Protein Family IF08681

Metagenome Isolate
216 Members
95 Samples
172 Scaffolds
358.83 Avg Length

🧬 Representative Sequence

ID
3300042623|Ga0466734_102853|Ga0466734_102853_3339_4559
Length
406 aa
Sequence
MVHCKYSGLAGSAGILPVFILRTGGTPAFPWHSFYGAHPYLQGNKGARFIMRLKAGIVGGTGMVGQRFISLLENHPWFEVAAIAASXXXAGKSYAQAVEGRWKLASALPECVKNIVVQDASKVDEVASGLDLIFCAVDMKKDETRALEESYARAETPVVSNNSAHRLTPDVPMIIPEINPGHLEIIEYQKKRLGTKRGFIAVKPNCSIQSYVPALHALMEYRPVSVVACTYQAISGAGRTFKDWPEMVDNIIPYIGGEEEKSEQEPLRIWGGISDGAIVKAATPGITTQCIRVPVTDGHMAAVFVTFERKPSKEEILELWRSFRGRPQEMELPSAPKQFIRYFEEADRPQTKLDRDLENGMGVAVGRLREDSLHDYKFVSLSHNTVRGAAGGAVLIAELLKAEGYI

📊 Sample Types

Isolate 20.4%
Metagenome 79.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.7%
Termitidae 29.3%
Kalotermitidae 10.9%
Blattidae 9.8%
Termopsidae 4.3%
Rhinotermitidae 3.3%
Passalidae 3.3%
Armadillidiidae 2.2%
Apidae 1.1%
Hodotermitidae 1.1%
Scarabaeidae 1.1%

🌳 Taxonomy

Archaea 2
Bacteria 207
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
2 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
3 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
4 2590828840 Clostridium sp. 2 Isolate Termitidae
5 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
6 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
7 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
8 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
9 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
10 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
11 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
21 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
22 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
23 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
33 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
34 2593339125 Clostridium sp. 5 Isolate Termitidae
35 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
36 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
41 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
42 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
43 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
52 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
53 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
54 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
57 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
58 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
59 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
60 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
61 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
62 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
63 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
64 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
65 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
66 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
67 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
68 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
69 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
70 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
71 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
