Protein Family IF08704

Metagenome Isolate
211 Members
94 Samples
180 Scaffolds
419.16 Avg Length

🧬 Representative Sequence

ID
3300042623|Ga0466734_145186|Ga0466734_145186_2555_4012
Length
485 aa
Sequence
LILGRYAEIFRHSANKMVWLRFTIATNYGKMGGLEVGATLLSPNSYLLKMKRRVVITGIGLVTPLGHDVETVWQKILTGQSGVGKITLFDAQSFPTQIAAEVKDFDMSVIGENPEDWQLQDRHTRFALGAGFKAMVDAGLWDASKKSKAFPYDSERIGIYTGAGEGKQDFGHFTEMVLAALDGKADGQFDMGKFIARGIEILDPIKELEQEPNMPAAHLAAMFEAFGPNINCLTACAASAQAVGEAAQLIKRDEVDIMIAGGTHSMIHPFGVTGFNLLTALSTNNENPQTASKPFDKERDGFVLGEGAAVVILESLEHAQKRGAKIYAELAGYGATADAFRITDIHPEGRGAIGCIKRAMEDAGLSIEDVDYINAHGTSTSVNDRIETLAIKGVFGERAYKVPVSSTKSMTGHLIAAAGASELIYCTLAIRDGVLPPTMNYNVPDPECDLDYIPNAARKAKCDAALSNSFGFGGQNVTLAVRRFA

📊 Sample Types

Isolate 14.7%
Metagenome 85.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 22.5%
Unclassified 18.0%
Kalotermitidae 15.7%
Culicidae 12.4%
Elmidae 7.9%
Termopsidae 3.4%
Scarabaeidae 3.4%
Drosophilidae 3.4%
Rhinotermitidae 3.4%
Passalidae 3.4%
Armadillidiidae 2.2%
Cerambycidae 1.1%
Hydrophilidae 1.1%
Hodotermitidae 1.1%
Pyralidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 191
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
2 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
3 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
4 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
5 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
6 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
7 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
8 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
9 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
10 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
11 2820007728 Unclassified Synergistetes Lab288P3bin114 Isolate Unclassified
12 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
15 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
16 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
17 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
18 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
23 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
24 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
25 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
26 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
27 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
34 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
35 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
36 2504756063 Isoptericola variabilis J5 Isolate Unclassified
37 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
38 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
44 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
45 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
46 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
48 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
49 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
50 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
51 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
52 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
53 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
54 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
55 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
56 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
