Protein Family IF08686

Metagenome Isolate
235 Members
186 Samples
123 Scaffolds
253.08 Avg Length

🧬 Representative Sequence

ID
3300042623|Ga0466734_108061|Ga0466734_108061_2267_3130
Length
287 aa
Sequence
MVFQCADNGGVASSFLGGFSRTIEDGLTEISMVSNVVVAIPSRYSASRLPGKPLRLLAGEPLIVHVVRRALEAQPCEVWVATDDARIGDILSTSGARVAMTSGEHASGTDRLAECADIAGWADDTIVVNLQGDEPFAPASGIRAVTEALTNSRAEMATLAEPIFDTAILFDPNTVKVVRTTTGEALYFSRAPIPWHRDDFARGEQTLSLAGEWLRHIGIYAYRAGFLRRFTKMPPSRLERIESLEQLRVLEAGLPISVALSPEPFPPGVDTEKDLAHAEIYLQERIR

📊 Sample Types

Isolate 47.7%
Metagenome 52.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.1%
Formicidae 9.3%
Termitidae 8.1%
Apidae 5.8%
Elmidae 4.1%
Armadillidiidae 4.1%
Culicidae 4.1%
Curculionidae 3.5%
Kalotermitidae 3.5%
Sarcophagidae 2.3%
Talitridae 1.7%
Palinuridae 1.7%
Drosophilidae 1.7%
Aphididae 1.2%
Termopsidae 1.2%
Majidae 1.2%
Penaeidae 0.6%
Rhinotermitidae 0.6%
Siricidae 0.6%
Passalidae 0.6%
Calliphoridae 0.6%
Cixiidae 0.6%
Stratiomyidae 0.6%
Artemiidae 0.6%
Kiwaidae 0.6%
Trigoniulidae 0.6%
Nephropidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 225
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
2 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
3 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
4 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
5 2684622551 Vibrio campbellii E1 Isolate Unclassified
6 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
7 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
8 2864791955 Aeromonas veronii S00030 Isolate Elmidae
9 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
10 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
11 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
12 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
13 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
14 8022096067 Vibrio sp. SALL6 Isolate Unclassified
15 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
16 8051461712 Vibrio vulnificus Vv002 Isolate
17 8060845732 Vibrio vulnificus Vv006 Isolate
18 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
21 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
22 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
23 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
24 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
25 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
26 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 2515154034 Frischella perrara PEB0191 Isolate Apidae
32 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
33 2630968947 Frischella perrara PEB0191 Isolate Apidae
34 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
35 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
36 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
37 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
38 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
39 2868506828 Gilliamella apicola App4-10 Isolate Apidae
40 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
41 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
42 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
43 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
44 8100461708 Delftia sp. S65 Isolate Curculionidae
45 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
46 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
49 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
50 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
51 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
52 2617270844 Dyella sp. HyOG Isolate Cixiidae
53 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
54 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
55 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
