Protein Family IF08701
Metagenome
Isolate
278
Members
115
Samples
239
Scaffolds
190.4
Avg Length
Representative Sequence
- ID
- 3300042623|Ga0466734_139753|Ga0466734_139753_11722_12369
- Length
- 215 aa
- Sequence
- MQKNNQHTSKVSNQKSPLRGAGGRILIFDNYDSFTYNLVQLVEKISQQKIDVYRNDKISLEEMDRYDKIILSPGPGIPEEAGLLLPLIKTYASRKSILGVCLGHQAIGEAFGGTLVNLSKVYHGVATNCKIIGADEKLFKNIPKEFKAGRYHSWVIDQKNFPSELEITALDDNNMIMAIKHKQYDVRGVQFHPESILTPMGEQILRNWLNRLNED
Sample Types
Isolate
14.0%
Metagenome
86.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.4%
Blattidae
16.5%
Kalotermitidae
13.6%
Armadillidiidae
7.8%
Formicidae
4.9%
Drosophilidae
4.9%
Culicidae
4.9%
Termopsidae
3.9%
Rhinotermitidae
2.9%
Unclassified
2.9%
Passalidae
2.9%
Elmidae
2.9%
Pseudophyllodromiidae
1.9%
Daphniidae
1.0%
Hydrophilidae
1.0%
Apidae
1.0%
Bombycidae
1.0%
Cambaridae
1.0%
Tenebrionidae
1.0%
Blaberidae
1.0%
Anaplectidae
1.0%
Tryonicidae
1.0%
Lamproblattidae
1.0%
Taxonomy
Archaea
1
Bacteria
263
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 2 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 3 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 4 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 5 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 6 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 7 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 10 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 23 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 26 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 37 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 38 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 39 | 3300005320 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut | Metagenome | Drosophilidae |
| 40 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 41 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 42 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 43 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 44 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 47 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 48 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 49 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 53 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 54 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 55 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 60 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 61 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 62 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 63 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 64 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 65 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 66 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 69 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 70 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 71 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 72 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 73 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 76 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 77 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 78 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 79 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 80 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 81 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 82 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 83 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 84 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 85 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 86 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 87 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 88 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 89 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 90 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 91 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 92 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 93 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 94 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 95 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 96 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 97 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 98 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 99 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 100 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 101 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 102 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 103 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 104 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 105 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 106 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 107 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 108 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 109 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 110 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 111 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 112 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 113 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 114 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 115 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_009779 | 3300042612 | Bacteria | 2863 |