72 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
73 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
74 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
75 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
76 2820127165 Unclassified Proteobacteria Emb289P3bin90 Isolate Unclassified
77 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
83 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
84 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
85 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
86 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
87 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
88 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
89 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
90 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
91 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
92 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
93 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
94 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
95 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10296968 3300009826 Bacteria 2208
2 Ga0123356_10001527 3300010049 Bacteria 25484
3 Ga0123356_10117996 3300010049 Bacteria 2575
4 Ga0123353_10237161 3300010167 Bacteria 2838
5 Ga0466734_102853 3300042623 Bacteria 4728
6 Ga0466735_040365 3300042624 Bacteria 2396
7 Ga0466735_151470 3300042624 Bacteria 2480
8 Ga0466715_032121 3300042616 Bacteria 36016
9 Ga0466718_064128 3300042617 Bacteria 2693
10 Ga0466726_185141 3300042619 Bacteria 17114
11 Ga0160452_100137 3300012834 Bacteria 89493
12 Ga0160452_100494 3300012834 Bacteria 25479
13 Ga0415639_019290 3300038395 Unclassified 2428
14 Ga0415639_086176 3300038395 Bacteria 4305
15 Ga0466694_355705 3300042594 Bacteria 3623
16 Ga0466701_014943 3300042598 Bacteria 55754
17 Ga0466701_035936 3300042598 Bacteria 4288
18 Ga0466706_084122 3300042599 Bacteria 1197
19 Ga0466706_253460 3300042599 Bacteria 2324
20 Ga0466707_076510 3300042601 Bacteria 1192
21 Ga0466714_058749 3300042603 Bacteria 1621
22 Ga0466714_102387 3300042603 Bacteria 1445
23 Ga0466719_100305 3300042606 Bacteria 13452
24 Ga0466722_255515 3300042609 Bacteria 20457
25 Ga0068305_10005230 3300005083 Bacteria 6754
26 Ga0123355_10016129 3300009826 Bacteria 11765
27 Ga0123355_10303175 3300009826 Bacteria 2175
28 Ga0123353_10136968 3300010167 Bacteria 3926
29 Ga0466731_213729 3300042622 Bacteria 1281
30 Ga0466702_190794 3300042635 Bacteria 2134
31 Ga0466703_073311 3300042636 Bacteria 30443
32 Ga0466705_420380 3300042612 Bacteria 591368
33 Ga0466718_138813 3300042617 Bacteria 2562
34 Ga0160467_102149 3300012829 Bacteria 4947
35 Ga0415639_004398 3300038395 Unclassified 7618
36 Ga0415639_023799 3300038395 Bacteria 35883
37 Ga0415639_157032 3300038395 Unclassified 1026
38 Ga0466696_014387 3300042596 Bacteria 23475
39 Ga0466696_379860 3300042596 Bacteria 2832
40 Ga0466706_044749 3300042599 Bacteria 7185
41 Ga0466706_064972 3300042599 Bacteria 11735
42 Ga0466706_223301 3300042599 Bacteria 40398
43 Ga0466700_244135 3300042600 Bacteria 13466
44 Ga0466707_262119 3300042601 Bacteria 21891