57 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
58 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
59 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
60 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
61 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
63 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
64 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
65 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
66 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
67 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
68 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
69 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
70 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
71 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
72 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
73 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
74 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
75 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
76 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
77 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
78 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
79 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
80 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
81 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
82 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
83 2505679068 Isoptericola variabilis 225 Isolate Unclassified
84 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
85 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
86 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
87 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
88 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
89 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
90 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
91 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
92 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
93 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
94 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_488092 3300042612 Bacteria 21416
2 Ga0466711_405813 3300042615 Bacteria 65237
3 Ga0466723_019754 3300042618 Bacteria 5252
4 Ga0466726_496862 3300042619 Bacteria 1438
5 Ga0123353_10009386 3300010167 Bacteria 13497
6 Ga0123353_10055978 3300010167 Bacteria 6311
7 Ga0123353_10401224 3300010167 Bacteria 2041
8 Ga0123354_10081427 3300010882 Bacteria 4574
9 Ga0160432_100874 3300012818 Bacteria 13197
10 Ga0160460_100032 3300012845 Bacteria 316932
11 Ga0160447_100022 3300012849 Bacteria 249772
12 Ga0466690_141666 3300042590 Bacteria 8439
13 Ga0466690_156763 3300042590 Unclassified 3542
14 Ga0466690_391518 3300042590 Bacteria 8665
15 Ga0068305_10000012 3300005083 Bacteria 51331
16 Ga0068305_10004980 3300005083 Bacteria 28780
17 Ga0068305_10010736 3300005083 Bacteria 13971
18 Ga0072941_1005966 3300005201 Bacteria 2981
19 Ga0104019_1191509 3300007150 Bacteria 1799
20 Ga0466729_272034 3300042621 Bacteria 4043
21 Ga0466730_071786 3300042625 Bacteria 741189
22 Ga0466706_010392 3300042599 Bacteria 27140
23 Ga0466705_039922 3300042612 Archaea 11238
24 Ga0466705_068878 3300042612 Bacteria 15921
25 Ga0466712_204312 3300042614 Bacteria 1503
26 Ga0466711_117944 3300042615 Bacteria 215972
27 Ga0466711_213944 3300042615 Bacteria 3448