| 2 | Ga0466705_095082 | 3300042612 | Bacteria | 6691 |
| 3 | 2227005365 | 2225789003 | Bacteria | 5831 |
| 4 | JGI24702J35022_10063217 | 3300002462 | Bacteria | 1983 |
| 5 | Ga0072941_1492302 | 3300005201 | Bacteria | 2626 |
| 6 | Ga0104045_1082238 | 3300007085 | Bacteria | 1068 |
| 7 | Ga0466711_139999 | 3300042615 | Bacteria | 3103 |
| 8 | Ga0466718_129503 | 3300042617 | Bacteria | 1538 |
| 9 | Ga0466726_056753 | 3300042619 | Bacteria | 6474 |
| 10 | Ga0466728_047470 | 3300042620 | Bacteria | 2485 |
| 11 | Ga0466735_210636 | 3300042624 | Bacteria | 3415 |
| 12 | Ga0466735_220934 | 3300042624 | Bacteria | 9943 |
| 13 | Ga0466703_084181 | 3300042636 | Bacteria | 6979 |
| 14 | Ga0466724_39249 | 3300042649 | Bacteria | 11625 |
| 15 | Ga0466727_218108 | 3300042655 | Bacteria | 13790 |
| 16 | Ga0160468_100065 | 3300012819 | Bacteria | 140978 |
| 17 | Ga0160433_100528 | 3300012846 | Bacteria | 17507 |
| 18 | Ga0160457_1011524 | 3300012858 | Bacteria | 1251 |
| 19 | Ga0160457_1013616 | 3300012858 | Unclassified | 1148 |
| 20 | Ga0466690_102107 | 3300042590 | Bacteria | 2116 |
| 21 | Ga0466692_135295 | 3300042591 | Bacteria | 1359 |
| 22 | Ga0466696_017034 | 3300042596 | Bacteria | 23314 |
| 23 | Ga0466696_310383 | 3300042596 | Bacteria | 1253 |
| 24 | Ga0466701_037660 | 3300042598 | Bacteria | 59723 |
| 25 | Ga0466707_387304 | 3300042601 | Bacteria | 7418 |
| 26 | Ga0068302_10068558 | 3300005071 | Bacteria | 2573 |
| 27 | Ga0072940_1162228 | 3300005200 | Bacteria | 1033 |
| 28 | Ga0074317_1137103 | 3300005320 | Bacteria | 1152 |
| 29 | Ga0466711_039476 | 3300042615 | Bacteria | 9362 |
| 30 | Ga0466715_092462 | 3300042616 | Bacteria | 14118 |
| 31 | Ga0466715_332864 | 3300042616 | Bacteria | 20648 |
| 32 | Ga0466723_005656 | 3300042618 | Bacteria | 20094 |
| 33 | Ga0466723_149172 | 3300042618 | Bacteria | 10747 |
| 34 | Ga0466726_011106 | 3300042619 | Bacteria | 2253 |
| 35 | Ga0466726_417570 | 3300042619 | Bacteria | 5617 |
| 36 | Ga0123357_10004506 | 3300009784 | Bacteria | 16374 |
| 37 | Ga0466729_261901 | 3300042621 | Bacteria | 8179 |
| 38 | Ga0466734_139753 | 3300042623 | Bacteria | 15723 |
| 39 | Ga0466703_089300 | 3300042636 | Unclassified | 1997 |
| 40 | Ga0466703_127121 | 3300042636 | Bacteria | 4735 |
| 41 | Ga0466704_072309 | 3300042643 | Bacteria | 9718 |
| 42 | Ga0466709_317083 | 3300042648 | Bacteria | 10979 |
| 43 | Ga0466724_34099 | 3300042649 | Bacteria | 50135 |
| 44 | Ga0160455_100023 | 3300012837 | Bacteria | 373908 |
| 45 | Ga0160457_1001699 | 3300012858 | Bacteria | 5590 |
| 46 | Ga0466691_034694 | 3300042593 | Bacteria | 2534 |
| 47 | Ga0466701_097399 | 3300042598 | Bacteria | 121087 |
| 48 | Ga0466713_087763 | 3300042602 | Bacteria | 5097 |
| 49 | Ga0466716_056980 | 3300042605 | Bacteria | 2618 |
| 50 | Ga0466716_073619 | 3300042605 | Bacteria | 3070 |
| 51 | Ga0466716_101528 | 3300042605 | Bacteria | 7751 |
| 52 | Ga0466719_362367 | 3300042606 | Bacteria | 6140 |
| 53 | Ga0466719_549364 | 3300042606 | Bacteria | 1731 |
| 54 | Ga0466722_029126 | 3300042609 | Bacteria | 18315 |
| 55 | Ga0466698_405024 | 3300042610 | Bacteria | 2802 |
| 56 | IMNBL1DRAFT_c0004122 | 3300000062 | Bacteria | 8875 |
| 57 | IMNBL1DRAFT_c0051141 | 3300000062 | Bacteria | 1303 |
| 58 | Ga0068302_10102124 | 3300005071 | Bacteria | 8884 |
| 59 | Ga0072940_1136793 | 3300005200 | Bacteria | 3211 |
| 60 | Ga0103263_110000 | 3300007042 | Bacteria | 977 |
| 61 | Ga0104045_1002750 | 3300007085 | Unclassified | 17842 |
| 62 | Ga0102734_1000640 | 3300007129 | Bacteria | 13948 |
| 63 | Ga0104048_1022506 | 3300007143 | Bacteria | 3589 |
| 64 | Ga0104019_1000350 | 3300007150 | Unclassified | 3390 |
| 65 | Ga0104019_1004048 | 3300007150 | Bacteria | 10189 |
| 66 | Ga0466712_213057 | 3300042614 | Bacteria | 1181 |
| 67 | Ga0466711_060306 | 3300042615 | Bacteria | 4565 |
| 68 | Ga0466711_088592 | 3300042615 | Bacteria | 4606 |
| 69 | Ga0466715_471970 | 3300042616 | Bacteria | 21523 |
| 70 | Ga0466728_021081 | 3300042620 | Bacteria | 5228 |
| 71 | Ga0466728_147328 | 3300042620 | Bacteria | 4156 |
| 72 | Ga0466728_156870 | 3300042620 | Bacteria | 24732 |
| 73 | Ga0466728_410703 | 3300042620 | Bacteria | 8493 |
| 74 | Ga0466730_009837 | 3300042625 | Bacteria | 325641 |
| 75 | Ga0466703_107170 | 3300042636 | Bacteria | 5745 |
| 76 | Ga0466703_286689 | 3300042636 | Bacteria | 12299 |
| 77 | Ga0466704_078568 | 3300042643 | Bacteria | 13182 |