45 Ga0466714_053357 3300042603 Bacteria 2101
46 Ga0466719_456848 3300042606 Bacteria 85239
47 JGI24695J34938_10000697 3300002450 Bacteria 31714
48 Ga0466704_070315 3300042643 Bacteria 4076
49 Ga0466715_640524 3300042616 Bacteria 49586
50 Ga0466723_312829 3300042618 Bacteria 9292
51 Ga0415639_004221 3300038395 Bacteria 18979
52 Ga0415639_086145 3300038395 Bacteria 2186
53 Ga0466706_028917 3300042599 Bacteria 2029
54 Ga0466706_166495 3300042599 Bacteria 1214
55 Ga0466700_313437 3300042600 Bacteria 1268
56 Ga0466707_212548 3300042601 Bacteria 93538
57 Ga0466713_141526 3300042602 Bacteria 43819
58 Ga0466714_016908 3300042603 Bacteria 1300
59 Ga0466714_062767 3300042603 Bacteria 1519
60 Ga0466719_533753 3300042606 Bacteria 2040
61 Ga0466722_161053 3300042609 Bacteria 58719
62 2227080788 2225789004 Bacteria 142057
63 IMNBL1DRAFT_c0000847 3300000062 Bacteria 24007
64 Ga0068305_10038476 3300005083 Bacteria 58791
65 Ga0466705_139824 3300042612 Bacteria 61712
66 Ga0123355_10109445 3300009826 Archaea 4321
67 Ga0123355_10506051 3300009826 Bacteria 1487
68 Ga0123356_10000734 3300010049 Bacteria 36122
69 Ga0123356_10008749 3300010049 Bacteria 10036
70 Ga0123356_10511675 3300010049 Bacteria 1358
71 Ga0123353_10017538 3300010167 Bacteria 10531
72 Ga0123353_10062486 3300010167 Bacteria 5972
73 Ga0123353_10210527 3300010167 Bacteria 3050
74 Ga0123353_10296235 3300010167 Bacteria 2473
75 Ga0123353_10316613 3300010167 Unclassified 2370
76 Ga0466657_151483 3300042582 Bacteria 1501
77 Ga0466706_141178 3300042599 Bacteria 9196
78 Ga0466706_157485 3300042599 Bacteria 18529
79 Ga0466706_165948 3300042599 Bacteria 9149
80 Ga0466706_195039 3300042599 Bacteria 2363
81 Ga0466714_008983 3300042603 Bacteria 13749
82 Ga0466698_169800 3300042610 Bacteria 3375
83 2227535729 2225789004 Bacteria 57601
84 AustNasuHG_c1000001 3300000089 Bacteria 78376
85 JGI24695J34938_10001564 3300002450 Bacteria 19283
86 JGI24702J35022_10085123 3300002462 Bacteria 1716
87 Ga0466733_207523 3300042659 Bacteria 3469
88 Ga0123355_10011093 3300009826 Bacteria 13875
89 Ga0123355_10039386 3300009826 Bacteria 7689
90 Ga0123356_10015675 3300010049 Bacteria 7257
91 Ga0123356_10223111 3300010049 Bacteria 1942
92 Ga0123353_10007775 3300010167 Bacteria 14550
93 Ga0466702_129145 3300042635 Bacteria 18302
94 Ga0466702_407008 3300042635 Bacteria 1208
95 Ga0466704_103189 3300042643 Bacteria 58965
96 Ga0466727_343780 3300042655 Bacteria 7901
97 Ga0466718_100911 3300042617 Bacteria 3935
98 Ga0160444_102529 3300012841 Bacteria 2792
99 Ga0415639_091669 3300038395 Bacteria 2528
100 Ga0466692_060050 3300042591 Bacteria 1871
101 Ga0466706_006808 3300042599 Bacteria 35792
102 Ga0466714_078529 3300042603 Bacteria 17715
103 Ga0466719_453084 3300042606 Unclassified 4215
104 Ga0466722_265288 3300042609 Bacteria 4615
105 Ga0072941_1079606 3300005201 Bacteria 12395
106 Ga0466705_057656 3300042612 Bacteria 9353
107 Ga0123356_10005297 3300010049 Bacteria 13149
108 Ga0123356_10282849 3300010049 Bacteria 1755
109 Ga0123353_10260955 3300010167 Bacteria 2676
110 Ga0123353_10288348 3300010167 Bacteria 2515
111 Ga0466704_248829 3300042643 Bacteria 10631
