Protein Family IF08615
Metagenome
Isolate
270
Members
192
Samples
148
Scaffolds
221.66
Avg Length
Representative Sequence
- ID
- 3300042622|Ga0466731_306108|Ga0466731_306108_388_1155
- Length
- 255 aa
- Sequence
- MDATFPVFCGQGDRVKKISYFYFLIRRQPMGIKIAPSILSADFAKLGEEVRKISDLGVDYIHIDVMDGNFVPNITIGPGVVSAIRKYSNLPFDVHLMIKSPGDHIESFINAGADIITIHAEAEIHLERLVRKIKSYKNVNDTRKTIQVGVSIVPSTSPSVLEYIIHELDIVLIMTVNPGFGGQEFIHSQLHKISVVRKMIEERNLKTQISVDGGVSALNAADIIKADADILVAGSAIFRAANTEKAINDLKNPSL
Sample Types
Isolate
45.2%
Metagenome
54.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Drosophilidae
16.0%
Termitidae
14.4%
Unclassified
12.8%
Cryptocercidae
6.4%
Formicidae
5.9%
Kalotermitidae
5.3%
Blaberidae
4.8%
Culicidae
4.3%
Blattellidae
3.7%
Pseudophyllodromiidae
2.7%
Apidae
2.7%
Tenebrionidae
2.7%
Corydiidae
1.6%
Psyllidae
1.1%
Pulicidae
1.1%
Passalidae
1.1%
Aphididae
1.1%
Termopsidae
1.1%
Ectobiidae
1.1%
Nyctiboridae
1.1%
Blattidae
1.1%
Nephropidae
1.1%
Delphacidae
0.5%
Pteromalidae
0.5%
Anaplectidae
0.5%
Noctuidae
0.5%
Silvanidae
0.5%
Lamproblattidae
0.5%
Cimicidae
0.5%
Cylisticidae
0.5%
Cerambycidae
0.5%
Tryonicidae
0.5%
Hodotermitidae
0.5%
Carposinidae
0.5%
Muscidae
0.5%
Armadillidiidae
0.5%
Taxonomy
Archaea
0
Bacteria
256
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 2 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 3 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 4 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 5 | 2896342394 | Wolbachia endosymbiont of Nilaparvata lugens wLug | Isolate | Delphacidae |
| 6 | 2513237282 | Wolbachia endosymbiont wVitB of Nasonia vitripennis | Isolate | Pteromalidae |
| 7 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 8 | 2540341171 | Wolbachia endosymbiont of Drosophila simulans wHa | Isolate | Drosophilidae |
| 9 | 2547132200 | Wolbachia sp (Diaphorina citri) | Isolate | Psyllidae |
| 10 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 11 | 2588253760 | Wolbachia endosymbiont wPip_Mol of Culex molestus | Isolate | Culicidae |
| 12 | 2619619280 | Wolbachia pipientis wAu | Isolate | Drosophilidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 637000340 | Wolbachia endosymbiont TRS of Brugia malayi | Isolate | Unclassified |
| 15 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 16 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 23 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 24 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 27 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 28 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 29 | 2884843004 | Wolbachia endosymbiont of Ctenocephalides felis wCfeT | Isolate | Pulicidae |
| 30 | 2848715743 | Wolbachia endosymbiont of Drosophila ananassae wAna_Indonesia | Isolate | Drosophilidae |
| 31 | 2896279687 | Wolbachia endosymbiont of Cardiocondyla obscurior wCobs-BR2009-alpha | Isolate | Formicidae |
| 32 | 2517572215 | Wolbachia endosymbiont of Drosophila suzukii wSuzi | Isolate | Drosophilidae |
| 33 | 2540341224 | Williamsoniiplasma luminosum ATCC 49195 | Isolate | Unclassified |
| 34 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 35 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 44 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 45 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 46 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 47 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 48 | 2834327606 | Wolbachia sp. wRi_2 | Isolate | Drosophilidae |
| 49 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 50 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 51 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 52 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 53 | 2884844624 | Wolbachia endosymbiont of Ctenocephalides felis wCfeJ | Isolate | Pulicidae |
| 54 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 55 | 2513237285 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 56 | 2585427698 | Occidentia massiliensis OS118 | Isolate | Unclassified |
| 57 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 58 | 2806310987 | Mesoplasma florum BARC 787 | Isolate | Unclassified |
