Protein Family IF08728

Metagenome Isolate
215 Members
60 Samples
204 Scaffolds
199.97 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_011711|Ga0466735_011711_1821_2537
Length
238 aa
Sequence
MKKSDTEEVPGNLLPGMFIPENFLLGKKLNGFLPVCGIDEAGRGPLAGPVCAAAVILPADFPVEILNDSKKLNAARRDAARLAICEKAIAWGIGWASAAEIDEINILQASLLAMKRAWEEMASCRNQDPSHRPAGSGDDAKGLTLIDGLTAIVDGLFAPNIPIPCKPMVKADAQVPEVMAASILAKTARDLMMERYSWFYSEYGYDKHKGYPTKAHREAVLKYGPSPIQRMTFTVKKP

📊 Sample Types

Isolate 5.1%
Metagenome 94.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.4%
Kalotermitidae 24.1%
Unclassified 20.7%
Rhinotermitidae 5.2%
Termopsidae 5.2%
Hodotermitidae 1.7%
Blaberidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 205
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
3 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
4 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
23 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
24 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
28 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
38 650716102 Treponema primitia ZAS-2 Isolate Unclassified
39 2772190975 Treponema sp. RmG30 Isolate Blaberidae
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
49 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
52 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
53 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
54 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
57 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
58 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
59 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
60 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_000981 3300042656 Bacteria 2916
2 Ga0123356_11798655 3300010049 Bacteria 761
3 Ga0466712_190974 3300042614 Bacteria 38196
4 Ga0466715_043809 3300042616 Bacteria 8373
5 Ga0466715_126880 3300042616 Bacteria 24039
6 Ga0466718_140065 3300042617 Bacteria 1668
7 Ga0466723_059623 3300042618 Bacteria 3189
8 Ga0466723_126712 3300042618 Bacteria 1398
9 Ga0466726_419638 3300042619 Bacteria 3729
10 Ga0466728_191985 3300042620 Bacteria 3253
11 Ga0466729_000708 3300042621 Bacteria 1166
12 Ga0415639_021002 3300038395 Bacteria 10848
13 Ga0466699_112750 3300042597 Unclassified 1198
14 Ga0466713_078971 3300042602 Bacteria 1966
15 Ga0466705_141700 3300042612 Bacteria 4260
16 Ga0466705_145401 3300042612 Bacteria 13568
17 Ga0466733_151476 3300042659 Bacteria 2821
18 Ga0466712_028639 3300042614 Bacteria 5956
19 Ga0466712_139082 3300042614 Bacteria 3061
20 Ga0466726_020543 3300042619 Bacteria 1256
21 JGI24698J34947_10168372 3300002449 Bacteria 890
22 JGI24695J34938_10001465 3300002450 Bacteria 19962
23 JGI24695J34938_10009619 3300002450 Bacteria 5362
24 Ga0072941_1078225 3300005201 Bacteria 805
25 Ga0466691_006311 3300042593 Bacteria 23417
26 Ga0466696_236991 3300042596 Bacteria 1429
27 Ga0466699_129268 3300042597 Bacteria 9116
28 Ga0466702_446606 3300042635 Bacteria 5784
29 Ga0466704_506123 3300042643 Bacteria 10442
30 Ga0466709_331957 3300042648 Bacteria 4110
31 Ga0466708_028845 3300042652 Bacteria 1406
32 Ga0466708_106623 3300042652 Bacteria 34173
33 Ga0466706_190963 3300042599 Bacteria 1328
34 Ga0466700_118037 3300042600 Bacteria 2599
35 Ga0466716_187998 3300042605 Bacteria 5801
36 Ga0466719_429690 3300042606 Bacteria 3395