112 Ga0466723_270762 3300042618 Bacteria 21971
113 Ga0466690_221393 3300042590 Bacteria 5390
114 Ga0466706_075785 3300042599 Bacteria 15657
115 Ga0466706_187792 3300042599 Unclassified 1252
116 Ga0466706_194038 3300042599 Bacteria 6197
117 Ga0466706_274074 3300042599 Bacteria 18421
118 Ga0466700_111662 3300042600 Bacteria 1655
119 Ga0466707_243945 3300042601 Bacteria 2546
120 Ga0466714_010591 3300042603 Bacteria 39899
121 Ga0466717_251337 3300042604 Bacteria 6714
122 Ga0466719_130485 3300042606 Bacteria 4722
123 2227075517 2225789003 Unclassified 2298
124 IMNBL1DRAFT_c0002082 3300000062 Bacteria 14247
125 IMNBL1DRAFT_c0005081 3300000062 Bacteria 7651
126 JGI24695J34938_10002725 3300002450 Bacteria 13029
127 JGI24695J34938_10014698 3300002450 Bacteria 4045
128 JGI24702J35022_10009829 3300002462 Bacteria 5361
129 JGI24702J35022_10013054 3300002462 Bacteria 4608
130 Ga0068302_10267900 3300005071 Bacteria 2201
131 Ga0068305_10346874 3300005083 Bacteria 4195
132 Ga0123355_10032799 3300009826 Bacteria 8430
133 Ga0123356_10061082 3300010049 Bacteria 3518
134 Ga0123353_10096298 3300010167 Bacteria 4769
135 Ga0123353_10148469 3300010167 Bacteria 3746
136 Ga0123353_10176635 3300010167 Bacteria 3385
137 Ga0466729_254634 3300042621 Bacteria 3076
138 Ga0466702_370419 3300042635 Bacteria 8562
139 Ga0466715_042181 3300042616 Bacteria 63725
140 Ga0466715_411922 3300042616 Bacteria 42002
141 Ga0466729_053312 3300042621 Bacteria 29885
142 Ga0466693_046813 3300042592 Bacteria 1365
143 Ga0466706_032217 3300042599 Bacteria 49907
144 Ga0466706_099121 3300042599 Bacteria 26092
145 Ga0466706_155984 3300042599 Bacteria 4403
146 Ga0466707_041931 3300042601 Bacteria 3832
147 Ga0466714_167736 3300042603 Bacteria 6470
148 Ga0466716_369546 3300042605 Bacteria 2514
149 2227480187 2225789004 Bacteria 78142
150 Ga0072940_1291924 3300005200 Archaea 2963
151 Ga0123355_10016048 3300009826 Bacteria 11789
152 Ga0123356_10000669 3300010049 Bacteria 37873
153 Ga0123353_10041968 3300010167 Bacteria 7233
154 Ga0123353_10186292 3300010167 Bacteria 3282
155 Ga0123353_10378625 3300010167 Bacteria 2118
156 Ga0160466_100856 3300012809 Bacteria 11295
157 Ga0466702_032394 3300042635 Bacteria 34580
158 Ga0466718_057707 3300042617 Bacteria 6861
159 Ga0466726_488489 3300042619 Bacteria 5622
160 Ga0415639_000672 3300038395 Bacteria 94504
161 Ga0415639_009182 3300038395 Bacteria 12523
162 Ga0415639_011546 3300038395 Bacteria 10404
163 Ga0466693_223915 3300042592 Bacteria 2606
164 Ga0466691_212677 3300042593 Bacteria 4994
165 Ga0466696_375600 3300042596 Bacteria 8621
166 Ga0466706_131558 3300042599 Bacteria 21014
167 Ga0466707_039554 3300042601 Bacteria 1380
168 Ga0466713_142802 3300042602 Bacteria 224732
169 Ga0466714_155065 3300042603 Bacteria 1737
170 Ga0466717_224990 3300042604 Bacteria 6431
171 IMNBL1DRAFT_c0008029 3300000062 Bacteria 5437
172 JGI24705J35276_12195629 3300002504 Bacteria 1528

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_187792 Ga0466706_187792_299_1165 288
2 3300042599 Ga0466706_166495 Ga0466706_166495_92_961 289
3 3300042601 Ga0466707_076510 Ga0466707_076510_224_1135 303