| 59 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 60 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 61 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 62 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 63 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 64 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 65 | 2840666718 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 66 | 2843484624 | Wolbachia endosymbiont of Nomada ferruginata wNfe | Isolate | Apidae |
| 67 | 2845988041 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 68 | 2845999109 | Wolbachia endosymbiont of Nomada flava wNfla | Isolate | Apidae |
| 69 | 2846015620 | Wolbachia sp. wMel_KL | Isolate | Drosophilidae |
| 70 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 71 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 72 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 73 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 74 | 2568526663 | Wolbachia pipientis wMelPop | Isolate | Drosophilidae |
| 75 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 642555168 | Wolbachia endosymbiont of Culex quinquefasciatus Pel | Isolate | Culicidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 2993991113 | Shikimatogenerans silvanidophilus JKI-2014 | Isolate | Silvanidae |
| 81 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 82 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 83 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 84 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 85 | 3002821025 | Wolbachia endosymbiont of Pentalonia nigronervosa WolPenNig | Isolate | Aphididae |
| 86 | 3002825763 | Candidatus Wolbachia massiliensis PL13 | Isolate | Cimicidae |
| 87 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 88 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 89 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 90 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 91 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 92 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 93 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 94 | 2845997892 | Wolbachia sp. wMel_AMD | Isolate | Drosophilidae |
| 95 | 2846025955 | Wolbachia endosymbiont of Cylisticus convexus Wcon | Isolate | Cylisticidae |
| 96 | 2846028689 | Wolbachia endosymbiont of Nomada panzeri wNpa | Isolate | Apidae |
| 97 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 98 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 99 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 100 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 101 | 2718218474 | Wolbachia endosymbiont of Drosophila incompta wInc_SM | Isolate | Drosophilidae |
| 102 | 638341232 | Wolbachia endosymbiont of Drosophila ananassae | Isolate | Drosophilidae |
| 103 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 104 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 105 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 106 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 107 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 108 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 109 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 110 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 111 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 112 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 113 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 114 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 115 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 116 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 117 | 2834326310 | Wolbachia endosymbiont of Drosophila ananassae wAna_India | Isolate | Drosophilidae |
| 118 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 119 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 120 | 2840963544 | Wolbachia endosymbiont of Nomada leucophthalma wNleu | Isolate | Apidae |
| 121 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 122 | 2561511192 | Spiroplasma taiwanense CT-1 | Isolate | Culicidae |
| 123 | 2721755752 | Wolbachia endosymbiont of Drosophila incompta wInc_Cu | Isolate | Drosophilidae |
| 124 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 125 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 126 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 127 | 642979308 | Wolbachia endosymbiont of Culex quinquefasciatus JHB | Isolate | Culicidae |