| 78 | Ga0466724_06985 | 3300042649 | Bacteria | 79949 |
| 79 | Ga0466708_135441 | 3300042652 | Bacteria | 21711 |
| 80 | Ga0160431_100285 | 3300012828 | Bacteria | 29450 |
| 81 | Ga0160460_100013 | 3300012845 | Bacteria | 460073 |
| 82 | Ga0160445_100097 | 3300012847 | Bacteria | 88551 |
| 83 | Ga0466690_009130 | 3300042590 | Bacteria | 7030 |
| 84 | Ga0466690_015343 | 3300042590 | Bacteria | 7118 |
| 85 | Ga0466691_167802 | 3300042593 | Bacteria | 22476 |
| 86 | Ga0466696_140797 | 3300042596 | Bacteria | 4085 |
| 87 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 88 | Ga0466696_394191 | 3300042596 | Bacteria | 7861 |
| 89 | Ga0466699_066155 | 3300042597 | Bacteria | 1025 |
| 90 | Ga0466701_044550 | 3300042598 | Bacteria | 48935 |
| 91 | Ga0466701_096150 | 3300042598 | Unclassified | 53495 |
| 92 | Ga0466707_219452 | 3300042601 | Bacteria | 5700 |
| 93 | Ga0466719_520451 | 3300042606 | Bacteria | 5093 |
| 94 | Ga0466722_157787 | 3300042609 | Bacteria | 8128 |
| 95 | Ga0466733_170029 | 3300042659 | Bacteria | 24463 |
| 96 | Ga0068305_10040460 | 3300005083 | Unclassified | 3079 |
| 97 | Ga0068305_10126352 | 3300005083 | Bacteria | 4519 |
| 98 | Ga0104045_1005457 | 3300007085 | Bacteria | 8619 |
| 99 | Ga0104045_1016806 | 3300007085 | Bacteria | 933 |
| 100 | Ga0102740_1002860 | 3300007140 | Bacteria | 3827 |
| 101 | Ga0104048_1002207 | 3300007143 | Bacteria | 17136 |
| 102 | Ga0104048_1169210 | 3300007143 | Bacteria | 2265 |
| 103 | Ga0104048_1184356 | 3300007143 | Bacteria | 662 |
| 104 | Ga0104019_1002611 | 3300007150 | Unclassified | 1971 |
| 105 | Ga0466711_000292 | 3300042615 | Bacteria | 8850 |
| 106 | Ga0466711_002735 | 3300042615 | Bacteria | 8441 |
| 107 | Ga0466715_045342 | 3300042616 | Bacteria | 6772 |
| 108 | Ga0466723_346543 | 3300042618 | Bacteria | 25857 |
| 109 | Ga0466709_262984 | 3300042648 | Bacteria | 8518 |
| 110 | Ga0466708_041887 | 3300042652 | Bacteria | 6797 |
| 111 | Ga0466727_127655 | 3300042655 | Bacteria | 11887 |
| 112 | Ga0160456_100015 | 3300012820 | Bacteria | 326465 |
| 113 | Ga0160472_101233 | 3300012839 | Bacteria | 8208 |
| 114 | Ga0466690_009119 | 3300042590 | Bacteria | 57867 |
| 115 | Ga0466690_216593 | 3300042590 | Bacteria | 11587 |
| 116 | Ga0466696_033740 | 3300042596 | Bacteria | 2149 |
| 117 | Ga0466701_060315 | 3300042598 | Unclassified | 2737 |
| 118 | Ga0466707_065750 | 3300042601 | Bacteria | 28818 |
| 119 | Ga0466707_146540 | 3300042601 | Bacteria | 20716 |
| 120 | Ga0466716_172046 | 3300042605 | Bacteria | 3531 |
| 121 | Ga0466716_425991 | 3300042605 | Bacteria | 3443 |
| 122 | Ga0466719_059687 | 3300042606 | Bacteria | 12859 |
| 123 | Ga0466719_440976 | 3300042606 | Bacteria | 4466 |
| 124 | Ga0466722_052959 | 3300042609 | Bacteria | 9542 |
| 125 | Ga0466697_127742 | 3300042611 | Bacteria | 1161 |
| 126 | Ga0466705_202926 | 3300042612 | Bacteria | 22976 |
| 127 | 2226991477 | 2225789003 | Bacteria | 7328 |
| 128 | IMNBL1DRAFT_c0001897 | 3300000062 | Bacteria | 15159 |
| 129 | Ga0072940_1198352 | 3300005200 | Bacteria | 1515 |
| 130 | Ga0466715_256528 | 3300042616 | Bacteria | 31335 |
| 131 | Ga0466723_266272 | 3300042618 | Bacteria | 11868 |
| 132 | Ga0466726_322858 | 3300042619 | Bacteria | 2206 |
| 133 | Ga0466726_335684 | 3300042619 | Bacteria | 1746 |
| 134 | Ga0466728_138171 | 3300042620 | Bacteria | 48750 |
| 135 | Ga0466728_374388 | 3300042620 | Bacteria | 11393 |
| 136 | Ga0160442_100009 | 3300012806 | Bacteria | 498468 |
| 137 | Ga0466735_151877 | 3300042624 | Bacteria | 3924 |
| 138 | Ga0466703_229514 | 3300042636 | Bacteria | 9538 |
| 139 | Ga0466704_182716 | 3300042643 | Bacteria | 28436 |
| 140 | Ga0466725_059721 | 3300042654 | Bacteria | 3126 |
| 141 | Ga0466727_179577 | 3300042655 | Bacteria | 6699 |
| 142 | Ga0160469_100036 | 3300012824 | Bacteria | 248494 |
| 143 | Ga0160469_101864 | 3300012824 | Bacteria | 4782 |
| 144 | Ga0160441_100026 | 3300012825 | Bacteria | 245262 |
| 145 | Ga0160455_100119 | 3300012837 | Bacteria | 109702 |
| 146 | Ga0466690_041158 | 3300042590 | Bacteria | 8601 |
| 147 | Ga0466692_004720 | 3300042591 | Bacteria | 21665 |
| 148 | Ga0466696_359729 | 3300042596 | Bacteria | 8179 |
| 149 | Ga0466701_060991 | 3300042598 | Bacteria | 19763 |
| 150 | Ga0466716_059223 | 3300042605 | Bacteria | 12106 |
| 151 | Ga0466716_115117 | 3300042605 | Bacteria | 8279 |
| 152 | Ga0466719_256888 | 3300042606 | Bacteria | 9371 |
| 153 | Ga0466719_335349 | 3300042606 | Bacteria | 8254 |
| 154 | Ga0466722_023509 | 3300042609 | Bacteria | 7337 |
| 155 | Ga0466722_086349 | 3300042609 | Bacteria | 7744 |
| 156 | Ga0466705_019926 | 3300042612 | Bacteria | 9861 |
| 157 | Ga0466705_062779 | 3300042612 | Unclassified | 2198 |
| 158 | Ga0466705_271306 | 3300042612 | Bacteria | 7767 |
| 159 | 2227138327 | 2225789004 | Bacteria | 1632 |
| 160 | IMNBL1DRAFT_c0004236 | 3300000062 | Bacteria | 8705 |
