
91 3300042619 Ga0466726_385768 Ga0466726_385768_2815_4128 437
92 3300042620 Ga0466728_066997 Ga0466728_066997_4183_5496 437
93 3300042620 Ga0466728_110625 Ga0466728_110625_3109_4422 437
94 3300042620 Ga0466728_302977 Ga0466728_302977_6134_7447 437
95 3300042621 Ga0466729_005970 Ga0466729_005970_3232_4545 437
96 3300042621 Ga0466729_065241 Ga0466729_065241_13889_15202 437
97 3300042624 Ga0466735_003895 Ga0466735_003895_2244_3557 437
98 3300042624 Ga0466735_185456 Ga0466735_185456_2933_4246 437
99 3300042624 Ga0466735_204079 Ga0466735_204079_2726_4039 437
100 3300042636 Ga0466703_036888 Ga0466703_036888_6768_8081 437
101 3300042636 Ga0466703_061591 Ga0466703_061591_15602_16915 437
102 3300042636 Ga0466703_070580 Ga0466703_070580_5118_6431 437
103 3300042636 Ga0466703_100821 Ga0466703_100821_8078_9391 437
104 3300042636 Ga0466703_118254 Ga0466703_118254_4881_6194 437
105 3300042636 Ga0466703_250498 Ga0466703_250498_1916_3229 437
106 3300042643 Ga0466704_180263 Ga0466704_180263_772_2085 437
107 3300042643 Ga0466704_192237 Ga0466704_192237_4539_5852 437
108 3300042643 Ga0466704_229795 Ga0466704_229795_15885_17198 437
109 3300042643 Ga0466704_291813 Ga0466704_291813_13551_14864 437
110 3300042643 Ga0466704_431598 Ga0466704_431598_1111_2424 437
111 3300042643 Ga0466704_512121 Ga0466704_512121_5492_6805 437
112 3300042648 Ga0466709_034964 Ga0466709_034964_7772_9085 437
113 3300042648 Ga0466709_215380 Ga0466709_215380_2889_4202 437
114 3300042652 Ga0466708_329889 Ga0466708_329889_3634_4947 437
115 3300042654 Ga0466725_185075 Ga0466725_185075_3135_4448 437
116 3300042655 Ga0466727_065656 Ga0466727_065656_1246_2559 437
117 3300042655 Ga0466727_137474 Ga0466727_137474_2242_3555 437
118 3300042655 Ga0466727_169553 Ga0466727_169553_1812_3125 437
119 3300042655 Ga0466727_329273 Ga0466727_329273_31896_33209 437
120 3300042659 Ga0466733_103433 Ga0466733_103433_23064_24377 437
121 3300042659 Ga0466733_138740 Ga0466733_138740_1977_3290 437
122 3300042659 Ga0466733_185397 Ga0466733_185397_588_1901 437
123 3300056842 Ga0562377_0004 Ga0562377_0004_1078802_1080115 437
124 iso_pr_bacteria 2820751898 2820753151 437
125 iso_pr_bacteria 2820757377 2820759203 437
126 iso_pr_bacteria 2820776227 2820777466 437
127 iso_pr_bacteria 2910926975 2910930247 437
128 iso_pr_bacteria 2910942425 2910947038 437
129 iso_pr_bacteria 2940195863 2940197445 437
130 iso_pr_bacteria 2940199050 2940199695 437
131 iso_pr_bacteria 2940205530 2940208883 437
132 iso_pr_bacteria 2940209341 2940209472 437
133 iso_pr_bacteria 2940212447 2940215860 437
134 iso_pr_bacteria 2940216256 2940217948 437
135 iso_pr_bacteria 2940298504 2940301851 437
136 iso_pr_bacteria 2940306115 2940309526 437
137 iso_pr_bacteria 2940309933 2940313300 437
138 iso_pr_bacteria 2940313741 2940317177 437
139 iso_pr_bacteria 2940317558 2940320928 437
140 iso_pr_bacteria 2940321370 2940324685 437
141 iso_pr_bacteria 2940325180 2940328586 437
142 iso_pr_bacteria 2940328985 2940332393 437
143 iso_pr_bacteria 2940332795 2940336229 437
144 iso_pr_bacteria 2940346213 2940346976 437
145 iso_pr_bacteria 8100166142 8100166650 437
146 3300000062 IMNBL1DRAFT_c0000203 IMNBL1DRAFT_00002032 438
147 3300000062 IMNBL1DRAFT_c0002690 IMNBL1DRAFT_00026906 438
148 3300000062 IMNBL1DRAFT_c0006299 IMNBL1DRAFT_00062992 438
149 3300002509 JGI24699J35502_11134185 JGI24699J35502_111341857 438
150 3300005083 Ga0068305_10134032 Ga0068305_101340322 438
151 3300009784 Ga0123357_10004008 Ga0123357_1000400817 438
152 3300042593 Ga0466691_179116 Ga0466691_179116_303_1619 438
153 3300042602 Ga0466713_008802 Ga0466713_008802_10193_11548 451
154 3300042621 Ga0466729_287966 Ga0466729_287966_155_1510 451
155 3300042636 Ga0466703_246946 Ga0466703_246946_11052_12407 451
156 3300042616 Ga0466715_318605 Ga0466715_318605_2787_4160 457

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal 333 414 0.97
PF01926 MMR_HSR1 50S ribosome-binding GTPase 156 274 0.9
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 20 152 0.83
PF02421 FeoB_N Ferrous iron transport protein B 156 319 0.81
PF03193 RsgA_GTPase RsgA GTPase 96 214 0.74

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01926 GO:0005525 GTP binding MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.65 0.65 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.