| 128 | 643692055 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 129 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 130 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 131 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 132 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 133 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 134 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 135 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 136 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 137 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 138 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 139 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 140 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 141 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 142 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 143 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 144 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 145 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 146 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 147 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 148 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 149 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 150 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 151 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 152 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 153 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 154 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 155 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 156 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 157 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 158 | 3002025727 | Blattabacterium cuenoti EUPHYsp | Isolate | Pseudophyllodromiidae |
| 159 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 160 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 161 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 162 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 163 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 164 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 165 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 166 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 167 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 168 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 169 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 170 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 171 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 172 | 2843491798 | Wolbachia endosymbiont of Drosophila ananassae wAna_Hawaii | Isolate | Drosophilidae |
| 173 | 2884841417 | Wolbachia endosymbiont of Carposina sasakii wCauA | Isolate | Carposinidae |
| 174 | 2540341172 | Wolbachia endosymbiont of Drosophila simulans wNo | Isolate | Drosophilidae |
| 175 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 176 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 177 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 178 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 179 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 180 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 181 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 182 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 183 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 184 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 185 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 186 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 187 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 188 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 189 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 190 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 191 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 192 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10045317 | 3300009784 | Bacteria | 5967 |
| 2 | Ga0123356_10012209 | 3300010049 | Bacteria | 8349 |
| 3 | Ga0466715_233740 | 3300042616 | Unclassified | 2405 |
| 4 | Ga0160446_100113 | 3300012835 | Bacteria | 71976 |