56 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
57 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
58 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
59 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
60 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
61 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
62 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
63 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
64 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
65 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
66 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
67 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
68 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
69 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
70 2850895757 Vibrio campbellii 170502 Isolate Unclassified
71 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
72 2872471378 Vibrio owensii V180403 Isolate Unclassified
73 2873636219 Gilliamella apicola App2-1 Isolate Apidae
74 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
75 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
76 8022087107 Vibrio sp. OULL4 Isolate Unclassified
77 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
78 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
79 3300000459 Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-C04 Metagenome Apidae
80 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
81 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
82 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
83 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
84 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
85 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
86 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
87 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
88 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
89 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
90 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
91 2554235022 Vibrio parahaemolyticus v110 Isolate
92 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
93 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
94 2912570088 Vibrio parahaemolyticus CHN25 Isolate
95 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
96 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
97 8051551332 Vibrio vulnificus Vv003 Isolate
98 8100449422 Delftia sp. S66 Isolate Curculionidae
99 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
100 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
101 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
102 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
103 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
104 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
105 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
106 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
107 2507262005 Candidatus Regiella insecticola R5.15 Isolate Aphididae
108 2511231129 Vibrio sp. EJY3 Isolate Unclassified
109 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
110 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
111 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
112 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
113 2831380896 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
114 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
115 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
116 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
117 2908136803 Vibrio owensii 1700302 Isolate Unclassified
118 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
119 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