37 Ga0466720_025382 3300042607 Unclassified 1558
38 Ga0466705_150150 3300042612 Bacteria 2072
39 Ga0466705_364016 3300042612 Bacteria 4586
40 Ga0123355_10093873 3300009826 Bacteria 4748
41 Ga0123356_10000195 3300010049 Bacteria 69819
42 Ga0123353_11449456 3300010167 Bacteria 878
43 Ga0466712_188833 3300042614 Bacteria 12783
44 Ga0466711_323747 3300042615 Bacteria 1126
45 Ga0466718_075443 3300042617 Bacteria 17626
46 Ga0466718_154059 3300042617 Bacteria 1214
47 Ga0466726_103064 3300042619 Bacteria 5845
48 Ga0466726_218436 3300042619 Bacteria 1246
49 Ga0466728_051073 3300042620 Bacteria 12284
50 JGI24698J34947_10000400 3300002449 Bacteria 19722
51 JGI24698J34947_10038738 3300002449 Bacteria 2471
52 JGI24698J34947_10064874 3300002449 Bacteria 1783
53 JGI24695J34938_10057337 3300002450 Bacteria 1675
54 Ga0072941_1066676 3300005201 Bacteria 2240
55 Ga0072941_1067661 3300005201 Bacteria 2232
56 Ga0072941_1118509 3300005201 Bacteria 1994
57 Ga0415639_207913 3300038395 Bacteria 3197
58 Ga0466699_001472 3300042597 Bacteria 3780
59 Ga0466703_239590 3300042636 Bacteria 1660
60 Ga0466704_193276 3300042643 Bacteria 4580
61 Ga0466727_161428 3300042655 Bacteria 4226
62 Ga0466727_318695 3300042655 Bacteria 3057
63 Ga0466716_185390 3300042605 Bacteria 27438
64 Ga0466719_114445 3300042606 Bacteria 8099
65 Ga0466722_110216 3300042609 Bacteria 32024
66 Ga0123356_10017511 3300010049 Bacteria 6816
67 Ga0123356_10073919 3300010049 Bacteria 3206
68 Ga0466705_427691 3300042612 Bacteria 5854
69 Ga0466712_002198 3300042614 Bacteria 2703
70 Ga0466712_322017 3300042614 Bacteria 16906
71 Ga0466711_293414 3300042615 Bacteria 1682
72 Ga0466715_065722 3300042616 Bacteria 9726
73 Ga0466715_286076 3300042616 Bacteria 13194
74 Ga0466715_310527 3300042616 Bacteria 19107
75 Ga0466715_367856 3300042616 Bacteria 2431
76 Ga0466723_018956 3300042618 Bacteria 15288
77 Ga0466728_254550 3300042620 Bacteria 6144
78 Ga0466728_397899 3300042620 Bacteria 8883
79 AustNasuHG_c1001395 3300000089 Bacteria 8659
80 JGI24698J34947_10028549 3300002449 Bacteria 2953
81 JGI24695J34938_10000096 3300002450 Bacteria 77675
82 JGI24702J35022_10002900 3300002462 Bacteria 10385
83 Ga0264413_100242 3300024493 Bacteria 5179
84 Ga0466690_364002 3300042590 Bacteria 2747
85 Ga0466692_152115 3300042591 Bacteria 8857
86 Ga0466693_082061 3300042592 Bacteria 5046
87 Ga0466691_083193 3300042593 Bacteria 5493
88 Ga0466691_173896 3300042593 Bacteria 1112
89 Ga0466694_319810 3300042594 Bacteria 1061
90 Ga0466731_202237 3300042622 Bacteria 1761
91 Ga0466731_250435 3300042622 Bacteria 10404
92 Ga0466735_153899 3300042624 Bacteria 3681
93 Ga0466735_178843 3300042624 Bacteria 1176
94 Ga0466708_033618 3300042652 Bacteria 6741
95 Ga0466708_368772 3300042652 Bacteria 50694
96 Ga0466701_051660 3300042598 Bacteria 1954
97 Ga0466719_197195 3300042606 Bacteria 18174
98 Ga0466719_257267 3300042606 Bacteria 1753
99 Ga0466719_325107 3300042606 Bacteria 20441
100 Ga0466722_063563 3300042609 Bacteria 3571
101 Ga0466733_051843 3300042659 Unclassified 2045
102 Ga0123356_10013818 3300010049 Unclassified 7776
103 Ga0123353_10106671 3300010167 Bacteria 4513
104 Ga0466711_380185 3300042615 Bacteria 1156
105 Ga0466715_447524 3300042616 Bacteria 20272
106 Ga0466718_016131 3300042617 Bacteria 1074
107 Ga0466723_013578 3300042618 Bacteria 26598