| 161 | Ga0102735_1000879 | 3300007080 | Bacteria | 5518 |
| 162 | Ga0466711_246719 | 3300042615 | Bacteria | 27110 |
| 163 | Ga0466715_628507 | 3300042616 | Bacteria | 8290 |
| 164 | Ga0466715_634151 | 3300042616 | Bacteria | 6543 |
| 165 | Ga0466718_108197 | 3300042617 | Bacteria | 2030 |
| 166 | Ga0466723_049435 | 3300042618 | Bacteria | 1003 |
| 167 | Ga0466726_375253 | 3300042619 | Bacteria | 1383 |
| 168 | Ga0466728_060040 | 3300042620 | Bacteria | 11052 |
| 169 | Ga0123353_10092708 | 3300010167 | Bacteria | 4866 |
| 170 | Ga0466703_104739 | 3300042636 | Bacteria | 9198 |
| 171 | Ga0466704_521025 | 3300042643 | Bacteria | 3681 |
| 172 | Ga0466724_10805 | 3300042649 | Unclassified | 2081 |
| 173 | Ga0466708_066300 | 3300042652 | Bacteria | 36627 |
| 174 | Ga0466727_196550 | 3300042655 | Bacteria | 5583 |
| 175 | Ga0160446_100001 | 3300012835 | Bacteria | 625222 |
| 176 | Ga0466657_018783 | 3300042582 | Bacteria | 1408 |
| 177 | Ga0466691_033852 | 3300042593 | Bacteria | 11172 |
| 178 | Ga0466694_388110 | 3300042594 | Bacteria | 1375 |
| 179 | Ga0466696_053612 | 3300042596 | Bacteria | 7089 |
| 180 | Ga0466713_156835 | 3300042602 | Bacteria | 2930 |
| 181 | Ga0466714_111320 | 3300042603 | Bacteria | 185233 |
| 182 | Ga0466716_317780 | 3300042605 | Bacteria | 2050 |
| 183 | Ga0466720_160767 | 3300042607 | Bacteria | 1024 |
| 184 | Ga0466722_104348 | 3300042609 | Bacteria | 5118 |
| 185 | Ga0466705_154185 | 3300042612 | Bacteria | 4715 |
| 186 | Ga0466727_351952 | 3300042655 | Bacteria | 33342 |
| 187 | Ga0466733_174663 | 3300042659 | Bacteria | 24320 |
| 188 | Ga0104045_1003465 | 3300007085 | Bacteria | 3876 |
| 189 | Ga0466711_483677 | 3300042615 | Bacteria | 2037 |
| 190 | Ga0466715_239786 | 3300042616 | Bacteria | 13840 |
| 191 | Ga0466723_004496 | 3300042618 | Bacteria | 7998 |
| 192 | Ga0466723_060434 | 3300042618 | Bacteria | 19796 |
| 193 | Ga0466723_274307 | 3300042618 | Unclassified | 2586 |
| 194 | Ga0123353_10094925 | 3300010167 | Bacteria | 4805 |
| 195 | Ga0123353_10616869 | 3300010167 | Bacteria | 1546 |
| 196 | Ga0466703_017988 | 3300042636 | Bacteria | 8088 |
| 197 | Ga0466703_193906 | 3300042636 | Bacteria | 13353 |
| 198 | Ga0466704_287840 | 3300042643 | Bacteria | 8466 |
| 199 | Ga0466704_375024 | 3300042643 | Bacteria | 17873 |
| 200 | Ga0466727_011393 | 3300042655 | Bacteria | 3964 |
| 201 | Ga0466727_019825 | 3300042655 | Bacteria | 16582 |
| 202 | Ga0160453_100226 | 3300012814 | Bacteria | 54682 |
| 203 | Ga0160444_100978 | 3300012841 | Bacteria | 7116 |
| 204 | Ga0160433_100067 | 3300012846 | Bacteria | 112579 |
| 205 | Ga0160433_100205 | 3300012846 | Bacteria | 46543 |
| 206 | Ga0466693_258385 | 3300042592 | Bacteria | 1283 |
| 207 | Ga0466691_081188 | 3300042593 | Bacteria | 1642 |
| 208 | Ga0466696_042333 | 3300042596 | Bacteria | 20220 |
| 209 | Ga0466696_210690 | 3300042596 | Bacteria | 2690 |
| 210 | Ga0466696_468029 | 3300042596 | Bacteria | 21396 |
| 211 | Ga0466707_253044 | 3300042601 | Bacteria | 4303 |
| 212 | Ga0466717_167537 | 3300042604 | Bacteria | 1074 |
| 213 | Ga0466722_040785 | 3300042609 | Bacteria | 21885 |
| 214 | Ga0466722_121135 | 3300042609 | Bacteria | 11462 |
| 215 | 2227499637 | 2225789004 | Bacteria | 19389 |
| 216 | IMNBL1DRAFT_c0002452 | 3300000062 | Bacteria | 12900 |
| 217 | CVPL010W_10000093 | 3300002931 | Bacteria | 63242 |
| 218 | Ga0104050_1002449 | 3300007153 | Bacteria | 11607 |
| 219 | Ga0104050_1031738 | 3300007153 | Unclassified | 4090 |
| 220 | Ga0466711_039975 | 3300042615 | Bacteria | 2662 |
| 221 | Ga0466715_320122 | 3300042616 | Bacteria | 8709 |
| 222 | Ga0466726_278784 | 3300042619 | Bacteria | 3184 |
| 223 | Ga0466728_063512 | 3300042620 | Bacteria | 17946 |
| 224 | Ga0466735_119800 | 3300042624 | Bacteria | 1445 |
| 225 | Ga0466704_046977 | 3300042643 | Bacteria | 19141 |
| 226 | Ga0466709_229045 | 3300042648 | Bacteria | 12197 |
| 227 | Ga0466709_402391 | 3300042648 | Bacteria | 2631 |
| 228 | Ga0160435_1000011 | 3300012857 | Bacteria | 218385 |
| 229 | Ga0160436_1031540 | 3300012861 | Unclassified | 899 |
| 230 | Ga0466690_051060 | 3300042590 | Bacteria | 5615 |
| 231 | Ga0466690_146168 | 3300042590 | Bacteria | 9301 |
| 232 | Ga0466696_022318 | 3300042596 | Bacteria | 4749 |
| 233 | Ga0466696_056325 | 3300042596 | Archaea | 2458 |
| 234 | Ga0466701_074981 | 3300042598 | Unclassified | 6242 |
| 235 | Ga0466707_211840 | 3300042601 | Bacteria | 2216 |
| 236 | Ga0466713_007597 | 3300042602 | Bacteria | 1041 |
| 237 | Ga0466713_063729 | 3300042602 | Bacteria | 12002 |
| 238 | Ga0466713_128661 | 3300042602 | Bacteria | 1291 |
| 239 | Ga0466716_244033 | 3300042605 | Bacteria | 1213 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042593 | Ga0466691_033852 | Ga0466691_033852_4842_5348 | 168 |
| 2 | 3300042611 | Ga0466697_127742 | Ga0466697_127742_608_1117 | 169 |
| 3 | 3300042596 | Ga0466696_056325 | Ga0466696_056325_1568_2080 | 170 |