28 Ga0466715_256017 3300042616 Bacteria 19667
29 Ga0466715_347031 3300042616 Bacteria 23088
30 Ga0466715_611347 3300042616 Bacteria 2214
31 Ga0466723_140918 3300042618 Bacteria 4329
32 Ga0466723_345019 3300042618 Bacteria 27914
33 Ga0466729_126861 3300042621 Bacteria 19801
34 Ga0123356_10001782 3300010049 Bacteria 23502
35 Ga0123353_10021204 3300010167 Bacteria 9744
36 Ga0123353_10038583 3300010167 Bacteria 7508
37 Ga0160455_100023 3300012837 Bacteria 373908
38 Ga0466690_186557 3300042590 Bacteria 2615
39 Ga0466691_005731 3300042593 Bacteria 15513
40 Ga0466696_144852 3300042596 Unclassified 8879
41 JGI24702J35022_10024120 3300002462 Bacteria 3286
42 Ga0068305_10000253 3300005083 Bacteria 49207
43 Ga0072940_1342187 3300005200 Bacteria 4793
44 Ga0104045_1003733 3300007085 Bacteria 5260
45 Ga0466730_048728 3300042625 Bacteria 16453
46 Ga0466704_283529 3300042643 Unclassified 5965
47 Ga0466708_122809 3300042652 Bacteria 31687
48 Ga0466708_459271 3300042652 Bacteria 1872
49 Ga0466717_220290 3300042604 Bacteria 1955
50 Ga0466716_049088 3300042605 Bacteria 4105
51 Ga0466719_010648 3300042606 Bacteria 9354
52 Ga0466705_208486 3300042612 Bacteria 71494
53 Ga0466705_307150 3300042612 Bacteria 11295
54 Ga0466711_088144 3300042615 Bacteria 25974
55 Ga0466711_119355 3300042615 Bacteria 3846
56 Ga0466723_095142 3300042618 Bacteria 13924
57 Ga0466723_147990 3300042618 Bacteria 45924
58 Ga0466728_245902 3300042620 Bacteria 2568
59 Ga0123355_10008026 3300009826 Bacteria 15915
60 Ga0123355_10398181 3300009826 Bacteria 1778
61 Ga0123353_10000121 3300010167 Bacteria 93049
62 Ga0160452_100011 3300012834 Bacteria 394039
63 Ga0160457_1000091 3300012858 Bacteria 119417
64 Ga0072941_1302660 3300005201 Bacteria 2112
65 Ga0074308_1114241 3300005307 Bacteria 1973
66 Ga0466704_036464 3300042643 Unclassified 6766
67 Ga0466704_060552 3300042643 Bacteria 4551
68 Ga0466704_370727 3300042643 Bacteria 76606
69 Ga0466704_384168 3300042643 Bacteria 13585
70 Ga0466724_25433 3300042649 Bacteria 649431
71 Ga0466708_153444 3300042652 Bacteria 13341
72 Ga0466727_151432 3300042655 Bacteria 242508
73 Ga0466716_137232 3300042605 Bacteria 4976
74 Ga0466722_106307 3300042609 Bacteria 35451
75 Ga0466733_158500 3300042659 Bacteria 12405
76 Ga0466711_024049 3300042615 Bacteria 9250
77 Ga0466715_473273 3300042616 Bacteria 12849
78 Ga0466723_054389 3300042618 Bacteria 2501
79 Ga0466723_276603 3300042618 Bacteria 34293
80 Ga0123353_10008756 3300010167 Bacteria 13863
81 Ga0123353_10010971 3300010167 Bacteria 12710
82 Ga0466693_071934 3300042592 Bacteria 1571
83 2227646814 2225789004 Bacteria 44642
84 JGI24702J35022_10009278 3300002462 Bacteria 5531
85 Ga0104045_1004363 3300007085 Bacteria 4465
86 Ga0466734_145186 3300042623 Bacteria 4734
87 Ga0466703_235728 3300042636 Bacteria 12070
88 Ga0466724_50998 3300042649 Unclassified 4541
89 Ga0466708_072337 3300042652 Bacteria 4125
90 Ga0466701_086935 3300042598 Bacteria 154395
91 Ga0466713_149396 3300042602 Bacteria 5017
92 Ga0466705_073622 3300042612 Bacteria 20606
93 Ga0466718_099325 3300042617 Bacteria 8096
94 Ga0466723_208657 3300042618 Bacteria 23133
95 Ga0466726_065940 3300042619 Bacteria 154230
96 Ga0466726_345134 3300042619 Bacteria 52575
97 Ga0466728_346008 3300042620 Bacteria 130078
98 Ga0123357_10005208 3300009784 Bacteria 15521