108 Ga0466723_325404 3300042618 Bacteria 1829
109 Ga0466726_006334 3300042619 Bacteria 1217
110 AustNasuHG_c1037162 3300000089 Unclassified 1249
111 JGI24702J35022_10032877 3300002462 Bacteria 2775
112 Ga0072940_1021822 3300005200 Bacteria 923
113 Ga0072941_1102712 3300005201 Bacteria 2036
114 Ga0466694_121515 3300042594 Bacteria 1818
115 Ga0466696_345523 3300042596 Bacteria 48190
116 Ga0466699_189531 3300042597 Bacteria 15863
117 Ga0466703_058642 3300042636 Unclassified 10733
118 Ga0466704_072990 3300042643 Unclassified 4624
119 Ga0466704_078336 3300042643 Bacteria 2537
120 Ga0466704_303779 3300042643 Bacteria 22719
121 Ga0466704_417564 3300042643 Bacteria 2793
122 Ga0466709_294346 3300042648 Bacteria 1417
123 Ga0466708_238227 3300042652 Bacteria 3400
124 Ga0466708_416689 3300042652 Bacteria 7144
125 Ga0466707_335159 3300042601 Bacteria 2388
126 Ga0466707_351246 3300042601 Bacteria 1460
127 Ga0466713_101717 3300042602 Bacteria 4729
128 Ga0123357_10004358 3300009784 Bacteria 16590
129 Ga0123356_10560403 3300010049 Unclassified 1304
130 Ga0123354_10123125 3300010882 Bacteria 3332
131 Ga0466726_333342 3300042619 Bacteria 1616
132 Ga0466728_019829 3300042620 Bacteria 7158
133 Ga0466728_180070 3300042620 Bacteria 4061
134 Ga0466729_121392 3300042621 Bacteria 1740
135 JGI24698J34947_10020587 3300002449 Bacteria 3552
136 JGI24698J34947_10136599 3300002449 Bacteria 1040
137 JGI24695J34938_10073166 3300002450 Bacteria 1428
138 JGI24702J35022_10035566 3300002462 Bacteria 2664
139 Ga0072941_1001405 3300005201 Bacteria 8536
140 Ga0264413_100245 3300024493 Bacteria 19068
141 Ga0415639_005327 3300038395 Bacteria 9048
142 Ga0415639_178900 3300038395 Bacteria 1468
143 Ga0466690_302593 3300042590 Bacteria 1736
144 Ga0466693_152830 3300042592 Bacteria 52782
145 Ga0466691_049828 3300042593 Bacteria 12529
146 Ga0466694_187810 3300042594 Bacteria 1118
147 Ga0466696_150416 3300042596 Bacteria 1064
148 Ga0466729_287732 3300042621 Bacteria 1203
149 Ga0466735_011711 3300042624 Bacteria 8147
150 Ga0466703_038640 3300042636 Bacteria 9661
151 Ga0466703_152439 3300042636 Bacteria 3179
152 Ga0466703_247107 3300042636 Bacteria 11599
153 Ga0466708_284472 3300042652 Bacteria 13785
154 Ga0466707_367494 3300042601 Bacteria 1177
155 Ga0466707_382438 3300042601 Bacteria 2072
156 Ga0466719_339448 3300042606 Bacteria 5971
157 Ga0466720_172706 3300042607 Bacteria 1119
158 Ga0466698_507564 3300042610 Bacteria 1028
159 Ga0466733_212182 3300042659 Bacteria 1169
160 Ga0123355_10003029 3300009826 Bacteria 23952
161 Ga0123356_10002597 3300010049 Bacteria 19264
162 Ga0123356_10226145 3300010049 Bacteria 1932
163 Ga0123356_10556984 3300010049 Bacteria 1308
164 Ga0123354_10087719 3300010882 Bacteria 4335
165 Ga0466712_099260 3300042614 Bacteria 6953
166 Ga0466723_098868 3300042618 Bacteria 14238
167 Ga0466726_216579 3300042619 Bacteria 9703
168 Ga0466728_166868 3300042620 Bacteria 1609
169 Ga0466728_477134 3300042620 Bacteria 4664
170 AustNasuHG_c1021062 3300000089 Bacteria 2116
171 JGI24698J34947_10001748 3300002449 Bacteria 11579
172 JGI24698J34947_10039269 3300002449 Bacteria 2451
173 Ga0466692_070807 3300042591 Bacteria 3469
174 Ga0466729_318336 3300042621 Unclassified 2968
175 Ga0466731_425653 3300042622 Bacteria 2767
176 Ga0466708_132767 3300042652 Bacteria 13186