| 4 | 3300042602 | Ga0466713_007597 | Ga0466713_007597_132_698 | 179 |
| 5 | 3300042590 | Ga0466690_051060 | Ga0466690_051060_1087_1629 | 180 |
| 6 | 3300007153 | Ga0104050_1031738 | Ga0104050_10317383 | 181 |
| 7 | 3300042596 | Ga0466696_033740 | Ga0466696_033740_1516_2097 | 182 |
| 8 | 3300042598 | Ga0466701_060991 | Ga0466701_060991_11015_11575 | 186 |
| 9 | 3300042601 | Ga0466707_146540 | Ga0466707_146540_3222_3782 | 186 |
| 10 | 3300042624 | Ga0466735_210636 | Ga0466735_210636_2434_2994 | 186 |
| 11 | 3300007143 | Ga0104048_1002207 | Ga0104048_10022076 | 187 |
| 12 | 3300007143 | Ga0104048_1184356 | Ga0104048_11843562 | 187 |
| 13 | 3300007150 | Ga0104019_1002611 | Ga0104019_10026112 | 187 |
| 14 | 3300007150 | Ga0104019_1004048 | Ga0104019_10040484 | 187 |
| 15 | 3300042590 | Ga0466690_009119 | Ga0466690_009119_5936_6499 | 187 |
| 16 | 3300042593 | Ga0466691_081188 | Ga0466691_081188_468_1031 | 187 |
| 17 | 3300042596 | Ga0466696_210690 | Ga0466696_210690_1670_2233 | 187 |
| 18 | 3300042596 | Ga0466696_253210 | Ga0466696_253210_116468_117031 | 187 |
| 19 | 3300042602 | Ga0466713_063729 | Ga0466713_063729_5760_6323 | 187 |
| 20 | 3300042606 | Ga0466719_440976 | Ga0466719_440976_202_765 | 187 |
| 21 | 3300042612 | Ga0466705_062779 | Ga0466705_062779_1286_1849 | 187 |
| 22 | 3300042612 | Ga0466705_202926 | Ga0466705_202926_15495_16058 | 187 |
| 23 | 3300042615 | Ga0466711_246719 | Ga0466711_246719_14994_15557 | 187 |
| 24 | 3300042616 | Ga0466715_092462 | Ga0466715_092462_10703_11266 | 187 |
| 25 | 3300042616 | Ga0466715_239786 | Ga0466715_239786_5176_5739 | 187 |
| 26 | 3300042620 | Ga0466728_147328 | Ga0466728_147328_2417_2980 | 187 |
| 27 | 3300042620 | Ga0466728_410703 | Ga0466728_410703_3335_3898 | 187 |
| 28 | 3300042636 | Ga0466703_089300 | Ga0466703_089300_1051_1614 | 187 |
| 29 | 3300042636 | Ga0466703_104739 | Ga0466703_104739_3906_4469 | 187 |
| 30 | 3300042636 | Ga0466703_127121 | Ga0466703_127121_2260_2823 | 187 |
| 31 | 3300042643 | Ga0466704_072309 | Ga0466704_072309_5634_6197 | 187 |
| 32 | iso_pr_bacteria | 2590828803 | 2592928395 | 187 |
| 33 | 2225789004 | 2227138327 | 2227539182 | 188 |
| 34 | 2225789004 | 2227499637 | 2227981033 | 188 |
| 35 | 3300002462 | JGI24702J35022_10063217 | JGI24702J35022_100632172 | 188 |
| 36 | 3300005083 | Ga0068305_10126352 | Ga0068305_101263525 | 188 |
| 37 | 3300005201 | Ga0072941_1492302 | Ga0072941_14923022 | 188 |
| 38 | 3300012837 | Ga0160455_100119 | Ga0160455_10011928 | 188 |
| 39 | 3300012846 | Ga0160433_100067 | Ga0160433_10006726 | 188 |
| 40 | 3300042590 | Ga0466690_015343 | Ga0466690_015343_5540_6106 | 188 |
| 41 | 3300042590 | Ga0466690_216593 | Ga0466690_216593_3726_4292 | 188 |
| 42 | 3300042593 | Ga0466691_167802 | Ga0466691_167802_3298_3864 | 188 |
| 43 | 3300042597 | Ga0466699_066155 | Ga0466699_066155_150_716 | 188 |
| 44 | 3300042601 | Ga0466707_065750 | Ga0466707_065750_4446_5012 | 188 |
| 45 | 3300042601 | Ga0466707_211840 | Ga0466707_211840_63_629 | 188 |
| 46 | 3300042601 | Ga0466707_219452 | Ga0466707_219452_2946_3512 | 188 |
| 47 | 3300042602 | Ga0466713_156835 | Ga0466713_156835_2026_2592 | 188 |
| 48 | 3300042605 | Ga0466716_059223 | Ga0466716_059223_4867_5433 | 188 |
| 49 | 3300042605 | Ga0466716_115117 | Ga0466716_115117_3509_4075 | 188 |
| 50 | 3300042605 | Ga0466716_244033 | Ga0466716_244033_485_1051 | 188 |
| 51 | 3300042605 | Ga0466716_317780 | Ga0466716_317780_1327_1893 | 188 |
| 52 | 3300042606 | Ga0466719_335349 | Ga0466719_335349_4798_5364 | 188 |
| 53 | 3300042606 | Ga0466719_362367 | Ga0466719_362367_1314_1880 | 188 |
| 54 | 3300042609 | Ga0466722_086349 | Ga0466722_086349_5249_5815 | 188 |
| 55 | 3300042612 | Ga0466705_019926 | Ga0466705_019926_2256_2822 | 188 |
| 56 | 3300042614 | Ga0466712_213057 | Ga0466712_213057_179_745 | 188 |
| 57 | 3300042615 | Ga0466711_002735 | Ga0466711_002735_4511_5077 | 188 |
| 58 | 3300042615 | Ga0466711_088592 | Ga0466711_088592_3479_4045 | 188 |
| 59 | 3300042616 | Ga0466715_320122 | Ga0466715_320122_7881_8447 | 188 |
| 60 | 3300042616 | Ga0466715_634151 | Ga0466715_634151_539_1105 | 188 |
| 61 | 3300042618 | Ga0466723_005656 | Ga0466723_005656_4582_5148 | 188 |
| 62 | 3300042618 | Ga0466723_060434 | Ga0466723_060434_3860_4426 | 188 |
| 63 | 3300042618 | Ga0466723_274307 | Ga0466723_274307_768_1334 | 188 |
| 64 | 3300042618 | Ga0466723_346543 | Ga0466723_346543_15065_15631 | 188 |
| 65 | 3300042619 | Ga0466726_056753 | Ga0466726_056753_1758_2324 | 188 |
| 66 | 3300042619 | Ga0466726_278784 | Ga0466726_278784_40_606 | 188 |
| 67 | 3300042619 | Ga0466726_322858 | Ga0466726_322858_608_1174 | 188 |
| 68 | 3300042619 | Ga0466726_417570 | Ga0466726_417570_1294_1860 | 188 |
| 69 | 3300042620 | Ga0466728_021081 | Ga0466728_021081_1373_1939 | 188 |
| 70 | 3300042624 | Ga0466735_151877 | Ga0466735_151877_1320_1886 | 188 |
| 71 | 3300042636 | Ga0466703_107170 | Ga0466703_107170_862_1428 | 188 |