99 Ga0123356_10553033 3300010049 Bacteria 1312
100 Ga0123353_10043659 3300010167 Bacteria 7104
101 Ga0160434_100061 3300012850 Bacteria 75989
102 Ga0466690_168179 3300042590 Bacteria 2828
103 Ga0466691_057730 3300042593 Unclassified 12235
104 Ga0466691_062223 3300042593 Bacteria 24335
105 Ga0466691_223306 3300042593 Bacteria 4738
106 Ga0466696_036971 3300042596 Bacteria 13028
107 Ga0466696_121054 3300042596 Bacteria 2929
108 Ga0466731_184658 3300042622 Bacteria 1767
109 Ga0466735_146244 3300042624 Bacteria 2920
110 Ga0466709_190789 3300042648 Unclassified 1511
111 Ga0466724_14598 3300042649 Bacteria 10198
112 Ga0466708_139554 3300042652 Bacteria 28818
113 Ga0466727_063582 3300042655 Bacteria 93834
114 Ga0466713_005490 3300042602 Bacteria 25065
115 Ga0466719_419904 3300042606 Bacteria 15352
116 Ga0466705_200769 3300042612 Unclassified 1919
117 Ga0466711_159983 3300042615 Bacteria 9920
118 Ga0466711_401857 3300042615 Bacteria 5763
119 Ga0466715_306309 3300042616 Unclassified 35761
120 Ga0466723_133842 3300042618 Bacteria 68745
121 Ga0466729_082034 3300042621 Bacteria 4693
122 Ga0123353_10179086 3300010167 Bacteria 3358
123 Ga0160446_100114 3300012835 Bacteria 71931
124 Ga0466692_031111 3300042591 Bacteria 12425
125 IMNBGM34_c000440 3300000036 Bacteria 11295
126 JGI24702J35022_10018191 3300002462 Bacteria 3833
127 Ga0068305_10000184 3300005083 Bacteria 99663
128 Ga0466729_230806 3300042621 Bacteria 2357
129 Ga0466731_351139 3300042622 Unclassified 2453
130 Ga0466730_030722 3300042625 Bacteria 1135247
131 Ga0466704_147616 3300042643 Bacteria 7580
132 Ga0466704_261152 3300042643 Unclassified 8577
133 Ga0466724_51506 3300042649 Bacteria 34498
134 Ga0466708_262744 3300042652 Unclassified 20123
135 Ga0466727_241854 3300042655 Bacteria 13450
136 Ga0466713_005286 3300042602 Bacteria 50542
137 Ga0466713_047897 3300042602 Bacteria 9584
138 Ga0466716_023046 3300042605 Bacteria 14254
139 Ga0466716_149957 3300042605 Bacteria 22152
140 Ga0466716_245817 3300042605 Unclassified 7205
141 Ga0466697_251728 3300042611 Bacteria 10618
142 Ga0466711_140963 3300042615 Bacteria 11959
143 Ga0466715_233674 3300042616 Bacteria 14345
144 Ga0466723_326921 3300042618 Bacteria 27694
145 Ga0123355_10260653 3300009826 Bacteria 2425
146 Ga0123356_10186701 3300010049 Unclassified 2100
147 Ga0160465_100104 3300012803 Bacteria 82876
148 Ga0160472_101272 3300012839 Unclassified 7868
149 Ga0466696_058216 3300042596 Bacteria 20036
150 Meta3P_1009839 3300002464 Bacteria 4378
151 Ga0466704_038669 3300042643 Bacteria 1699
152 Ga0466709_217732 3300042648 Unclassified 1897
153 Ga0466724_53424 3300042649 Bacteria 3708
154 Ga0466708_364329 3300042652 Bacteria 54307
155 Ga0466707_176498 3300042601 Bacteria 3238
156 Ga0466707_183102 3300042601 Bacteria 16535
157 Ga0466722_094365 3300042609 Bacteria 6791
158 Ga0466705_155149 3300042612 Unclassified 3148
159 Ga0466711_044341 3300042615 Bacteria 37002
160 Ga0466711_251707 3300042615 Bacteria 16974
161 Ga0466715_332143 3300042616 Bacteria 9948
162 Ga0466726_239056 3300042619 Bacteria 21787
163 Ga0466728_192819 3300042620 Bacteria 25511
164 Ga0466729_093993 3300042621 Bacteria 3610
165 Ga0123356_10003749 3300010049 Bacteria 15841
166 Ga0160466_100001 3300012809 Bacteria 656346
167 Ga0160470_100477 3300012813 Bacteria 16928
168 Ga0466691_082301 3300042593 Bacteria 6311