120 640963010 Vibrio harveyi HY01 Isolate Unclassified
121 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
122 8022345672 Vibrio sp. 070316B Isolate Unclassified
123 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
124 8100455565 Delftia sp. S67 Isolate Curculionidae
125 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
126 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
127 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
128 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
129 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
130 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
131 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
132 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
133 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
134 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
135 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
136 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
137 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
138 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
139 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
140 2791355473 Vibrio barjaei 3062 Isolate Unclassified
141 2838140227 Dyella sp. OAE510 Isolate Unclassified
142 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
143 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
144 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
145 8051534459 Vibrio vulnificus Vv004 Isolate
146 8065340634 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
147 3000861951 Budvicia diplopodorum D9 Isolate
148 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
149 3006242587 Vibrio sp. RE86 Isolate Unclassified
150 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
151 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
152 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
153 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
154 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
155 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
156 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
157 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
158 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
159 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
160 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
161 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
162 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
163 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
164 2684622921 Frischella perrara Fp_167 Isolate Unclassified
165 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
166 2833532623 Frischella perrara ESL0167 Isolate Apidae
167 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
168 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
169 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
170 2864768727 Aeromonas veronii S00020 Isolate Elmidae
171 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
172 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
173 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
174 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
175 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
176 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
177 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
178 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
179 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
180 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
181 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
182 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
183 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
184 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