| 72 | 3300042636 | Ga0466703_286689 | Ga0466703_286689_5447_6013 | 188 |
| 73 | 3300042643 | Ga0466704_046977 | Ga0466704_046977_12249_12815 | 188 |
| 74 | 3300042643 | Ga0466704_078568 | Ga0466704_078568_1956_2522 | 188 |
| 75 | 3300042643 | Ga0466704_182716 | Ga0466704_182716_5021_5587 | 188 |
| 76 | 3300042648 | Ga0466709_317083 | Ga0466709_317083_6244_6810 | 188 |
| 77 | 3300042652 | Ga0466708_135441 | Ga0466708_135441_13859_14425 | 188 |
| 78 | 3300042654 | Ga0466725_059721 | Ga0466725_059721_788_1354 | 188 |
| 79 | 3300042655 | Ga0466727_011393 | Ga0466727_011393_2264_2830 | 188 |
| 80 | 3300042655 | Ga0466727_127655 | Ga0466727_127655_7327_7893 | 188 |
| 81 | 3300042655 | Ga0466727_218108 | Ga0466727_218108_2098_2664 | 188 |
| 82 | 3300042659 | Ga0466733_170029 | Ga0466733_170029_21609_22175 | 188 |
| 83 | iso_pr_bacteria | 2864836148 | 2864839557 | 188 |
| 84 | iso_pr_bacteria | 2864878056 | 2864879644 | 188 |
| 85 | iso_pr_bacteria | 2864886855 | 2864888445 | 188 |
| 86 | iso_pr_bacteria | 2904728850 | 2904730270 | 188 |
| 87 | iso_pr_bacteria | 2958471994 | 2958473080 | 188 |
| 88 | iso_pr_bacteria | 8065497608 | 8065498915 | 188 |
| 89 | 2225789003 | 2226991477 | 2227341668 | 189 |
| 90 | 2225789003 | 2227005365 | 2227361036 | 189 |
| 91 | 3300000062 | IMNBL1DRAFT_c0002452 | IMNBL1DRAFT_000245215 | 189 |
| 92 | 3300000062 | IMNBL1DRAFT_c0004122 | IMNBL1DRAFT_00041228 | 189 |
| 93 | 3300000062 | IMNBL1DRAFT_c0051141 | IMNBL1DRAFT_00511412 | 189 |
| 94 | 3300005071 | Ga0068302_10068558 | Ga0068302_100685585 | 189 |
| 95 | 3300005071 | Ga0068302_10102124 | Ga0068302_101021244 | 189 |
| 96 | 3300005200 | Ga0072940_1198352 | Ga0072940_11983522 | 189 |
| 97 | 3300012820 | Ga0160456_100015 | Ga0160456_10001554 | 189 |
| 98 | 3300012858 | Ga0160457_1011524 | Ga0160457_10115241 | 189 |
| 99 | 3300042591 | Ga0466692_004720 | Ga0466692_004720_17688_18257 | 189 |
| 100 | 3300042594 | Ga0466694_388110 | Ga0466694_388110_690_1259 | 189 |
| 101 | 3300042596 | Ga0466696_017034 | Ga0466696_017034_5686_6255 | 189 |
| 102 | 3300042596 | Ga0466696_042333 | Ga0466696_042333_4131_4700 | 189 |
| 103 | 3300042596 | Ga0466696_053612 | Ga0466696_053612_649_1218 | 189 |
| 104 | 3300042596 | Ga0466696_140797 | Ga0466696_140797_3315_3884 | 189 |
| 105 | 3300042596 | Ga0466696_310383 | Ga0466696_310383_232_801 | 189 |
| 106 | 3300042598 | Ga0466701_097399 | Ga0466701_097399_59024_59593 | 189 |
| 107 | 3300042601 | Ga0466707_253044 | Ga0466707_253044_2916_3485 | 189 |
| 108 | 3300042605 | Ga0466716_056980 | Ga0466716_056980_701_1270 | 189 |
| 109 | 3300042605 | Ga0466716_073619 | Ga0466716_073619_1350_1919 | 189 |
| 110 | 3300042605 | Ga0466716_172046 | Ga0466716_172046_2071_2640 | 189 |
| 111 | 3300042606 | Ga0466719_520451 | Ga0466719_520451_1380_1949 | 189 |
| 112 | 3300042610 | Ga0466698_405024 | Ga0466698_405024_1455_2024 | 189 |
| 113 | 3300042612 | Ga0466705_009779 | Ga0466705_009779_1945_2514 | 189 |
| 114 | 3300042612 | Ga0466705_095082 | Ga0466705_095082_2866_3435 | 189 |
| 115 | 3300042612 | Ga0466705_154185 | Ga0466705_154185_1582_2151 | 189 |
| 116 | 3300042615 | Ga0466711_039975 | Ga0466711_039975_435_1004 | 189 |
| 117 | 3300042615 | Ga0466711_060306 | Ga0466711_060306_3105_3674 | 189 |
| 118 | 3300042615 | Ga0466711_139999 | Ga0466711_139999_2092_2661 | 189 |
| 119 | 3300042615 | Ga0466711_483677 | Ga0466711_483677_158_727 | 189 |
| 120 | 3300042616 | Ga0466715_045342 | Ga0466715_045342_4540_5109 | 189 |
| 121 | 3300042616 | Ga0466715_332864 | Ga0466715_332864_3726_4295 | 189 |
| 122 | 3300042616 | Ga0466715_471970 | Ga0466715_471970_15982_16551 | 189 |
| 123 | 3300042618 | Ga0466723_004496 | Ga0466723_004496_4813_5382 | 189 |
| 124 | 3300042618 | Ga0466723_266272 | Ga0466723_266272_8156_8725 | 189 |
| 125 | 3300042619 | Ga0466726_011106 | Ga0466726_011106_397_966 | 189 |
| 126 | 3300042619 | Ga0466726_335684 | Ga0466726_335684_1154_1723 | 189 |
| 127 | 3300042619 | Ga0466726_375253 | Ga0466726_375253_31_600 | 189 |
| 128 | 3300042620 | Ga0466728_060040 | Ga0466728_060040_10297_10866 | 189 |
| 129 | 3300042620 | Ga0466728_138171 | Ga0466728_138171_44829_45398 | 189 |
| 130 | 3300042620 | Ga0466728_156870 | Ga0466728_156870_22689_23258 | 189 |
| 131 | 3300042624 | Ga0466735_119800 | Ga0466735_119800_440_1009 | 189 |
| 132 | 3300042624 | Ga0466735_220934 | Ga0466735_220934_8255_8824 | 189 |
| 133 | 3300042636 | Ga0466703_017988 | Ga0466703_017988_2646_3215 | 189 |
| 134 | 3300042636 | Ga0466703_193906 | Ga0466703_193906_5711_6280 | 189 |
| 135 | 3300042648 | Ga0466709_229045 | Ga0466709_229045_4965_5534 | 189 |
| 136 | 3300042648 | Ga0466709_262984 | Ga0466709_262984_4174_4743 | 189 |
| 137 | 3300042648 | Ga0466709_402391 | Ga0466709_402391_1393_1962 | 189 |
| 138 | 3300042652 | Ga0466708_041887 | Ga0466708_041887_4614_5183 | 189 |