177 Ga0466708_159818 3300042652 Bacteria 12071
178 Ga0466727_104477 3300042655 Bacteria 1697
179 Ga0466719_053243 3300042606 Bacteria 17590
180 Ga0123356_10032867 3300010049 Bacteria 4851
181 Ga0123356_10460807 3300010049 Unclassified 1421
182 Ga0123353_10038362 3300010167 Bacteria 7528
183 Ga0123353_12081133 3300010167 Bacteria 692
184 Ga0466711_033391 3300042615 Bacteria 1117
185 Ga0466711_313526 3300042615 Bacteria 1297
186 Ga0466711_401048 3300042615 Bacteria 13916
187 Ga0466715_067738 3300042616 Bacteria 2268
188 AustNasuHG_c1043980 3300000089 Bacteria 1041
189 JGI24698J34947_10142895 3300002449 Bacteria 1005
190 JGI24695J34938_10000975 3300002450 Bacteria 26067
191 JGI24695J34938_10007966 3300002450 Bacteria 6119
192 JGI24695J34938_10055161 3300002450 Bacteria 1719
193 Ga0264413_138166 3300024493 Bacteria 2264
194 Ga0466690_296683 3300042590 Bacteria 5047
195 Ga0466694_050561 3300042594 Bacteria 4039
196 Ga0466694_185124 3300042594 Bacteria 1509
197 Ga0466703_350882 3300042636 Bacteria 30976
198 Ga0466708_030059 3300042652 Bacteria 2063
199 Ga0466707_092896 3300042601 Bacteria 1301
200 Ga0466716_084186 3300042605 Bacteria 10879
201 Ga0466716_130739 3300042605 Bacteria 2607
202 Ga0466719_499584 3300042606 Bacteria 7538
203 Ga0466719_554461 3300042606 Bacteria 1429
204 Ga0466698_334483 3300042610 Bacteria 1047

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_286076 Ga0466715_286076_1340_1906 163
2 3300042652 Ga0466708_106623 Ga0466708_106623_27509_28012 167
3 3300042659 Ga0466733_051843 Ga0466733_051843_302_820 172
4 3300002449 JGI24698J34947_10000400 JGI24698J34947_1000040017 175
5 3300042606 Ga0466719_554461 Ga0466719_554461_705_1235 176
6 3300042612 Ga0466705_145401 Ga0466705_145401_7440_8042 176
7 3300042614 Ga0466712_188833 Ga0466712_188833_4514_5044 176
8 3300042614 Ga0466712_322017 Ga0466712_322017_9294_9824 176
9 3300042620 Ga0466728_254550 Ga0466728_254550_3286_3816 176
10 3300042617 Ga0466718_154059 Ga0466718_154059_416_973 185
11 3300042656 Ga0466732_000981 Ga0466732_000981_1947_2504 185
12 3300042614 Ga0466712_099260 Ga0466712_099260_5612_6175 187
13 3300002449 JGI24698J34947_10001748 JGI24698J34947_100017489 188
14 3300042596 Ga0466696_236991 Ga0466696_236991_346_912 188
15 3300042605 Ga0466716_185390 Ga0466716_185390_16080_16646 188
16 3300038395 Ga0415639_178900 Ga0415639_178900_344_913 189
17 3300042617 Ga0466718_016131 Ga0466718_016131_58_630 190
18 3300042617 Ga0466718_075443 Ga0466718_075443_5714_6286 190
19 3300000089 AustNasuHG_c1037162 AustNasuHG_10371622 191
20 3300000089 AustNasuHG_c1043980 AustNasuHG_10439801 191
21 3300002450 JGI24695J34938_10000975 JGI24695J34938_1000097510 191
22 3300010167 Ga0123353_12081133 Ga0123353_120811331 191
23 3300024493 Ga0264413_100242 Ga0264413_1002423 191
24 3300024493 Ga0264413_138166 Ga0264413_1381663 191
25 3300038395 Ga0415639_005327 Ga0415639_005327_6203_6778 191
26 3300042606 Ga0466719_339448 Ga0466719_339448_2386_2961 191
27 3300042607 Ga0466720_025382 Ga0466720_025382_374_949 191
28 3300042607 Ga0466720_172706 Ga0466720_172706_175_750 191
29 3300042616 Ga0466715_126880 Ga0466715_126880_4898_5473 191
30 3300042616 Ga0466715_447524 Ga0466715_447524_18404_18979 191
31 3300042620 Ga0466728_051073 Ga0466728_051073_5118_5744 191