185 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
186 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_220026 3300042656 Bacteria 2532
2 Ga0466733_057310 3300042659 Bacteria 34943
3 Ga0160468_100404 3300012819 Unclassified 18457
4 Ga0160433_100171 3300012846 Bacteria 54254
5 Ga0160443_103971 3300012848 Bacteria 2373
6 Ga0160436_1000414 3300012861 Bacteria 17368
7 Ga0466657_387694 3300042582 Bacteria 6675
8 Ga0466710_155550 3300042613 Bacteria 3811
9 Ga0466730_005475 3300042625 Bacteria 83148
10 Ga0466701_091235 3300042598 Unclassified 45122
11 Ga0466713_051068 3300042602 Bacteria 7957
12 SWWA_contig06580__length_4136___numreads_64 2100351016 Unclassified 4136
13 CVPL010W_10000762 3300002931 Bacteria 59721
14 Ga0074278_110888 3300005721 Bacteria 159335
15 Ga0102734_1003806 3300007129 Bacteria 5798
16 Ga0103260_1000043 3300007139 Bacteria 38512
17 Ga0103264_1072327 3300007188 Bacteria 1489
18 Ga0123357_10000144 3300009784 Bacteria 62807
19 Ga0466733_121053 3300042659 Bacteria 7865
20 Ga0160443_100192 3300012848 Bacteria 80735
21 Ga0160447_101145 3300012849 Bacteria 10621
22 Ga0160448_100140 3300012854 Bacteria 34694
23 Ga0160448_100233 3300012854 Bacteria 22602
24 Ga0160457_1000037 3300012858 Bacteria 225688
25 Ga0466710_110693 3300042613 Bacteria 3212
26 Ga0466711_275755 3300042615 Bacteria 30959
27 Ga0466735_053348 3300042624 Bacteria 17300
28 Ga0160470_100042 3300012813 Bacteria 189457
29 Ga0466707_079738 3300042601 Bacteria 89147
30 Ga0466713_059751 3300042602 Bacteria 5524
31 Ga0103263_100027 3300007042 Bacteria 39471
32 Ga0160441_100091 3300012825 Bacteria 110104
33 Ga0160435_1000213 3300012857 Bacteria 28299
34 Ga0160457_1000055 3300012858 Bacteria 180671
35 Ga0157631_137351 3300013007 Bacteria 1144
36 Ga0466718_093490 3300042617 Bacteria 1968
37 Ga0466730_006615 3300042625 Bacteria 4959
38 Ga0466730_046718 3300042625 Bacteria 68019
39 Ga0466701_068336 3300042598 Bacteria 3437
40 Ga0466722_095049 3300042609 Bacteria 42286
41 SWWA_contig17289__length_2920___numreads_34 2100351016 Bacteria 2920
42 HBC_ctgsDRAFT_1000819 3300000333 Unclassified 6867
43 Ga0103266_1006769 3300007067 Bacteria 1430
44 Ga0102735_1000757 3300007080 Bacteria 7276
45 Ga0102735_1001751 3300007080 Unclassified 3558
46 Ga0102740_1003621 3300007140 Bacteria 3259
47 Ga0127656_100080 3300009453 Bacteria 57992
48 Ga0466705_021724 3300042612 Bacteria 82521
49 Ga0466705_053435 3300042612 Bacteria 27619
50 Ga0160467_101080 3300012829 Bacteria 14002
51 Ga0160459_100045 3300012831 Bacteria 207196
52 Ga0160444_101243 3300012841 Bacteria 5433
53 Ga0160430_110710 3300012852 Unclassified 1571
54 Ga0466657_012670 3300042582 Bacteria 6501
55 Ga0466657_368674 3300042582 Bacteria 1366
56 Ga0466710_034181 3300042613 Bacteria 1639
57 Ga0466715_181754 3300042616 Bacteria 79863
58 Ga0466726_083930 3300042619 Bacteria 23331
59 Ga0123356_10037525 3300010049 Bacteria 4520
60 Ga0466713_050606 3300042602 Bacteria 4796
61 gam1t_NODE_689636_length=159105_GC=32_4_Contigs=24 2189573031 Bacteria 159335
62 HBC_ctgsDRAFT_1000509 3300000333 Bacteria 8737
63 Ga0102736_1001481 3300007052 Bacteria 4108
64 Ga0102734_1000038 3300007129 Bacteria 44043
65 Ga0102738_1000771 3300007141 Bacteria 5119
66 Ga0160452_100101 3300012834 Bacteria 112536
67 Ga0160434_101100 3300012850 Bacteria 5394
68 Ga0466696_213027 3300042596 Bacteria 2199
69 Ga0466725_177809 3300042654 Bacteria 7689
70 Ga0123353_10486923 3300010167 Bacteria 1802
71 Ga0466722_241144 3300042609 Bacteria 18394
72 DPOL_contig09368 2035918003 Bacteria 1930
73 2227516023 2225789004 Bacteria 3444
74 Ga0068305_10097494 3300005083 Bacteria 4913
75 Ga0102740_1000011 3300007140 Bacteria 149332
76 Ga0102740_1003819 3300007140 Bacteria 3118