| 5 | Ga0160443_102049 | 3300012848 | Bacteria | 5101 |
| 6 | Ga0309902_000011 | 3300028910 | Unclassified | 17710 |
| 7 | Ga0309904_1000034 | 3300029810 | Bacteria | 11200 |
| 8 | Ga0120204_000101 | 3300038942 | Bacteria | 4108 |
| 9 | Ga0466656_004977 | 3300042550 | Bacteria | 12839 |
| 10 | Ga0466657_355207 | 3300042582 | Bacteria | 6646 |
| 11 | Ga0466696_279012 | 3300042596 | Bacteria | 1708 |
| 12 | Ga0466700_322733 | 3300042600 | Bacteria | 3030 |
| 13 | IMNBL1DRAFT_c0000441 | 3300000062 | Bacteria | 34818 |
| 14 | JGI24705J35276_12213936 | 3300002504 | Bacteria | 1942 |
| 15 | Ga0127656_106831 | 3300009453 | Bacteria | 5819 |
| 16 | Ga0466697_106503 | 3300042611 | Bacteria | 1646 |
| 17 | Ga0466732_041734 | 3300042656 | Bacteria | 75299 |
| 18 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 19 | Ga0562378_2657 | 3300056814 | Bacteria | 13846 |
| 20 | Ga0562374_1818 | 3300057007 | Unclassified | 22812 |
| 21 | Ga0123356_10025417 | 3300010049 | Bacteria | 5567 |
| 22 | Ga0123356_10046767 | 3300010049 | Bacteria | 4026 |
| 23 | Ga0123356_11142289 | 3300010049 | Bacteria | 946 |
| 24 | Ga0123356_11580150 | 3300010049 | Bacteria | 811 |
| 25 | Ga0123353_10000881 | 3300010167 | Bacteria | 36574 |
| 26 | Ga0123353_10107009 | 3300010167 | Bacteria | 4506 |
| 27 | Ga0123354_10036940 | 3300010882 | Bacteria | 7611 |
| 28 | Ga0466708_083964 | 3300042652 | Bacteria | 36970 |
| 29 | Ga0466727_071993 | 3300042655 | Bacteria | 9088 |
| 30 | Ga0466727_145974 | 3300042655 | Bacteria | 7582 |
| 31 | Ga0160472_100015 | 3300012839 | Bacteria | 403883 |
| 32 | Ga0466657_203004 | 3300042582 | Bacteria | 2626 |
| 33 | Ga0466701_084025 | 3300042598 | Bacteria | 1038 |
| 34 | Ga0466706_102889 | 3300042599 | Bacteria | 104910 |
| 35 | Ga0466706_126281 | 3300042599 | Bacteria | 6339 |
| 36 | Ga0466719_514576 | 3300042606 | Bacteria | 1126 |
| 37 | JGI24702J35022_10001253 | 3300002462 | Bacteria | 15826 |
| 38 | JGI24705J35276_12237375 | 3300002504 | Bacteria | 10868 |
| 39 | WW0001_100065 | 3300002732 | Unclassified | 34386 |
| 40 | CVPL005W_1003775 | 3300002934 | Bacteria | 2540 |
| 41 | Ga0068305_10008178 | 3300005083 | Bacteria | 10869 |
| 42 | Ga0104050_1000499 | 3300007153 | Bacteria | 5470 |
| 43 | Ga0127655_1001095 | 3300009459 | Bacteria | 6525 |
| 44 | Ga0466733_045594 | 3300042659 | Bacteria | 1357 |
| 45 | Ga0562376_2685 | 3300056857 | Unclassified | 20466 |
| 46 | Ga0562376_4772 | 3300056857 | Bacteria | 10424 |
| 47 | Ga0123355_10000054 | 3300009826 | Bacteria | 118112 |
| 48 | Ga0123356_10565379 | 3300010049 | Bacteria | 1299 |
| 49 | Ga0123353_10104424 | 3300010167 | Bacteria | 4566 |
| 50 | Ga0466715_381400 | 3300042616 | Bacteria | 23596 |
| 51 | Ga0466709_123017 | 3300042648 | Unclassified | 21658 |
| 52 | Ga0255572_1000001 | 3300026175 | Bacteria | 634207 |
| 53 | Ga0466693_358406 | 3300042592 | Bacteria | 4808 |
| 54 | Ga0466706_096390 | 3300042599 | Bacteria | 1735 |
| 55 | Ga0466714_167951 | 3300042603 | Bacteria | 2889 |
| 56 | 2217918850 | 2209111014 | Bacteria | 69769 |
| 57 | 2227533799 | 2225789004 | Bacteria | 3102 |
| 58 | CVPL005L_10000004 | 3300002938 | Bacteria | 247297 |
| 59 | Ga0102734_1003825 | 3300007129 | Bacteria | 3401 |
| 60 | Ga0103264_1000041 | 3300007188 | Bacteria | 73656 |
| 61 | Ga0466733_009233 | 3300042659 | Bacteria | 1480 |
| 62 | Ga0562379_0085 | 3300056790 | Bacteria | 343095 |
| 63 | Ga0123355_10238030 | 3300009826 | Bacteria | 2585 |
| 64 | Ga0123356_10525620 | 3300010049 | Bacteria | 1342 |
| 65 | Ga0123353_10016145 | 3300010167 | Bacteria | 10896 |
| 66 | Ga0123353_10091152 | 3300010167 | Bacteria | 4910 |
| 67 | Ga0123353_10536176 | 3300010167 | Bacteria | 1693 |
| 68 | Ga0123354_10349170 | 3300010882 | Unclassified | 1321 |
| 69 | Ga0466703_227408 | 3300042636 | Bacteria | 3719 |
| 70 | Ga0466703_430886 | 3300042636 | Bacteria | 17829 |
| 71 | Ga0466727_105253 | 3300042655 | Bacteria | 1342 |
| 72 | Ga0466699_306308 | 3300042597 | Bacteria | 8098 |
| 73 | Ga0466701_062899 | 3300042598 | Bacteria | 3255 |
| 74 | Ga0466713_137226 | 3300042602 | Bacteria | 80436 |
| 75 | Ga0466714_013676 | 3300042603 | Bacteria | 8500 |
| 76 | Ga0466714_074198 | 3300042603 | Bacteria | 829090 |