169 Ga0466696_334723 3300042596 Unclassified 5695
170 IMNBL1DRAFT_c0000060 3300000062 Bacteria 101547
171 Ga0466708_324784 3300042652 Bacteria 6363
172 Ga0466708_392587 3300042652 Bacteria 35393
173 Ga0466727_004454 3300042655 Bacteria 4897
174 Ga0466706_031300 3300042599 Bacteria 209681
175 Ga0466706_214601 3300042599 Bacteria 6886
176 Ga0466700_309868 3300042600 Bacteria 5403
177 Ga0466716_064137 3300042605 Bacteria 2643
178 Ga0466719_413609 3300042606 Unclassified 2070
179 Ga0466722_041168 3300042609 Bacteria 4884
180 Ga0466698_239118 3300042610 Bacteria 5409

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_068878 Ga0466705_068878_12616_13758 380
2 3300012837 Ga0160455_100023 Ga0160455_100023242 389
3 3300005307 Ga0074308_1114241 Ga0074308_11142413 392
4 3300012809 Ga0160466_100001 Ga0160466_100001445 394
5 3300042590 Ga0466690_186557 Ga0466690_186557_989_2230 397
6 3300012835 Ga0160446_100114 Ga0160446_10011422 398
7 3300007085 Ga0104045_1003733 Ga0104045_10037335 399
8 3300007085 Ga0104045_1004363 Ga0104045_10043634 399
9 3300042616 Ga0466715_233674 Ga0466715_233674_10791_11993 400
10 3300042652 Ga0466708_262744 Ga0466708_262744_6432_7637 401
11 3300042609 Ga0466722_041168 Ga0466722_041168_679_1932 402
12 3300042615 Ga0466711_119355 Ga0466711_119355_1487_2725 402
13 3300042596 Ga0466696_036971 Ga0466696_036971_9257_10501 404
14 3300042616 Ga0466715_332143 Ga0466715_332143_3402_4652 405
15 iso_pr_bacteria 2671180705 2673867688 405
16 3300042616 Ga0466715_611347 Ga0466715_611347_716_1957 406
17 3300010049 Ga0123356_10553033 Ga0123356_105530331 408
18 iso_pr_bacteria 8046957834 8046963690 408
19 3300005200 Ga0072940_1342187 Ga0072940_13421873 409
20 3300009826 Ga0123355_10398181 Ga0123355_103981811 409
21 2225789004 2227646814 2228239191 411
22 3300042592 Ga0466693_071934 Ga0466693_071934_30_1265 411
23 3300042596 Ga0466696_058216 Ga0466696_058216_5835_7070 411
24 3300042615 Ga0466711_024049 Ga0466711_024049_1959_3194 411
25 3300042615 Ga0466711_088144 Ga0466711_088144_10321_11556 411
26 3300042615 Ga0466711_401857 Ga0466711_401857_3856_5091 411
27 3300042648 Ga0466709_217732 Ga0466709_217732_625_1860 411
28 iso_pr_bacteria 2820007728 2820007916 411
29 3300000062 IMNBL1DRAFT_c0000060 IMNBL1DRAFT_000006070 412
30 3300010167 Ga0123353_10055978 Ga0123353_100559785 412
31 3300042593 Ga0466691_062223 Ga0466691_062223_13427_14665 412
32 3300042606 Ga0466719_010648 Ga0466719_010648_6817_8055 412
33 3300042615 Ga0466711_140963 Ga0466711_140963_9774_11012 412
34 3300042616 Ga0466715_306309 Ga0466715_306309_24895_26133 412
35 3300042618 Ga0466723_054389 Ga0466723_054389_836_2074 412
36 3300042618 Ga0466723_147990 Ga0466723_147990_24460_25698 412
37 3300042625 Ga0466730_030722 Ga0466730_030722_912451_913689 412
38 3300042648 Ga0466709_190789 Ga0466709_190789_162_1400 412
39 3300042649 Ga0466724_14598 Ga0466724_14598_7328_8566 412
40 3300042649 Ga0466724_25433 Ga0466724_25433_541342_542580 412
41 3300042649 Ga0466724_50998 Ga0466724_50998_120_1358 412
42 3300042649 Ga0466724_51506 Ga0466724_51506_2263_3501 412
43 3300042652 Ga0466708_392587 Ga0466708_392587_10176_11414 412
44 3300042652 Ga0466708_459271 Ga0466708_459271_462_1700 412
45 iso_pr_bacteria 2529292732 2529760750 412
46 iso_pr_bacteria 2847090942 2847094690 412