4 3300038395 Ga0415639_157032 Ga0415639_157032_49_984 311
5 3300009826 Ga0123355_10296968 Ga0123355_102969682 312
6 3300042599 Ga0466706_084122 Ga0466706_084122_20_1006 328
7 3300038395 Ga0415639_004221 Ga0415639_004221_1783_2844 335
8 3300042596 Ga0466696_379860 Ga0466696_379860_408_1493 336
9 3300042599 Ga0466706_075785 Ga0466706_075785_12633_13664 343
10 3300042599 Ga0466706_141178 Ga0466706_141178_1648_2679 343
11 3300042603 Ga0466714_058749 Ga0466714_058749_264_1298 344
12 3300042603 Ga0466714_062767 Ga0466714_062767_193_1227 344
13 3300010167 Ga0123353_10017538 Ga0123353_100175388 345
14 3300042612 Ga0466705_057656 Ga0466705_057656_152_1189 345
15 3300010049 Ga0123356_10223111 Ga0123356_102231112 346
16 3300002450 JGI24695J34938_10001564 JGI24695J34938_1000156413 347
17 3300009826 Ga0123355_10109445 Ga0123355_101094453 347
18 3300010167 Ga0123353_10096298 Ga0123353_100962984 347
19 3300038395 Ga0415639_004398 Ga0415639_004398_26_1069 347
20 3300038395 Ga0415639_019290 Ga0415639_019290_1360_2403 347
21 3300042596 Ga0466696_014387 Ga0466696_014387_869_1912 347
22 3300042599 Ga0466706_028917 Ga0466706_028917_949_1992 347
23 3300042599 Ga0466706_274074 Ga0466706_274074_9184_10227 347
24 3300042606 Ga0466719_533753 Ga0466719_533753_230_1273 347
25 iso_pr_bacteria 2576861701 2579271152 347
26 3300012809 Ga0160466_100856 Ga0160466_1008569 348
27 3300012834 Ga0160452_100137 Ga0160452_10013752 348
28 3300042599 Ga0466706_165948 Ga0466706_165948_7472_8518 348
29 3300042601 Ga0466707_262119 Ga0466707_262119_16396_17442 348
30 3300009826 Ga0123355_10303175 Ga0123355_103031752 349
31 3300042624 Ga0466735_151470 Ga0466735_151470_421_1470 349
32 3300042599 Ga0466706_032217 Ga0466706_032217_35046_36128 351
33 3300038395 Ga0415639_086176 Ga0415639_086176_2602_3660 352
34 iso_pr_bacteria 2820333861 2820334801 352
35 3300038395 Ga0415639_011546 Ga0415639_011546_3459_4520 353
36 3300042603 Ga0466714_167736 Ga0466714_167736_1880_2941 353
37 3300042604 Ga0466717_224990 Ga0466717_224990_4542_5603 353
38 3300000089 AustNasuHG_c1000001 AustNasuHG_100000137 354
39 3300038395 Ga0415639_000672 Ga0415639_000672_9360_10424 354
40 3300042635 Ga0466702_129145 Ga0466702_129145_2177_3241 354
41 2225789004 2227535729 2228052382 356
42 3300005200 Ga0072940_1291924 Ga0072940_12919243 356
43 3300010167 Ga0123353_10237161 Ga0123353_102371615 356
44 3300038395 Ga0415639_091669 Ga0415639_091669_677_1747 356
45 3300042582 Ga0466657_151483 Ga0466657_151483_301_1371 356
46 iso_pr_bacteria 2820950349 2820950858 356
47 3300002450 JGI24695J34938_10002725 JGI24695J34938_1000272510 357
48 3300002462 JGI24702J35022_10009829 JGI24702J35022_100098294 357
49 3300002462 JGI24702J35022_10085123 JGI24702J35022_100851232 357
50 3300038395 Ga0415639_009182 Ga0415639_009182_3589_4662 357
51 3300042601 Ga0466707_041931 Ga0466707_041931_289_1362 357
52 3300042603 Ga0466714_010591 Ga0466714_010591_15636_16709 357
53 3300042603 Ga0466714_053357 Ga0466714_053357_910_1983 357
54 3300042635 Ga0466702_032394 Ga0466702_032394_346_1419 357
55 3300005201 Ga0072941_1079606 Ga0072941_10796066 358