32 3300042652 Ga0466708_368772 Ga0466708_368772_28205_28780 191
33 3300042655 Ga0466727_104477 Ga0466727_104477_850_1425 191
34 3300042659 Ga0466733_151476 Ga0466733_151476_1704_2279 191
35 iso_pr_bacteria 650716099 650879228 191
36 3300000089 AustNasuHG_c1001395 AustNasuHG_10013957 192
37 3300002450 JGI24695J34938_10000096 JGI24695J34938_1000009616 192
38 3300002450 JGI24695J34938_10073166 JGI24695J34938_100731662 192
39 3300010049 Ga0123356_10013818 Ga0123356_100138186 192
40 3300010167 Ga0123353_10106671 Ga0123353_101066714 192
41 3300042591 Ga0466692_070807 Ga0466692_070807_1523_2101 192
42 3300042600 Ga0466700_118037 Ga0466700_118037_457_1035 192
43 3300042601 Ga0466707_335159 Ga0466707_335159_78_656 192
44 3300042612 Ga0466705_364016 Ga0466705_364016_3925_4503 192
45 3300042619 Ga0466726_216579 Ga0466726_216579_4470_5048 192
46 3300042621 Ga0466729_121392 Ga0466729_121392_1078_1656 192
47 3300042643 Ga0466704_303779 Ga0466704_303779_21335_21913 192
48 iso_pr_bacteria 2781125653 2781313753 192
49 3300000089 AustNasuHG_c1021062 AustNasuHG_10210624 193
50 3300009826 Ga0123355_10093873 Ga0123355_100938732 193
51 3300010049 Ga0123356_10017511 Ga0123356_100175113 193
52 3300010049 Ga0123356_10556984 Ga0123356_105569842 193
53 3300042594 Ga0466694_319810 Ga0466694_319810_122_703 193
54 3300042596 Ga0466696_345523 Ga0466696_345523_14562_15143 193
55 3300042601 Ga0466707_367494 Ga0466707_367494_512_1093 193
56 3300042605 Ga0466716_130739 Ga0466716_130739_332_955 193
57 3300042610 Ga0466698_334483 Ga0466698_334483_186_767 193
58 3300042610 Ga0466698_507564 Ga0466698_507564_312_893 193
59 3300042618 Ga0466723_098868 Ga0466723_098868_4736_5317 193
60 3300042624 Ga0466735_178843 Ga0466735_178843_48_629 193
61 3300042636 Ga0466703_038640 Ga0466703_038640_2110_2691 193
62 3300010049 Ga0123356_10226145 Ga0123356_102261451 194
63 3300042591 Ga0466692_152115 Ga0466692_152115_5755_6339 194
64 3300042593 Ga0466691_173896 Ga0466691_173896_120_704 194
65 3300042594 Ga0466694_185124 Ga0466694_185124_720_1304 194
66 3300042606 Ga0466719_325107 Ga0466719_325107_550_1134 194
67 3300042615 Ga0466711_033391 Ga0466711_033391_303_887 194
68 3300042615 Ga0466711_380185 Ga0466711_380185_386_970 194
69 3300042620 Ga0466728_019829 Ga0466728_019829_628_1212 194
70 3300042636 Ga0466703_239590 Ga0466703_239590_853_1437 194
71 3300042652 Ga0466708_030059 Ga0466708_030059_1388_1972 194
72 3300010167 Ga0123353_10038362 Ga0123353_100383625 195
73 3300024493 Ga0264413_100245 Ga0264413_1002455 195
74 3300042606 Ga0466719_053243 Ga0466719_053243_8113_8700 195
75 3300042615 Ga0466711_313526 Ga0466711_313526_599_1186 195
76 3300042615 Ga0466711_323747 Ga0466711_323747_135_722 195
77 3300042616 Ga0466715_367856 Ga0466715_367856_1656_2243 195
78 3300042620 Ga0466728_477134 Ga0466728_477134_75_662 195
79 iso_pr_bacteria 2772190975 2773723787 195
80 iso_pr_bacteria 2781125662 2781335605 195
81 iso_pr_bacteria 2781125687 2781421651 195
82 3300002450 JGI24695J34938_10055161 JGI24695J34938_100551611 196
83 3300010049 Ga0123356_10000195 Ga0123356_1000019521 196
84 3300010882 Ga0123354_10123125 Ga0123354_101231253 196
85 3300042597 Ga0466699_112750 Ga0466699_112750_585_1175 196
86 3300042606 Ga0466719_257267 Ga0466719_257267_575_1165 196
87 3300042612 Ga0466705_141700 Ga0466705_141700_2048_2638 196