47 iso_pr_bacteria 2864788197 2864790132 412
48 iso_pr_bacteria 2864923010 2864924945 412
49 iso_pr_bacteria 2864948220 2864949236 412
50 iso_pr_bacteria 2873581347 2873583754 412
51 iso_pr_bacteria 8002299145 8002304272 412
52 iso_pr_bacteria 8020009074 8020009574 412
53 iso_pr_bacteria 8114076984 8114077229 412
54 iso_pr_bacteria 8114076984 8114080903 412
55 3300002464 Meta3P_1009839 Meta3P_10098391 413
56 3300010882 Ga0123354_10081427 Ga0123354_100814274 413
57 3300042590 Ga0466690_141666 Ga0466690_141666_5375_6616 413
58 3300042593 Ga0466691_057730 Ga0466691_057730_4411_5652 413
59 3300042596 Ga0466696_121054 Ga0466696_121054_153_1394 413
60 3300042598 Ga0466701_086935 Ga0466701_086935_71955_73196 413
61 3300042599 Ga0466706_010392 Ga0466706_010392_18926_20167 413
62 3300042602 Ga0466713_005286 Ga0466713_005286_37838_39079 413
63 3300042602 Ga0466713_149396 Ga0466713_149396_1384_2625 413
64 3300042605 Ga0466716_049088 Ga0466716_049088_761_2002 413
65 3300042605 Ga0466716_245817 Ga0466716_245817_4301_5542 413
66 3300042609 Ga0466722_094365 Ga0466722_094365_445_1686 413
67 3300042611 Ga0466697_251728 Ga0466697_251728_3497_4738 413
68 3300042612 Ga0466705_073622 Ga0466705_073622_6026_7267 413
69 3300042612 Ga0466705_208486 Ga0466705_208486_33032_34273 413
70 3300042615 Ga0466711_117944 Ga0466711_117944_149055_150296 413
71 3300042616 Ga0466715_347031 Ga0466715_347031_16395_17636 413
72 3300042618 Ga0466723_133842 Ga0466723_133842_22467_23708 413
73 3300042618 Ga0466723_208657 Ga0466723_208657_6424_7665 413
74 3300042618 Ga0466723_276603 Ga0466723_276603_26436_27677 413
75 3300042619 Ga0466726_065940 Ga0466726_065940_23798_25039 413
76 3300042619 Ga0466726_345134 Ga0466726_345134_40354_41595 413
77 3300042620 Ga0466728_346008 Ga0466728_346008_24130_25371 413
78 3300042621 Ga0466729_082034 Ga0466729_082034_1827_3068 413
79 3300042621 Ga0466729_126861 Ga0466729_126861_16105_17346 413
80 3300042625 Ga0466730_071786 Ga0466730_071786_415819_417060 413
81 3300042643 Ga0466704_036464 Ga0466704_036464_2212_3453 413
82 3300042643 Ga0466704_283529 Ga0466704_283529_1669_2910 413
83 3300042643 Ga0466704_370727 Ga0466704_370727_39648_40889 413
84 3300042655 Ga0466727_063582 Ga0466727_063582_57383_58624 413
85 iso_pr_bacteria 2687453786 2690172691 413
86 iso_pr_bacteria 2864822740 2864825374 413
87 iso_pr_bacteria 2864831662 2864835036 413
88 iso_pr_bacteria 2864882932 2864885566 413
89 iso_pr_bacteria 2864891731 2864893740 413
90 3300005083 Ga0068305_10000184 Ga0068305_1000018493 414
91 3300005083 Ga0068305_10000253 Ga0068305_1000025310 414
92 3300005083 Ga0068305_10004980 Ga0068305_100049807 414
93 3300042590 Ga0466690_391518 Ga0466690_391518_2858_4102 414
94 3300042593 Ga0466691_005731 Ga0466691_005731_12848_14092 414
95 3300042599 Ga0466706_214601 Ga0466706_214601_1454_2698 414
96 3300042612 Ga0466705_307150 Ga0466705_307150_9247_10491 414
97 3300042612 Ga0466705_488092 Ga0466705_488092_15617_16861 414
98 3300042615 Ga0466711_159983 Ga0466711_159983_2353_3597 414
99 3300042615 Ga0466711_213944 Ga0466711_213944_1805_3049 414
100 3300042636 Ga0466703_235728 Ga0466703_235728_3379_4623 414
101 3300042643 Ga0466704_147616 Ga0466704_147616_2071_3315 414
102 3300042643 Ga0466704_384168 Ga0466704_384168_1516_2760 414
103 iso_pr_bacteria 2504756063 2504977315 414