77 Ga0102737_1003389 3300007142 Unclassified 4446
78 Ga0103268_1005308 3300007192 Bacteria 2612
79 Ga0105524_104499 3300007733 Bacteria 2344
80 Ga0160440_100002 3300012815 Bacteria 1234951
81 Ga0160469_100019 3300012824 Bacteria 336789
82 Ga0160436_1000422 3300012861 Bacteria 17061
83 Ga0466701_004861 3300042598 Bacteria 162026
84 Ga0466730_065044 3300042625 Bacteria 1177
85 Ga0123353_10203128 3300010167 Bacteria 3115
86 Ga0466707_026244 3300042601 Bacteria 4991
87 Ga0466719_467287 3300042606 Bacteria 5727
88 Ga0102733_102278 3300006995 Bacteria 1220
89 Ga0102736_1000021 3300007052 Bacteria 92408
90 Ga0102739_1000147 3300007095 Bacteria 19720
91 Ga0316159_10001 3300030930 Bacteria 1642808
92 Ga0466710_266898 3300042613 Bacteria 30554
93 Ga0466734_108061 3300042623 Bacteria 6528
94 Ga0466725_063059 3300042654 Bacteria 42120
95 Ga0123356_10082051 3300010049 Unclassified 3052
96 Ga0123353_10130629 3300010167 Bacteria 4031
97 SWWA_contig31660__length_24037___numreads_1280 2100351016 Bacteria 24037
98 Ga0063521_1000254 3300003973 Bacteria 35495
99 Ga0068305_10245905 3300005083 Bacteria 2311
100 Ga0103261_1000024 3300007083 Bacteria 66582
101 Ga0103261_1000362 3300007083 Bacteria 9870
102 Ga0104042_1004536 3300007130 Bacteria 2788
103 Ga0103260_1003161 3300007139 Bacteria 2690
104 Ga0102738_1002807 3300007141 Bacteria 2580
105 Ga0104040_1001474 3300007149 Bacteria 2442
106 Ga0103264_1000010 3300007188 Bacteria 126108
107 Ga0466733_170684 3300042659 Bacteria 24962
108 Ga0160440_101523 3300012815 Bacteria 2953
109 Ga0160436_1000039 3300012861 Bacteria 73083
110 Ga0316159_12960 3300030930 Bacteria 2493
111 Ga0466657_338988 3300042582 Bacteria 1587
112 Ga0466710_111680 3300042613 Bacteria 2733
113 Ga0466723_092998 3300042618 Bacteria 7358
114 Ga0466735_229826 3300042624 Unclassified 3518
115 Ga0466724_02429 3300042649 Bacteria 9312
116 Ga0466701_069596 3300042598 Bacteria 1069
117 Ga0466713_038453 3300042602 Bacteria 47379
118 Ga0466717_015615 3300042604 Bacteria 5891
119 DPO_contig00939 2032320009 Bacteria 94479
120 SCG598C04_11372 3300000459 Unclassified 29013
121 Ga0102738_1000128 3300007141 Bacteria 21906
122 Ga0102737_1000112 3300007142 Bacteria 25685
123 Ga0103268_1001921 3300007192 Bacteria 4838

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007080 Ga0102735_1001751 Ga0102735_10017515 207
2 3300042617 Ga0466718_093490 Ga0466718_093490_1303_1944 213
3 3300007052 Ga0102736_1001481 Ga0102736_10014813 230
4 3300042618 Ga0466723_092998 Ga0466723_092998_5394_6122 231
5 3300007080 Ga0102735_1000757 Ga0102735_10007574 237
6 3300007141 Ga0102738_1002807 Ga0102738_10028072 238
7 3300007192 Ga0103268_1001921 Ga0103268_10019212 238
8 3300042613 Ga0466710_111680 Ga0466710_111680_1562_2320 238
9 3300007192 Ga0103268_1005308 Ga0103268_10053082 239
10 3300042612 Ga0466705_053435 Ga0466705_053435_10222_10941 239
11 3300006995 Ga0102733_102278 Ga0102733_1022782 242
12 3300012846 Ga0160433_100171 Ga0160433_10017151 242
13 3300007067 Ga0103266_1006769 Ga0103266_10067692 243
14 3300042598 Ga0466701_091235 Ga0466701_091235_18386_19183 243
15 3300042615 Ga0466711_275755 Ga0466711_275755_13651_14415 243
16 3300010049 Ga0123356_10037525 Ga0123356_100375253 244
17 3300042619 Ga0466726_083930 Ga0466726_083930_17860_18597 245
18 iso_pr_bacteria 8065497608 8065501760 245
19 3300042613 Ga0466710_034181 Ga0466710_034181_127_867 246
20 3300012849 Ga0160447_101145 Ga0160447_10114510 247
21 3300012861 Ga0160436_1000414 Ga0160436_10004146 247
22 3300013007 Ga0157631_137351 Ga0157631_1373512 247
23 3300042624 Ga0466735_229826 Ga0466735_229826_829_1572 247
24 3300042659 Ga0466733_057310 Ga0466733_057310_32549_33292 247
25 iso_pr_bacteria 2648501628 2650559056 247