88 3300042621 Ga0466729_287732 Ga0466729_287732_217_807 196
89 iso_pr_bacteria 2781125688 2781423823 196
90 3300002449 JGI24698J34947_10028549 JGI24698J34947_100285493 197
91 3300005201 Ga0072941_1067661 Ga0072941_10676612 197
92 3300010049 Ga0123356_10560403 Ga0123356_105604032 197
93 3300010882 Ga0123354_10087719 Ga0123354_100877194 197
94 3300038395 Ga0415639_021002 Ga0415639_021002_9528_10121 197
95 3300042606 Ga0466719_197195 Ga0466719_197195_11002_11595 197
96 3300042606 Ga0466719_499584 Ga0466719_499584_6656_7249 197
97 3300042615 Ga0466711_401048 Ga0466711_401048_3760_4353 197
98 3300042636 Ga0466703_350882 Ga0466703_350882_7811_8404 197
99 3300042652 Ga0466708_028845 Ga0466708_028845_476_1069 197
100 3300010049 Ga0123356_10032867 Ga0123356_100328672 198
101 3300010049 Ga0123356_10460807 Ga0123356_104608071 198
102 3300010049 Ga0123356_11798655 Ga0123356_117986551 198
103 3300042592 Ga0466693_082061 Ga0466693_082061_4306_4902 198
104 3300042601 Ga0466707_382438 Ga0466707_382438_806_1402 198
105 3300042615 Ga0466711_293414 Ga0466711_293414_181_777 198
106 3300042616 Ga0466715_067738 Ga0466715_067738_485_1081 198
107 3300042616 Ga0466715_310527 Ga0466715_310527_10244_10840 198
108 3300042618 Ga0466723_325404 Ga0466723_325404_354_971 198
109 iso_pr_bacteria 2781125639 2781285722 198
110 iso_pr_bacteria 2781125648 2781305430 198
111 3300002450 JGI24695J34938_10001465 JGI24695J34938_1000146515 199
112 3300002462 JGI24702J35022_10032877 JGI24702J35022_100328772 199
113 3300042594 Ga0466694_187810 Ga0466694_187810_160_759 199
114 3300042622 Ga0466731_250435 Ga0466731_250435_3010_3609 199
115 3300042622 Ga0466731_425653 Ga0466731_425653_1761_2360 199
116 3300042635 Ga0466702_446606 Ga0466702_446606_3544_4143 199
117 3300042659 Ga0466733_212182 Ga0466733_212182_491_1090 199
118 3300002449 JGI24698J34947_10142895 JGI24698J34947_101428952 200
119 3300042619 Ga0466726_103064 Ga0466726_103064_4588_5190 200
120 3300042621 Ga0466729_318336 Ga0466729_318336_25_627 200
121 3300042652 Ga0466708_159818 Ga0466708_159818_7286_7888 200
122 3300042655 Ga0466727_318695 Ga0466727_318695_112_714 200
123 3300002449 JGI24698J34947_10020587 JGI24698J34947_100205874 201
124 3300002449 JGI24698J34947_10038738 JGI24698J34947_100387383 201
125 3300010049 Ga0123356_10002597 Ga0123356_1000259712 201
126 3300042643 Ga0466704_078336 Ga0466704_078336_218_823 201
127 3300002449 JGI24698J34947_10064874 JGI24698J34947_100648742 202
128 3300010167 Ga0123353_11449456 Ga0123353_114494562 202
129 3300042593 Ga0466691_006311 Ga0466691_006311_19507_20115 202
130 3300042612 Ga0466705_427691 Ga0466705_427691_5101_5709 202
131 3300005201 Ga0072941_1001405 Ga0072941_10014059 203
132 3300005201 Ga0072941_1078225 Ga0072941_10782251 203
133 3300042619 Ga0466726_006334 Ga0466726_006334_307_918 203
134 3300042619 Ga0466726_218436 Ga0466726_218436_231_842 203
135 3300042621 Ga0466729_000708 Ga0466729_000708_403_1014 203
136 iso_pr_bacteria 650716102 650881992 203
137 3300002449 JGI24698J34947_10136599 JGI24698J34947_101365992 204
138 3300042594 Ga0466694_050561 Ga0466694_050561_2960_3574 204
139 3300042594 Ga0466694_121515 Ga0466694_121515_234_848 204
140 3300042619 Ga0466726_333342 Ga0466726_333342_609_1223 204
141 3300042636 Ga0466703_247107 Ga0466703_247107_5826_6440 204