56 3300010167 Ga0123353_10186292 Ga0123353_101862922 358
57 3300038395 Ga0415639_023799 Ga0415639_023799_4644_5720 358
58 3300042617 Ga0466718_057707 Ga0466718_057707_105_1205 358
59 3300042618 Ga0466723_312829 Ga0466723_312829_6260_7336 358
60 3300042643 Ga0466704_070315 Ga0466704_070315_2730_3806 358
61 3300042643 Ga0466704_248829 Ga0466704_248829_440_1516 358
62 3300042659 Ga0466733_207523 Ga0466733_207523_911_1987 358
63 iso_pr_bacteria 2820441105 2820442312 358
64 iso_pr_bacteria 2820626145 2820626304 358
65 2225789003 2227075517 2227440645 359
66 2225789004 2227480187 2227939228 359
67 3300009826 Ga0123355_10011093 Ga0123355_1001109314 359
68 3300009826 Ga0123355_10016048 Ga0123355_100160489 359
69 3300009826 Ga0123355_10506051 Ga0123355_105060511 359
70 3300010167 Ga0123353_10378625 Ga0123353_103786253 359
71 3300042590 Ga0466690_221393 Ga0466690_221393_1497_2576 359
72 3300042600 Ga0466700_244135 Ga0466700_244135_6301_7380 359
73 3300042602 Ga0466713_141526 Ga0466713_141526_1404_2483 359
74 3300042603 Ga0466714_155065 Ga0466714_155065_427_1506 359
75 3300042606 Ga0466719_456848 Ga0466719_456848_31954_33033 359
76 3300042609 Ga0466722_161053 Ga0466722_161053_22727_23806 359
77 3300042610 Ga0466698_169800 Ga0466698_169800_1841_2920 359
78 3300042612 Ga0466705_139824 Ga0466705_139824_29970_31049 359
79 3300042617 Ga0466718_064128 Ga0466718_064128_1096_2175 359
80 3300042621 Ga0466729_254634 Ga0466729_254634_1799_2878 359
81 3300042635 Ga0466702_370419 Ga0466702_370419_4484_5563 359
82 3300042635 Ga0466702_407008 Ga0466702_407008_86_1165 359
83 iso_pr_bacteria 2590828841 2593260971 359
84 iso_pr_bacteria 2820261600 2820263068 359
85 iso_pr_bacteria 2820340373 2820341407 359
86 iso_pr_bacteria 2820464928 2820466164 359
87 iso_pr_bacteria 2820525019 2820525592 359
88 iso_pr_bacteria 2820560510 2820562273 359
89 iso_pr_bacteria 2820661146 2820662479 359
90 iso_pr_bacteria 2820690275 2820691785 359
91 3300000062 IMNBL1DRAFT_c0000847 IMNBL1DRAFT_000084718 360
92 3300000062 IMNBL1DRAFT_c0005081 IMNBL1DRAFT_00050812 360
93 3300000062 IMNBL1DRAFT_c0008029 IMNBL1DRAFT_00080292 360
94 3300002504 JGI24705J35276_12195629 JGI24705J35276_121956291 360
95 3300009826 Ga0123355_10016129 Ga0123355_1001612910 360
96 3300009826 Ga0123355_10039386 Ga0123355_100393862 360
97 3300010167 Ga0123353_10062486 Ga0123353_100624863 360
98 3300042591 Ga0466692_060050 Ga0466692_060050_148_1230 360
99 3300042593 Ga0466691_212677 Ga0466691_212677_1278_2360 360
100 3300042596 Ga0466696_375600 Ga0466696_375600_2857_3939 360
101 3300042599 Ga0466706_006808 Ga0466706_006808_151_1233 360
102 3300042599 Ga0466706_044749 Ga0466706_044749_151_1233 360
103 3300042599 Ga0466706_064972 Ga0466706_064972_7498_8580 360
104 3300042599 Ga0466706_099121 Ga0466706_099121_20330_21412 360
105 3300042599 Ga0466706_131558 Ga0466706_131558_9662_10744 360
106 3300042599 Ga0466706_155984 Ga0466706_155984_3146_4228 360
107 3300042599 Ga0466706_157485 Ga0466706_157485_7198_8280 360
108 3300042599 Ga0466706_194038 Ga0466706_194038_3364_4446 360
109 3300042599 Ga0466706_195039 Ga0466706_195039_565_1647 360