104 iso_pr_bacteria 2505679068 2505953049 414
105 iso_pr_bacteria 2681812870 2682013381 414
106 iso_pr_bacteria 2731957681 2732698772 414
107 iso_pr_bacteria 2820803007 2820803490 414
108 iso_pr_bacteria 2883361506 2883363682 414
109 iso_pr_bacteria 2884351759 2884353779 414
110 3300005083 Ga0068305_10010736 Ga0068305_100107367 415
111 3300005201 Ga0072941_1302660 Ga0072941_13026602 415
112 3300007150 Ga0104019_1191509 Ga0104019_11915092 415
113 3300012858 Ga0160457_1000091 Ga0160457_100009195 415
114 3300042602 Ga0466713_047897 Ga0466713_047897_7224_8471 415
115 3300042643 Ga0466704_038669 Ga0466704_038669_98_1345 415
116 3300042649 Ga0466724_53424 Ga0466724_53424_34_1281 415
117 3300005083 Ga0068305_10000012 Ga0068305_1000001213 416
118 3300010049 Ga0123356_10003749 Ga0123356_1000374910 416
119 3300012813 Ga0160470_100477 Ga0160470_1004772 416
120 3300042590 Ga0466690_156763 Ga0466690_156763_1904_3154 416
121 3300042593 Ga0466691_082301 Ga0466691_082301_1751_3001 416
122 3300042605 Ga0466716_023046 Ga0466716_023046_6733_7983 416
123 3300042612 Ga0466705_039922 Ga0466705_039922_3876_5126 416
124 3300042615 Ga0466711_044341 Ga0466711_044341_12679_13929 416
125 3300042615 Ga0466711_251707 Ga0466711_251707_15463_16713 416
126 3300042615 Ga0466711_405813 Ga0466711_405813_22706_23956 416
127 3300042618 Ga0466723_019754 Ga0466723_019754_3881_5131 416
128 3300042620 Ga0466728_192819 Ga0466728_192819_18235_19485 416
129 3300042622 Ga0466731_184658 Ga0466731_184658_11_1261 416
130 3300042652 Ga0466708_072337 Ga0466708_072337_794_2044 416
131 3300042652 Ga0466708_324784 Ga0466708_324784_1665_2915 416
132 3300042652 Ga0466708_364329 Ga0466708_364329_10070_11320 416
133 iso_pr_bacteria 2848356102 2848357540 416
134 3300012839 Ga0160472_101272 Ga0160472_1012725 417
135 3300012849 Ga0160447_100022 Ga0160447_100022134 417
136 3300012850 Ga0160434_100061 Ga0160434_10006160 417
137 3300042602 Ga0466713_005490 Ga0466713_005490_22779_24032 417
138 3300042616 Ga0466715_473273 Ga0466715_473273_6548_7801 417
139 3300042652 Ga0466708_122809 Ga0466708_122809_25221_26474 417
140 3300005201 Ga0072941_1005966 Ga0072941_10059663 418
141 3300010167 Ga0123353_10179086 Ga0123353_101790863 418
142 3300012818 Ga0160432_100874 Ga0160432_1008747 418
143 3300012834 Ga0160452_100011 Ga0160452_100011265 418
144 3300042618 Ga0466723_140918 Ga0466723_140918_833_2122 418
145 3300000036 IMNBGM34_c000440 IMNBGM34_00044017 419
146 3300012803 Ga0160465_100104 Ga0160465_10010475 419
147 3300042659 Ga0466733_158500 Ga0466733_158500_10835_12094 419
148 iso_pr_bacteria 2821316722 2821319976 419
149 3300012845 Ga0160460_100032 Ga0160460_100032136 420
150 3300042619 Ga0466726_496862 Ga0466726_496862_37_1344 421
151 3300042621 Ga0466729_093993 Ga0466729_093993_485_1795 421
152 3300042655 Ga0466727_151432 Ga0466727_151432_89556_90821 421
153 3300009826 Ga0123355_10260653 Ga0123355_102606533 422
154 3300010167 Ga0123353_10021204 Ga0123353_100212046 422
155 3300010167 Ga0123353_10043659 Ga0123353_100436595 422
156 3300042609 Ga0466722_106307 Ga0466722_106307_18039_19307 422
157 3300042625 Ga0466730_048728 Ga0466730_048728_3276_4547 423
158 3300042599 Ga0466706_031300 Ga0466706_031300_110339_111613 424
159 3300042655 Ga0466727_004454 Ga0466727_004454_1010_2314 424
160 3300010167 Ga0123353_10010971 Ga0123353_1001097111 426