| 139 | 3300042655 | Ga0466727_019825 | Ga0466727_019825_6391_6960 | 189 |
| 140 | 3300042655 | Ga0466727_179577 | Ga0466727_179577_1080_1649 | 189 |
| 141 | 3300042659 | Ga0466733_174663 | Ga0466733_174663_18207_18776 | 189 |
| 142 | iso_pr_bacteria | 2718218155 | 2720330343 | 189 |
| 143 | iso_pr_bacteria | 2940195863 | 2940196169 | 189 |
| 144 | iso_pr_bacteria | 2940205530 | 2940209086 | 189 |
| 145 | iso_pr_bacteria | 2940212447 | 2940216001 | 189 |
| 146 | iso_pr_bacteria | 2940298504 | 2940302054 | 189 |
| 147 | iso_pr_bacteria | 2940302308 | 2940305840 | 189 |
| 148 | iso_pr_bacteria | 2940306115 | 2940308739 | 189 |
| 149 | iso_pr_bacteria | 2940309933 | 2940312577 | 189 |
| 150 | iso_pr_bacteria | 2940313741 | 2940316390 | 189 |
| 151 | iso_pr_bacteria | 2940317558 | 2940320096 | 189 |
| 152 | iso_pr_bacteria | 2940321370 | 2940323851 | 189 |
| 153 | iso_pr_bacteria | 2940325180 | 2940328727 | 189 |
| 154 | iso_pr_bacteria | 2940328985 | 2940332536 | 189 |
| 155 | iso_pr_bacteria | 2940332795 | 2940335332 | 189 |
| 156 | 3300000062 | IMNBL1DRAFT_c0001897 | IMNBL1DRAFT_000189714 | 190 |
| 157 | 3300000062 | IMNBL1DRAFT_c0004236 | IMNBL1DRAFT_00042366 | 190 |
| 158 | 3300005200 | Ga0072940_1162228 | Ga0072940_11622282 | 190 |
| 159 | 3300007085 | Ga0104045_1016806 | Ga0104045_10168062 | 190 |
| 160 | 3300007129 | Ga0102734_1000640 | Ga0102734_10006403 | 190 |
| 161 | 3300042590 | Ga0466690_009130 | Ga0466690_009130_4058_4630 | 190 |
| 162 | 3300042590 | Ga0466690_041158 | Ga0466690_041158_4885_5457 | 190 |
| 163 | 3300042592 | Ga0466693_258385 | Ga0466693_258385_643_1215 | 190 |
| 164 | 3300042593 | Ga0466691_034694 | Ga0466691_034694_1682_2254 | 190 |
| 165 | 3300042596 | Ga0466696_359729 | Ga0466696_359729_3236_3808 | 190 |
| 166 | 3300042601 | Ga0466707_387304 | Ga0466707_387304_308_880 | 190 |
| 167 | 3300042602 | Ga0466713_128661 | Ga0466713_128661_355_927 | 190 |
| 168 | 3300042604 | Ga0466717_167537 | Ga0466717_167537_125_697 | 190 |
| 169 | 3300042605 | Ga0466716_425991 | Ga0466716_425991_453_1025 | 190 |
| 170 | 3300042606 | Ga0466719_256888 | Ga0466719_256888_1462_2034 | 190 |
| 171 | 3300042607 | Ga0466720_160767 | Ga0466720_160767_298_870 | 190 |
| 172 | 3300042609 | Ga0466722_104348 | Ga0466722_104348_168_740 | 190 |
| 173 | 3300042615 | Ga0466711_000292 | Ga0466711_000292_2652_3224 | 190 |
| 174 | 3300042616 | Ga0466715_628507 | Ga0466715_628507_4238_4810 | 190 |
| 175 | 3300042618 | Ga0466723_049435 | Ga0466723_049435_152_724 | 190 |
| 176 | 3300042618 | Ga0466723_149172 | Ga0466723_149172_8181_8753 | 190 |
| 177 | 3300042620 | Ga0466728_047470 | Ga0466728_047470_1829_2401 | 190 |
| 178 | 3300042621 | Ga0466729_261901 | Ga0466729_261901_3672_4244 | 190 |
| 179 | 3300042649 | Ga0466724_06985 | Ga0466724_06985_43612_44184 | 190 |
| 180 | 3300042649 | Ga0466724_39249 | Ga0466724_39249_5917_6489 | 190 |
| 181 | iso_pr_bacteria | 2579779088 | 2582236623 | 190 |
| 182 | iso_pr_bacteria | 2896321640 | 2896324963 | 190 |
| 183 | iso_pr_bacteria | 2896330536 | 2896333407 | 190 |
| 184 | iso_pr_bacteria | 2896350215 | 2896353264 | 190 |
| 185 | iso_pr_bacteria | 2898741527 | 2898744548 | 190 |
| 186 | iso_pr_bacteria | 3002026254 | 3002026463 | 190 |
| 187 | iso_pr_bacteria | 3002028123 | 3002028343 | 190 |
| 188 | 3300007085 | Ga0104045_1082238 | Ga0104045_10822382 | 191 |
| 189 | 3300009784 | Ga0123357_10004506 | Ga0123357_1000450610 | 191 |
| 190 | 3300012828 | Ga0160431_100285 | Ga0160431_1002852 | 191 |
| 191 | 3300042596 | Ga0466696_022318 | Ga0466696_022318_2577_3152 | 191 |
| 192 | 3300042598 | Ga0466701_060315 | Ga0466701_060315_409_984 | 191 |
| 193 | 3300042598 | Ga0466701_096150 | Ga0466701_096150_15401_15976 | 191 |
| 194 | 3300042609 | Ga0466722_023509 | Ga0466722_023509_3707_4282 | 191 |
| 195 | 3300042609 | Ga0466722_121135 | Ga0466722_121135_7301_7876 | 191 |
| 196 | 3300042617 | Ga0466718_108197 | Ga0466718_108197_111_686 | 191 |
| 197 | 3300042620 | Ga0466728_374388 | Ga0466728_374388_9105_9680 | 191 |
| 198 | 3300042625 | Ga0466730_009837 | Ga0466730_009837_243467_244042 | 191 |
| 199 | 3300042643 | Ga0466704_287840 | Ga0466704_287840_3372_3947 | 191 |
| 200 | 3300042643 | Ga0466704_375024 | Ga0466704_375024_7614_8189 | 191 |
| 201 | 3300042649 | Ga0466724_10805 | Ga0466724_10805_1462_2037 | 191 |
| 202 | iso_pr_bacteria | 2882250448 | 2882251757 | 191 |
| 203 | iso_pr_bacteria | 2940199050 | 2940201879 | 191 |
| 204 | iso_pr_bacteria | 2940346213 | 2940348943 | 191 |
| 205 | 3300007080 | Ga0102735_1000879 | Ga0102735_10008792 | 192 |
| 206 | 3300007085 | Ga0104045_1003465 | Ga0104045_10034653 | 192 |
| 207 | 3300007085 | Ga0104045_1005457 | Ga0104045_10054578 | 192 |
| 208 | 3300007153 | Ga0104050_1002449 | Ga0104050_10024496 | 192 |
| 209 | 3300012806 | Ga0160442_100009 | Ga0160442_100009151 | 192 |
| 210 | 3300042591 | Ga0466692_135295 | Ga0466692_135295_668_1246 | 192 |