110 3300042599 Ga0466706_223301 Ga0466706_223301_36144_37226 360
111 3300042601 Ga0466707_243945 Ga0466707_243945_273_1355 360
112 3300042602 Ga0466713_142802 Ga0466713_142802_104414_105496 360
113 3300042603 Ga0466714_008983 Ga0466714_008983_1585_2667 360
114 3300042605 Ga0466716_369546 Ga0466716_369546_658_1740 360
115 3300042606 Ga0466719_453084 Ga0466719_453084_2080_3162 360
116 3300042616 Ga0466715_032121 Ga0466715_032121_3789_4871 360
117 3300042616 Ga0466715_411922 Ga0466715_411922_13158_14240 360
118 3300042635 Ga0466702_190794 Ga0466702_190794_574_1656 360
119 iso_pr_bacteria 2820463629 2820464538 360
120 3300000062 IMNBL1DRAFT_c0002082 IMNBL1DRAFT_00020823 361
121 3300002450 JGI24695J34938_10000697 JGI24695J34938_1000069728 361
122 3300002462 JGI24702J35022_10013054 JGI24702J35022_100130542 361
123 3300005083 Ga0068305_10346874 Ga0068305_103468742 361
124 3300010167 Ga0123353_10148469 Ga0123353_101484693 361
125 3300042598 Ga0466701_014943 Ga0466701_014943_5138_6223 361
126 3300042599 Ga0466706_253460 Ga0466706_253460_603_1688 361
127 3300042601 Ga0466707_039554 Ga0466707_039554_36_1121 361
128 3300042603 Ga0466714_078529 Ga0466714_078529_13402_14487 361
129 3300042603 Ga0466714_102387 Ga0466714_102387_278_1363 361
130 3300042612 Ga0466705_420380 Ga0466705_420380_501291_502376 361
131 3300042616 Ga0466715_042181 Ga0466715_042181_14941_16026 361
132 3300042619 Ga0466726_185141 Ga0466726_185141_3194_4279 361
133 3300042619 Ga0466726_488489 Ga0466726_488489_279_1364 361
134 3300042624 Ga0466735_040365 Ga0466735_040365_977_2062 361
135 iso_pr_bacteria 2529293168 2531451418 361
136 iso_pr_bacteria 2590828840 2593255538 361
137 iso_pr_bacteria 2593339125 2595065533 361
138 iso_pr_bacteria 2820250282 2820250740 361
139 iso_pr_bacteria 2820389254 2820390752 361
140 iso_pr_bacteria 2820507989 2820510064 361
141 iso_pr_bacteria 2852337885 2852338862 361
142 iso_pr_bacteria 2940221333 2940221417 361
143 iso_pr_bacteria 2940380068 2940384088 361
144 iso_pr_bacteria 2940386776 2940390711 361
145 iso_pr_bacteria 2940393498 2940397514 361
146 iso_pr_bacteria 2940400224 2940404246 361
147 iso_pr_bacteria 2940406939 2940410672 361
148 iso_pr_bacteria 2940413413 2940414086 361
149 iso_pr_bacteria 2940419646 2940421126 361
150 iso_pr_bacteria 2940425923 2940427394 361
151 3300002450 JGI24695J34938_10014698 JGI24695J34938_100146983 362
152 3300005083 Ga0068305_10038476 Ga0068305_1003847655 362
153 3300010167 Ga0123353_10288348 Ga0123353_102883482 362
154 3300012829 Ga0160467_102149 Ga0160467_1021492 362
155 3300042592 Ga0466693_046813 Ga0466693_046813_173_1261 362
156 3300042604 Ga0466717_251337 Ga0466717_251337_3707_4795 362
157 3300042606 Ga0466719_100305 Ga0466719_100305_1450_2538 362
158 3300042621 Ga0466729_053312 Ga0466729_053312_6959_8047 362
159 iso_pr_bacteria 2820127165 2820127504 362
160 3300005071 Ga0068302_10267900 Ga0068302_102679002 363
161 3300005083 Ga0068305_10005230 Ga0068305_100052308 363
162 3300010049 Ga0123356_10005297 Ga0123356_1000529719 363
163 3300010167 Ga0123353_10296235 Ga0123353_102962352 363
164 3300042603 Ga0466714_016908 Ga0466714_016908_142_1233 363