142 3300042643 Ga0466704_506123 Ga0466704_506123_4568_5182 204
143 3300042652 Ga0466708_238227 Ga0466708_238227_1060_1674 204
144 3300042652 Ga0466708_416689 Ga0466708_416689_1897_2511 204
145 3300005200 Ga0072940_1021822 Ga0072940_10218222 205
146 3300009826 Ga0123355_10003029 Ga0123355_1000302914 205
147 3300042636 Ga0466703_058642 Ga0466703_058642_1182_1799 205
148 3300042636 Ga0466703_152439 Ga0466703_152439_1738_2355 205
149 3300002450 JGI24695J34938_10007966 JGI24695J34938_100079663 206
150 3300002450 JGI24695J34938_10009619 JGI24695J34938_100096193 206
151 3300002462 JGI24702J35022_10002900 JGI24702J35022_100029006 206
152 3300010049 Ga0123356_10073919 Ga0123356_100739193 206
153 3300042605 Ga0466716_187998 Ga0466716_187998_4511_5131 206
154 3300042609 Ga0466722_110216 Ga0466722_110216_6709_7329 206
155 3300042616 Ga0466715_043809 Ga0466715_043809_6062_6682 206
156 3300042617 Ga0466718_140065 Ga0466718_140065_79_699 206
157 3300042622 Ga0466731_202237 Ga0466731_202237_22_678 206
158 3300042596 Ga0466696_150416 Ga0466696_150416_42_665 207
159 3300042602 Ga0466713_101717 Ga0466713_101717_1740_2363 207
160 3300042616 Ga0466715_065722 Ga0466715_065722_7213_7836 207
161 3300042648 Ga0466709_331957 Ga0466709_331957_778_1401 207
162 3300042652 Ga0466708_284472 Ga0466708_284472_10243_10866 207
163 3300042590 Ga0466690_364002 Ga0466690_364002_1005_1631 208
164 3300042593 Ga0466691_049828 Ga0466691_049828_6195_6848 208
165 3300042606 Ga0466719_114445 Ga0466719_114445_6508_7134 208
166 3300042614 Ga0466712_190974 Ga0466712_190974_30518_31144 208
167 3300042618 Ga0466723_059623 Ga0466723_059623_2076_2702 208
168 3300042620 Ga0466728_180070 Ga0466728_180070_3123_3749 208
169 3300042620 Ga0466728_397899 Ga0466728_397899_6852_7478 208
170 iso_pr_bacteria 2781125666 2781345509 208
171 3300002449 JGI24698J34947_10039269 JGI24698J34947_100392693 209
172 3300002450 JGI24695J34938_10057337 JGI24695J34938_100573372 209
173 3300009784 Ga0123357_10004358 Ga0123357_100043585 209
174 3300042605 Ga0466716_084186 Ga0466716_084186_2451_3080 209
175 3300042606 Ga0466719_429690 Ga0466719_429690_465_1094 209
176 3300042612 Ga0466705_150150 Ga0466705_150150_104_733 209
177 3300042619 Ga0466726_020543 Ga0466726_020543_542_1171 209
178 3300002449 JGI24698J34947_10168372 JGI24698J34947_101683721 210
179 3300005201 Ga0072941_1102712 Ga0072941_11027123 210
180 3300042614 Ga0466712_028639 Ga0466712_028639_4559_5191 210
181 iso_pr_bacteria 2781125655 2781318109 210
182 3300005201 Ga0072941_1066676 Ga0072941_10666763 211
183 3300042592 Ga0466693_152830 Ga0466693_152830_40143_40778 211
184 3300042593 Ga0466691_083193 Ga0466691_083193_4284_4919 211
185 3300042614 Ga0466712_002198 Ga0466712_002198_1784_2419 211
186 3300042614 Ga0466712_139082 Ga0466712_139082_2375_3010 211
187 3300042648 Ga0466709_294346 Ga0466709_294346_87_722 211
188 3300005201 Ga0072941_1118509 Ga0072941_11185093 212
189 3300042620 Ga0466728_191985 Ga0466728_191985_2478_3116 212
190 3300038395 Ga0415639_207913 Ga0415639_207913_802_1503 213
191 3300042590 Ga0466690_296683 Ga0466690_296683_468_1109 213
192 3300042590 Ga0466690_302593 Ga0466690_302593_835_1476 213
193 3300042597 Ga0466699_001472 Ga0466699_001472_3118_3759 213
194 3300042620 Ga0466728_166868 Ga0466728_166868_159_800 213