161 3300042624 Ga0466735_146244 Ga0466735_146244_134_1414 426
162 3300042606 Ga0466719_419904 Ga0466719_419904_739_2049 428
163 iso_pr_bacteria 2820189034 2820191881 430
164 3300009784 Ga0123357_10005208 Ga0123357_1000520812 431
165 3300009826 Ga0123355_10008026 Ga0123355_100080268 431
166 3300010049 Ga0123356_10001782 Ga0123356_1000178213 431
167 3300002462 JGI24702J35022_10009278 JGI24702J35022_100092782 434
168 3300010167 Ga0123353_10401224 Ga0123353_104012242 434
169 3300042605 Ga0466716_064137 Ga0466716_064137_1093_2397 434
170 3300042618 Ga0466723_345019 Ga0466723_345019_23128_24432 434
171 3300042605 Ga0466716_137232 Ga0466716_137232_2761_4068 435
172 3300042621 Ga0466729_230806 Ga0466729_230806_295_1602 435
173 3300002462 JGI24702J35022_10024120 JGI24702J35022_100241204 436
174 3300042590 Ga0466690_168179 Ga0466690_168179_744_2054 436
175 3300042591 Ga0466692_031111 Ga0466692_031111_1156_2466 436
176 3300042596 Ga0466696_144852 Ga0466696_144852_5736_7046 436
177 3300042596 Ga0466696_334723 Ga0466696_334723_2063_3373 436
178 3300042606 Ga0466719_413609 Ga0466719_413609_382_1692 436
179 3300042612 Ga0466705_155149 Ga0466705_155149_114_1424 436
180 3300042612 Ga0466705_200769 Ga0466705_200769_369_1679 436
181 3300042618 Ga0466723_095142 Ga0466723_095142_3880_5190 436
182 3300042620 Ga0466728_245902 Ga0466728_245902_977_2287 436
183 3300042643 Ga0466704_060552 Ga0466704_060552_239_1549 436
184 3300042643 Ga0466704_261152 Ga0466704_261152_726_2036 436
185 3300042652 Ga0466708_139554 Ga0466708_139554_22697_24007 436
186 iso_pr_bacteria 2820205024 2820207352 436
187 3300010167 Ga0123353_10000121 Ga0123353_1000012145 437
188 3300010167 Ga0123353_10009386 Ga0123353_1000938612 437
189 3300042600 Ga0466700_309868 Ga0466700_309868_1763_3076 437
190 3300042604 Ga0466717_220290 Ga0466717_220290_157_1470 437
191 3300042610 Ga0466698_239118 Ga0466698_239118_3751_5064 437
192 3300042617 Ga0466718_099325 Ga0466718_099325_5042_6355 437
193 3300042619 Ga0466726_239056 Ga0466726_239056_18384_19697 437
194 3300042621 Ga0466729_272034 Ga0466729_272034_1436_2749 437
195 3300042622 Ga0466731_351139 Ga0466731_351139_886_2199 437
196 iso_pr_bacteria 2820180635 2820181515 437
197 iso_pr_bacteria 2820185449 2820187423 437
198 3300010049 Ga0123356_10186701 Ga0123356_101867011 438
199 3300010167 Ga0123353_10038583 Ga0123353_100385832 438
200 3300042618 Ga0466723_326921 Ga0466723_326921_25589_26905 438
201 3300042652 Ga0466708_153444 Ga0466708_153444_5415_6734 439
202 3300010167 Ga0123353_10008756 Ga0123353_100087567 443
203 3300042616 Ga0466715_256017 Ga0466715_256017_12742_14112 444
204 3300042601 Ga0466707_176498 Ga0466707_176498_870_2207 445
205 3300042605 Ga0466716_149957 Ga0466716_149957_3987_5330 447
206 3300042593 Ga0466691_223306 Ga0466691_223306_1255_2601 448
207 3300042601 Ga0466707_183102 Ga0466707_183102_2785_4131 448
208 3300042614 Ga0466712_204312 Ga0466712_204312_56_1414 452
209 3300002462 JGI24702J35022_10018191 JGI24702J35022_100181915 463
210 3300042655 Ga0466727_241854 Ga0466727_241854_5465_6865 466
211 3300042623 Ga0466734_145186 Ga0466734_145186_2555_4012 485

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 327 441 0.98
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 52 319 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.