165 3300042609 Ga0466722_265288 Ga0466722_265288_1296_2387 363
166 3300042655 Ga0466727_343780 Ga0466727_343780_2709_3800 363
167 iso_pr_bacteria 2905310146 2905310648 363
168 2225789004 2227080788 2227453890 364
169 3300010049 Ga0123356_10061082 Ga0123356_100610822 364
170 3300010049 Ga0123356_10511675 Ga0123356_105116751 364
171 3300010167 Ga0123353_10041968 Ga0123353_100419684 364
172 3300012834 Ga0160452_100494 Ga0160452_10049417 364
173 3300042609 Ga0466722_255515 Ga0466722_255515_15474_16568 364
174 iso_pr_bacteria 2820347164 2820347312 364
175 3300042594 Ga0466694_355705 Ga0466694_355705_1359_2456 365
176 3300042601 Ga0466707_212548 Ga0466707_212548_13634_14731 365
177 3300042618 Ga0466723_270762 Ga0466723_270762_1265_2362 365
178 iso_pr_bacteria 2820290662 2820292033 365
179 iso_pr_bacteria 2820414148 2820416244 365
180 3300010167 Ga0123353_10136968 Ga0123353_101369684 366
181 3300042617 Ga0466718_100911 Ga0466718_100911_1119_2219 366
182 3300042622 Ga0466731_213729 Ga0466731_213729_84_1184 366
183 3300042643 Ga0466704_103189 Ga0466704_103189_55068_56168 366
184 iso_pr_bacteria 2820573558 2820575805 366
185 3300010049 Ga0123356_10008749 Ga0123356_100087497 367
186 3300010167 Ga0123353_10007775 Ga0123353_100077756 367
187 3300010167 Ga0123353_10176635 Ga0123353_101766353 367
188 3300042592 Ga0466693_223915 Ga0466693_223915_485_1588 367
189 3300010049 Ga0123356_10117996 Ga0123356_101179962 368
190 3300010167 Ga0123353_10316613 Ga0123353_103166132 368
191 3300042600 Ga0466700_111662 Ga0466700_111662_181_1287 368
192 3300042600 Ga0466700_313437 Ga0466700_313437_115_1221 368
193 iso_pr_bacteria 2820336130 2820338562 368
194 iso_pr_bacteria 2820362221 2820363646 368
195 iso_pr_bacteria 2820576413 2820578850 368
196 3300010049 Ga0123356_10015675 Ga0123356_100156755 369
197 3300042598 Ga0466701_035936 Ga0466701_035936_1837_2946 369
198 3300038395 Ga0415639_086145 Ga0415639_086145_638_1750 370
199 iso_pr_bacteria 2820551407 2820553486 370
200 iso_pr_bacteria 2820570671 2820572620 370
201 3300010049 Ga0123356_10000734 Ga0123356_1000073430 371
202 3300010049 Ga0123356_10282849 Ga0123356_102828492 371
203 iso_pr_bacteria 2781125661 2781333590 371
204 iso_pr_bacteria 2820252425 2820253507 371
205 3300010049 Ga0123356_10001527 Ga0123356_100015275 372
206 3300010049 Ga0123356_10000669 Ga0123356_1000066912 373
207 3300042606 Ga0466719_130485 Ga0466719_130485_1075_2196 373
208 iso_pr_bacteria 2820520043 2820520206 373
209 3300042617 Ga0466718_138813 Ga0466718_138813_189_1316 375
210 3300012841 Ga0160444_102529 Ga0160444_1025292 377
211 3300042636 Ga0466703_073311 Ga0466703_073311_21095_22231 378
212 3300010167 Ga0123353_10260955 Ga0123353_102609553 381
213 3300010167 Ga0123353_10210527 Ga0123353_102105273 386
214 3300042616 Ga0466715_640524 Ga0466715_640524_34119_35288 389
215 3300009826 Ga0123355_10032799 Ga0123355_100327995 398
216 3300042623 Ga0466734_102853 Ga0466734_102853_3339_4559 406

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 54 184 0.94
PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain 218 386 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.