26 3300007140 Ga0102740_1003621 Ga0102740_10036212 248
27 3300042582 Ga0466657_368674 Ga0466657_368674_554_1300 248
28 3300042596 Ga0466696_213027 Ga0466696_213027_751_1497 248
29 3300042606 Ga0466719_467287 Ga0466719_467287_932_1678 248
30 3300042654 Ga0466725_177809 Ga0466725_177809_6838_7584 248
31 iso_pr_bacteria 2507262057 2507517589 248
32 iso_pr_bacteria 2844251356 2844255417 248
33 iso_pr_bacteria 2858407585 2858408178 248
34 iso_pr_bacteria 2868883784 2868886828 248
35 iso_pr_bacteria 2873884416 2873887565 248
36 iso_pr_bacteria 2900349738 2900352241 248
37 iso_pr_bacteria 2902438364 2902439079 248
38 iso_pr_bacteria 2902451016 2902451483 248
39 iso_pr_bacteria 2902469402 2902472046 248
40 iso_pr_bacteria 2912636047 2912638407 248
41 iso_pr_bacteria 8022116796 8022120042 248
42 iso_pr_bacteria 8022345672 8022345917 248
43 iso_pr_bacteria 8033364368 8033367346 248
44 iso_pr_bacteria 8033368880 8033371787 248
45 iso_pr_bacteria 8048923410 8048924715 248
46 iso_pr_bacteria 8048928574 8048929918 248
47 3300005083 Ga0068305_10245905 Ga0068305_102459052 249
48 3300042602 Ga0466713_038453 Ga0466713_038453_33552_34301 249
49 iso_pr_bacteria 2518285522 2518345405 249
50 iso_pr_bacteria 2551306520 2553400549 249
51 iso_pr_bacteria 2609459925 2610645028 249
52 iso_pr_bacteria 2609459958 2610826737 249
53 iso_pr_bacteria 2627853677 2628492500 249
54 iso_pr_bacteria 2627854002 2629834789 249
55 iso_pr_bacteria 2630968716 2632957418 249
56 iso_pr_bacteria 2636415542 2636990850 249
57 iso_pr_bacteria 2648501820 2651397247 249
58 iso_pr_bacteria 2767802234 2769332275 249
59 iso_pr_bacteria 2864768727 2864771250 249
60 iso_pr_bacteria 2864791955 2864794478 249
61 iso_pr_bacteria 2896925746 2896926845 249
62 iso_pr_bacteria 8116627632 8116632709 249
63 2225789004 2227516023 2228014716 250
64 3300003973 Ga0063521_1000254 Ga0063521_100025423 250
65 3300030930 Ga0316159_10001 Ga0316159_10001226 250
66 iso_pr_bacteria 2565956518 2566024553 250
67 iso_pr_bacteria 2600255074 2600845766 250
68 iso_pr_bacteria 2648501158 2648749067 250
69 iso_pr_bacteria 2711768158 2712481251 250
70 iso_pr_bacteria 2791355471 2794375232 250
71 iso_pr_bacteria 2989793055 2989794325 250
72 iso_pr_bacteria 3006225627 3006227368 250
73 iso_pr_bacteria 3006242587 3006245269 250
74 3300007149 Ga0104040_1001474 Ga0104040_10014743 251
75 3300042601 Ga0466707_079738 Ga0466707_079738_2162_2917 251
76 3300042602 Ga0466713_059751 Ga0466713_059751_3661_4416 251
77 3300042624 Ga0466735_053348 Ga0466735_053348_15181_15936 251
78 iso_pr_bacteria 2551306507 2553348741 251
79 iso_pr_bacteria 2554235022 2554335457 251
80 iso_pr_bacteria 2663763317 2666537624 251
81 iso_pr_bacteria 2667527830 2669650556 251
82 iso_pr_bacteria 2693429575 2693742984 251
83 iso_pr_bacteria 2700989396 2702441737 251
84 iso_pr_bacteria 2785510762 2785804276 251
85 iso_pr_bacteria 2791355473 2794386289 251
86 iso_pr_bacteria 2860776474 2860778464 251
87 iso_pr_bacteria 2875320051 2875322310 251
88 iso_pr_bacteria 2877647439 2877649453 251
89 iso_pr_bacteria 2880115952 2880117007 251
90 iso_pr_bacteria 2912570088 2912571151 251
91 iso_pr_bacteria 2997380424 2997382766 251
92 iso_pr_bacteria 3000861951 3000863019 251
93 iso_pr_bacteria 8022087107 8022089230 251
94 iso_pr_bacteria 8022096067 8022098275 251
95 iso_pr_bacteria 8022439116 8022439608 251
96 iso_pr_bacteria 8051461712 8051462731 251
97 iso_pr_bacteria 8051534459 8051535350 251
98 iso_pr_bacteria 8051551332 8051553090 251
99 iso_pr_bacteria 8060845732 8060847916 251
100 3300042602 Ga0466713_051068 Ga0466713_051068_6027_6785 252
101 iso_pr_bacteria 2507262005 2507287372 252
102 iso_pr_bacteria 2511231129 2511730398 252
103 iso_pr_bacteria 2531839005 2531866397 252