| 211 | 3300042598 | Ga0466701_037660 | Ga0466701_037660_19227_19805 | 192 |
| 212 | 3300042602 | Ga0466713_087763 | Ga0466713_087763_190_768 | 192 |
| 213 | 3300042609 | Ga0466722_040785 | Ga0466722_040785_20886_21464 | 192 |
| 214 | 3300042609 | Ga0466722_052959 | Ga0466722_052959_8217_8795 | 192 |
| 215 | 3300042652 | Ga0466708_066300 | Ga0466708_066300_5674_6252 | 192 |
| 216 | iso_pr_bacteria | 2923982719 | 2923983038 | 192 |
| 217 | iso_pr_bacteria | 2940371297 | 2940373257 | 192 |
| 218 | iso_pr_bacteria | 3002006476 | 3002006696 | 192 |
| 219 | iso_pr_bacteria | 3002022645 | 3002022855 | 192 |
| 220 | 3300002931 | CVPL010W_10000093 | CVPL010W_1000009342 | 193 |
| 221 | 3300005083 | Ga0068305_10040460 | Ga0068305_100404603 | 193 |
| 222 | 3300007085 | Ga0104045_1002750 | Ga0104045_10027505 | 193 |
| 223 | 3300007143 | Ga0104048_1169210 | Ga0104048_11692102 | 193 |
| 224 | 3300010167 | Ga0123353_10094925 | Ga0123353_100949254 | 193 |
| 225 | 3300012858 | Ga0160457_1001699 | Ga0160457_10016994 | 193 |
| 226 | 3300042596 | Ga0466696_468029 | Ga0466696_468029_1534_2115 | 193 |
| 227 | 3300042605 | Ga0466716_101528 | Ga0466716_101528_3162_3743 | 193 |
| 228 | 3300042609 | Ga0466722_029126 | Ga0466722_029126_6741_7322 | 193 |
| 229 | 3300042620 | Ga0466728_063512 | Ga0466728_063512_15025_15606 | 193 |
| 230 | iso_pr_bacteria | 2899132286 | 2899133893 | 193 |
| 231 | iso_pr_bacteria | 3002025161 | 3002025366 | 193 |
| 232 | 3300007042 | Ga0103263_110000 | Ga0103263_1100002 | 194 |
| 233 | 3300012835 | Ga0160446_100001 | Ga0160446_100001268 | 194 |
| 234 | 3300012839 | Ga0160472_101233 | Ga0160472_1012334 | 194 |
| 235 | 3300012847 | Ga0160445_100097 | Ga0160445_10009745 | 194 |
| 236 | 3300012857 | Ga0160435_1000011 | Ga0160435_1000011149 | 194 |
| 237 | 3300012861 | Ga0160436_1031540 | Ga0160436_10315402 | 194 |
| 238 | 3300042582 | Ga0466657_018783 | Ga0466657_018783_109_693 | 194 |
| 239 | 3300042598 | Ga0466701_044550 | Ga0466701_044550_8666_9250 | 194 |
| 240 | 3300042598 | Ga0466701_074981 | Ga0466701_074981_1864_2448 | 194 |
| 241 | 3300042612 | Ga0466705_271306 | Ga0466705_271306_3287_3871 | 194 |
| 242 | 3300042655 | Ga0466727_196550 | Ga0466727_196550_1012_1596 | 194 |
| 243 | 3300007140 | Ga0102740_1002860 | Ga0102740_10028602 | 195 |
| 244 | 3300007143 | Ga0104048_1022506 | Ga0104048_10225063 | 195 |
| 245 | 3300007150 | Ga0104019_1000350 | Ga0104019_10003503 | 195 |
| 246 | 3300012819 | Ga0160468_100065 | Ga0160468_10006510 | 195 |
| 247 | 3300012824 | Ga0160469_100036 | Ga0160469_10003647 | 195 |
| 248 | 3300012824 | Ga0160469_101864 | Ga0160469_1018644 | 195 |
| 249 | 3300012841 | Ga0160444_100978 | Ga0160444_1009786 | 195 |
| 250 | 3300012845 | Ga0160460_100013 | Ga0160460_10001366 | 195 |
| 251 | 3300012846 | Ga0160433_100205 | Ga0160433_10020511 | 195 |
| 252 | 3300012846 | Ga0160433_100528 | Ga0160433_1005289 | 195 |
| 253 | 3300012858 | Ga0160457_1013616 | Ga0160457_10136162 | 195 |
| 254 | 3300042615 | Ga0466711_039476 | Ga0466711_039476_4145_4732 | 195 |
| 255 | 3300042617 | Ga0466718_129503 | Ga0466718_129503_191_778 | 195 |
| 256 | 3300042636 | Ga0466703_229514 | Ga0466703_229514_1338_1925 | 195 |
| 257 | 3300042643 | Ga0466704_521025 | Ga0466704_521025_2046_2633 | 195 |
| 258 | 3300042649 | Ga0466724_34099 | Ga0466724_34099_15473_16060 | 195 |
| 259 | iso_pr_bacteria | 2873776654 | 2873779003 | 195 |
| 260 | 3300005320 | Ga0074317_1137103 | Ga0074317_11371032 | 196 |
| 261 | 3300012825 | Ga0160441_100026 | Ga0160441_100026213 | 197 |
| 262 | 3300042609 | Ga0466722_157787 | Ga0466722_157787_2898_3494 | 198 |
| 263 | 3300012814 | Ga0160453_100226 | Ga0160453_10022631 | 199 |
| 264 | 3300042590 | Ga0466690_146168 | Ga0466690_146168_4762_5361 | 199 |
| 265 | 3300042596 | Ga0466696_394191 | Ga0466696_394191_3482_4081 | 199 |
| 266 | 3300010167 | Ga0123353_10092708 | Ga0123353_100927083 | 200 |
| 267 | 3300042636 | Ga0466703_084181 | Ga0466703_084181_2774_3379 | 201 |
| 268 | 3300010167 | Ga0123353_10616869 | Ga0123353_106168692 | 202 |
| 269 | 3300042606 | Ga0466719_549364 | Ga0466719_549364_800_1408 | 202 |
| 270 | iso_pr_bacteria | 3001995955 | 3001996157 | 202 |
| 271 | 3300042655 | Ga0466727_351952 | Ga0466727_351952_9431_10045 | 204 |
| 272 | 3300042590 | Ga0466690_102107 | Ga0466690_102107_289_909 | 206 |
| 273 | 3300042606 | Ga0466719_059687 | Ga0466719_059687_1870_2490 | 206 |
| 274 | 3300042616 | Ga0466715_256528 | Ga0466715_256528_16130_16750 | 206 |
| 275 | 3300042603 | Ga0466714_111320 | Ga0466714_111320_113001_113627 | 208 |
| 276 | 3300005200 | Ga0072940_1136793 | Ga0072940_11367932 | 212 |
| 277 | 3300042623 | Ga0466734_139753 | Ga0466734_139753_11722_12369 | 215 |
| 278 | 3300012837 | Ga0160455_100023 | Ga0160455_100023275 | 216 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07722 | GO:0016787 | hydrolase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.