195 3300042643 Ga0466704_072990 Ga0466704_072990_3725_4366 213
196 3300042643 Ga0466704_193276 Ga0466704_193276_3681_4322 213
197 3300042655 Ga0466727_161428 Ga0466727_161428_2015_2656 213
198 3300042598 Ga0466701_051660 Ga0466701_051660_1149_1793 214
199 3300042601 Ga0466707_351246 Ga0466707_351246_290_934 214
200 3300042618 Ga0466723_013578 Ga0466723_013578_8048_8692 214
201 3300042619 Ga0466726_419638 Ga0466726_419638_1286_1930 214
202 3300042652 Ga0466708_033618 Ga0466708_033618_1149_1793 214
203 3300042618 Ga0466723_126712 Ga0466723_126712_552_1199 215
204 3300042652 Ga0466708_132767 Ga0466708_132767_7932_8579 215
205 3300042597 Ga0466699_189531 Ga0466699_189531_4114_4764 216
206 3300042601 Ga0466707_092896 Ga0466707_092896_17_667 216
207 3300042643 Ga0466704_417564 Ga0466704_417564_314_967 217
208 3300042597 Ga0466699_129268 Ga0466699_129268_5745_6401 218
209 3300042602 Ga0466713_078971 Ga0466713_078971_904_1560 218
210 3300042609 Ga0466722_063563 Ga0466722_063563_1485_2141 218
211 3300042618 Ga0466723_018956 Ga0466723_018956_9619_10302 227
212 3300002462 JGI24702J35022_10035566 JGI24702J35022_100355663 229
213 3300042599 Ga0466706_190963 Ga0466706_190963_312_1004 230
214 3300042624 Ga0466735_153899 Ga0466735_153899_950_1660 236
215 3300042624 Ga0466735_011711 Ga0466735_011711_1821_2537 238

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01351 RNase_HII Ribonuclease HII 36 120 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01351 GO:0004523 RNA-DNA hybrid ribonuclease activity MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3o3h-assembly1.cif.gz_A T. maritima RNase H2 D107N in complex with nucleic acid substrate and manganese ions 0.935 32 233
7uwe-assembly1.cif.gz_C CryoEM Structure of E. coli Transcription-Coupled Ribonucleotide Excision Repair (TC-RER) complex 0.935 30 235
3o3g-assembly1.cif.gz_A T. maritima RNase H2 in complex with nucleic acid substrate and calcium ions 0.928 31 235
2etj-assembly1.cif.gz_A Crystal structure of Ribonuclease HII (EC 3.1.26.4) (RNase HII) (tm0915) from THERMOTOGA MARITIMA at 1.74 A resolution 0.919 30 235
7uwh-assembly1.cif.gz_C CryoEM Structure of E. coli Transcription-Coupled Ribonucleotide Excision Repair (TC-RER) complex bound to ribonucleotide substrate 0.915 32 235
IDDescriptionScoreStartEndSuperfamily
af_P10442_2_197_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9399 31 235 3.30.420.10
af_P9WH01_18_234_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9181 34 235 3.30.420.10
af_Q2FZ38_49_255_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9067 21 233 3.30.420.10
2etjA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9059 30 235 3.30.420.10
af_A4HVE1_65_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8057 97 233 3.30.420.10
IDDescriptionScoreStartEndGO Terms
AF-A0A831UQY3-F1-model_v4 Uncharacterized/unreviewed 0.9717 36 117
AF-A0A7X6T6F9-F1-model_v4 Uncharacterized/unreviewed 0.9697 32 234
AF-Q47F78-F1-model_v4 Ribonuclease HII 0.9694 35 235 GO:0005737
GO:0032299
GO:0030145
GO:0003723
GO:0004523
GO:0043137
GO:0006298
AF-A0A7W9RUB4-F1-model_v4 Uncharacterized/unreviewed 0.9673 34 233
AF-A0A5B8R9H1-F1-model_v4 Ribonuclease HII 0.9667 34 233 GO:0032299
GO:0046872
GO:0003723
GO:0004523
GO:0043137
GO:0006298

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.