104 iso_pr_bacteria 2571042430 2572512631 252
105 iso_pr_bacteria 2571042554 2572924874 252
106 iso_pr_bacteria 2636415586 2637164998 252
107 iso_pr_bacteria 2654587515 2654661370 252
108 iso_pr_bacteria 2667527887 2669887873 252
109 iso_pr_bacteria 2684622551 2684819637 252
110 iso_pr_bacteria 2731957638 2732528533 252
111 iso_pr_bacteria 2850895757 2850896764 252
112 iso_pr_bacteria 2872471378 2872473485 252
113 iso_pr_bacteria 2877638525 2877639576 252
114 iso_pr_bacteria 2908136803 2908138588 252
115 iso_pr_bacteria 640963010 641030206 252
116 iso_pr_bacteria 648861007 648921646 252
117 iso_pr_bacteria 8008122225 8008126367 252
118 iso_pr_bacteria 8042061949 8042065933 252
119 2189573031 gam1t_NODE_689636_length=159105_GC=32_4_Contigs=24 gam1t_00040930 253
120 3300007188 Ga0103264_1000010 Ga0103264_100001071 253
121 3300009453 Ga0127656_100080 Ga0127656_10008037 253
122 3300042582 Ga0466657_338988 Ga0466657_338988_65_826 253
123 3300042616 Ga0466715_181754 Ga0466715_181754_59735_60496 253
124 3300042659 Ga0466733_121053 Ga0466733_121053_672_1433 253
125 iso_pr_bacteria 2515154034 2515299571 253
126 iso_pr_bacteria 2630968947 2633886339 253
127 iso_pr_bacteria 2671180705 2673867889 253
128 iso_pr_bacteria 2684622921 2686090932 253
129 iso_pr_bacteria 2731957969 2734003075 253
130 iso_pr_bacteria 2756170266 2756754248 253
131 iso_pr_bacteria 2833532623 2833533398 253
132 iso_pr_bacteria 2864764899 2864766117 253
133 iso_pr_bacteria 2864796242 2864797021 253
134 iso_pr_bacteria 2868506828 2868507080 253
135 iso_pr_bacteria 2873636219 2873637761 253
136 iso_pr_bacteria 2902896024 2902896927 253
137 2032320009 DPO_contig00939 DPOB_509320 254
138 2100351016 SWWA_contig06580__length_4136___numreads_64 SWWA_01686600 254
139 2100351016 SWWA_contig17289__length_2920___numreads_34 SWWA_00667980 254
140 2100351016 SWWA_contig31660__length_24037___numreads_1280 SWWA_01977020 254
141 3300000333 HBC_ctgsDRAFT_1000819 HBC_ctgsDRAFT_10008199 254
142 3300000459 SCG598C04_11372 SCG598C04_1137221 254
143 3300005721 Ga0074278_110888 Ga0074278_110888144 254
144 3300007129 Ga0102734_1003806 Ga0102734_10038065 254
145 3300042598 Ga0466701_069596 Ga0466701_069596_94_858 254
146 3300042602 Ga0466713_050606 Ga0466713_050606_1381_2145 254
147 3300042625 Ga0466730_046718 Ga0466730_046718_48642_49439 254
148 iso_pr_bacteria 2838140227 2838143121 254
149 iso_pr_bacteria 2864751016 2864751107 254
150 iso_pr_bacteria 2902916284 2902916730 254
151 3300007130 Ga0104042_1004536 Ga0104042_10045363 255
152 3300007139 Ga0103260_1000043 Ga0103260_10000439 255
153 3300012815 Ga0160440_101523 Ga0160440_1015234 255
154 3300012848 Ga0160443_103971 Ga0160443_1039711 255
155 3300012852 Ga0160430_110710 Ga0160430_1107103 255
156 3300012854 Ga0160448_100140 Ga0160448_10014012 255
157 3300042582 Ga0466657_387694 Ga0466657_387694_450_1217 255
158 3300042598 Ga0466701_068336 Ga0466701_068336_1397_2164 255
159 3300000333 HBC_ctgsDRAFT_1000509 HBC_ctgsDRAFT_10005094 256
160 3300042601 Ga0466707_026244 Ga0466707_026244_2184_2954 256
161 3300042612 Ga0466705_021724 Ga0466705_021724_73186_73956 256
162 iso_pr_bacteria 2517487021 2517563554 256
163 iso_pr_bacteria 2820121232 2820121333 256
164 2035918003 DPOL_contig09368 DPOLB_1263460 257
165 3300007188 Ga0103264_1072327 Ga0103264_10723272 257
166 3300007733 Ga0105524_104499 Ga0105524_1044994 257
167 3300009784 Ga0123357_10000144 Ga0123357_1000014436 257
168 3300012824 Ga0160469_100019 Ga0160469_100019255 257
169 3300042598 Ga0466701_004861 Ga0466701_004861_7147_7920 257
170 3300042613 Ga0466710_110693 Ga0466710_110693_1730_2503 257
171 3300042613 Ga0466710_155550 Ga0466710_155550_855_1628 257
172 3300042613 Ga0466710_266898 Ga0466710_266898_17164_17937 257
173 3300042625 Ga0466730_005475 Ga0466730_005475_46627_47400 257
174 3300042625 Ga0466730_006615 Ga0466730_006615_3593_4366 257
175 3300042649 Ga0466724_02429 Ga0466724_02429_3937_4710 257
176 iso_pr_bacteria 2617270844 2617734478 257
177 3300005083 Ga0068305_10097494 Ga0068305_100974941 258
178 3300007141 Ga0102738_1000771 Ga0102738_10007716 258
179 3300012819 Ga0160468_100404 Ga0160468_1004049 258
180 3300012829 Ga0160467_101080 Ga0160467_1010806 258
181 3300012834 Ga0160452_100101 Ga0160452_10010160 258
182 3300012848 Ga0160443_100192 Ga0160443_10019259 258
183 3300012858 Ga0160457_1000037 Ga0160457_1000037172 258
184 3300042582 Ga0466657_012670 Ga0466657_012670_540_1316 258
185 3300042604 Ga0466717_015615 Ga0466717_015615_76_852 258
186 3300042654 Ga0466725_063059 Ga0466725_063059_31012_31788 258
187 iso_pr_bacteria 2791354930 2792023132 258
188 iso_pr_bacteria 2820065746 2820066830 258
189 iso_pr_bacteria 2831380896 2831380904 258
190 iso_pr_bacteria 8065340634 8065340641 258
191 3300010167 Ga0123353_10203128 Ga0123353_102031283 259
192 3300012858 Ga0160457_1000055 Ga0160457_1000055145 259
193 3300007141 Ga0102738_1000128 Ga0102738_10001289 260
194 3300007142 Ga0102737_1003389 Ga0102737_10033894 260
195 3300010167 Ga0123353_10486923 Ga0123353_104869233 260
196 3300012813 Ga0160470_100042 Ga0160470_100042149 260
197 3300012815 Ga0160440_100002 Ga0160440_10000267 260
198 3300012831 Ga0160459_100045 Ga0160459_100045132 260
199 3300012841 Ga0160444_101243 Ga0160444_1012431 260
200 3300012850 Ga0160434_101100 Ga0160434_1011001 260
201 3300012854 Ga0160448_100233 Ga0160448_1002339 260
202 3300012857 Ga0160435_1000213 Ga0160435_100021320 260
203 3300042609 Ga0466722_241144 Ga0466722_241144_5562_6344 260
204 3300042656 Ga0466732_220026 Ga0466732_220026_1251_2033 260
205 iso_pr_bacteria 2513237114 2513782218 260
206 iso_pr_bacteria 2518285616 2518643268 260
207 iso_pr_bacteria 2548876789 2549848505 260
208 iso_pr_bacteria 2820131053 2820132459 260
209 3300010049 Ga0123356_10082051 Ga0123356_100820513 261
210 3300010167 Ga0123353_10130629 Ga0123353_101306292 261
211 3300012861 Ga0160436_1000422 Ga0160436_10004226 261
212 3300007140 Ga0102740_1000011 Ga0102740_1000011103 262
213 iso_pr_bacteria 8011357093 8011361335 262
214 3300007129 Ga0102734_1000038 Ga0102734_100003842 263
215 3300007139 Ga0103260_1003161 Ga0103260_10031614 263
216 3300007083 Ga0103261_1000362 Ga0103261_10003622 264
217 3300002931 CVPL010W_10000762 CVPL010W_100007622 265
218 3300007042 Ga0103263_100027 Ga0103263_10002731 265
219 3300007052 Ga0102736_1000021 Ga0102736_100002118 265
220 3300007095 Ga0102739_1000147 Ga0102739_10001478 265
221 3300030930 Ga0316159_12960 Ga0316159_129603 265
222 3300042625 Ga0466730_065044 Ga0466730_065044_368_1165 265
223 iso_pr_bacteria 2864761044 2864761844 265
224 iso_pr_bacteria 8100449422 8100451066 265
225 iso_pr_bacteria 8100455565 8100458655 265
226 iso_pr_bacteria 8100461708 8100462815 265
227 3300007083 Ga0103261_1000024 Ga0103261_100002449 266
228 3300007142 Ga0102737_1000112 Ga0102737_100011211 266
229 3300012825 Ga0160441_100091 Ga0160441_10009144 266
230 3300012861 Ga0160436_1000039 Ga0160436_100003912 266
231 3300042659 Ga0466733_170684 Ga0466733_170684_14882_15715 266
232 3300007140 Ga0102740_1003819 Ga0102740_10038194 267
233 3300042609 Ga0466722_095049 Ga0466722_095049_19263_20066 267
234 iso_pr_bacteria 2864826666 2864827231 273
235 3300042623 Ga0466734_108061 Ga0466734_108061_2267_3130 287

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02348 CTP_transf_3 Cytidylyltransferase 38 254 0.96
PF12804 NTP_transf_3 MobA-like NTP transferase domain 52 160 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.