| 77 | JGI24696J40584_12896529 | 3300002834 | Unclassified | 1160 |
| 78 | CVPL010W_10001139 | 3300002931 | Bacteria | 30625 |
| 79 | Ga0102734_1000846 | 3300007129 | Bacteria | 8082 |
| 80 | Ga0103264_1004902 | 3300007188 | Bacteria | 6739 |
| 81 | Ga0103268_1009869 | 3300007192 | Bacteria | 1985 |
| 82 | Ga0466705_107675 | 3300042612 | Bacteria | 1086 |
| 83 | Ga0466705_201574 | 3300042612 | Bacteria | 2904 |
| 84 | Ga0562379_0496 | 3300056790 | Bacteria | 79115 |
| 85 | Ga0562378_0063 | 3300056814 | Bacteria | 309476 |
| 86 | Ga0123353_10336783 | 3300010167 | Bacteria | 2281 |
| 87 | Ga0123354_10070589 | 3300010882 | Bacteria | 5050 |
| 88 | Ga0466728_057283 | 3300042620 | Bacteria | 1552 |
| 89 | Ga0466703_415911 | 3300042636 | Bacteria | 8244 |
| 90 | Ga0466719_269122 | 3300042606 | Bacteria | 7925 |
| 91 | IMNBL1DRAFT_c0000117 | 3300000062 | Bacteria | 71901 |
| 92 | Ga0072940_1329965 | 3300005200 | Bacteria | 1281 |
| 93 | Ga0466705_321026 | 3300042612 | Unclassified | 8212 |
| 94 | Ga0562374_1046 | 3300057007 | Bacteria | 36176 |
| 95 | Ga0123353_11188326 | 3300010167 | Bacteria | 1002 |
| 96 | Ga0466734_035264 | 3300042623 | Bacteria | 1342 |
| 97 | Ga0466735_156416 | 3300042624 | Bacteria | 16512 |
| 98 | Ga0466730_002648 | 3300042625 | Bacteria | 1373 |
| 99 | Ga0466696_189727 | 3300042596 | Bacteria | 10398 |
| 100 | Ga0466706_027441 | 3300042599 | Bacteria | 14712 |
| 101 | Ga0466707_115517 | 3300042601 | Bacteria | 2658 |
| 102 | Ga0466714_112072 | 3300042603 | Bacteria | 2427 |
| 103 | Ga0466717_230734 | 3300042604 | Unclassified | 1193 |
| 104 | Ga0466720_196216 | 3300042607 | Bacteria | 1811 |
| 105 | AglaG_contig16050 | 2084038013 | Bacteria | 2211 |
| 106 | 2227480177 | 2225789004 | Bacteria | 85772 |
| 107 | IMNBL1DRAFT_c0000410 | 3300000062 | Bacteria | 36299 |
| 108 | IMNBL1DRAFT_c0012793 | 3300000062 | Bacteria | 3811 |
| 109 | JGI24703J35330_11468843 | 3300002501 | Bacteria | 1061 |
| 110 | Ga0127649_113261 | 3300009460 | Bacteria | 17537 |
| 111 | Ga0466733_204569 | 3300042659 | Bacteria | 18235 |
| 112 | Ga0123355_10004418 | 3300009826 | Bacteria | 20446 |
| 113 | Ga0123353_10054469 | 3300010167 | Bacteria | 6396 |
| 114 | Ga0123353_10367034 | 3300010167 | Bacteria | 2160 |
| 115 | Ga0123353_10599322 | 3300010167 | Bacteria | 1575 |
| 116 | Ga0466731_306108 | 3300042622 | Bacteria | 13958 |
| 117 | Ga0466691_039123 | 3300042593 | Bacteria | 54215 |
| 118 | Ga0466701_088756 | 3300042598 | Bacteria | 87139 |
| 119 | Ga0466706_096426 | 3300042599 | Bacteria | 1271 |
| 120 | Ga0466700_118084 | 3300042600 | Bacteria | 1352 |
| 121 | 2227638494 | 2225789004 | Bacteria | 11161 |
| 122 | IMNBL1DRAFT_c0000004 | 3300000062 | Bacteria | 271062 |
| 123 | JGI24705J35276_12232645 | 3300002504 | Bacteria | 4424 |
| 124 | CVPL005W_1003077 | 3300002934 | Bacteria | 2926 |
| 125 | CVPL005L_10003286 | 3300002938 | Bacteria | 18109 |
| 126 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 127 | Ga0562375_1396 | 3300056856 | Bacteria | 33338 |
| 128 | Ga0562376_0761 | 3300056857 | Bacteria | 52773 |
| 129 | Ga0123357_10179545 | 3300009784 | Bacteria | 2476 |
| 130 | Ga0123355_10009635 | 3300009826 | Bacteria | 14718 |
| 131 | Ga0123355_10309335 | 3300009826 | Bacteria | 2144 |
| 132 | Ga0123355_10489495 | 3300009826 | Bacteria | 1524 |
| 133 | Ga0123356_10169397 | 3300010049 | Bacteria | 2193 |
| 134 | Ga0123353_10042770 | 3300010167 | Bacteria | 7170 |
| 135 | Ga0123353_10156040 | 3300010167 | Bacteria | 3638 |
| 136 | Ga0123353_10243827 | 3300010167 | Bacteria | 2790 |
| 137 | Ga0123354_10234866 | 3300010882 | Unclassified | 1905 |
| 138 | Ga0466728_039571 | 3300042620 | Bacteria | 11062 |
| 139 | Ga0309903_100011 | 3300029809 | Bacteria | 51837 |
| 140 | Ga0309903_100046 | 3300029809 | Unclassified | 6344 |
| 141 | Ga0309904_1000366 | 3300029810 | Unclassified | 3694 |
| 142 | Ga0466701_099968 | 3300042598 | Bacteria | 1061 |
| 143 | Ga0466706_216003 | 3300042599 | Bacteria | 119342 |
| 144 | Ga0466707_260043 | 3300042601 | Bacteria | 20986 |
| 145 | Ga0466719_151914 | 3300042606 | Bacteria | 1697 |
| 146 | Ga0466698_505588 | 3300042610 | Bacteria | 9943 |
| 147 | Ga0104147_1036359 | 3300007224 | Bacteria | 5911 |
| 148 | Ga0127649_101337 | 3300009460 | Unclassified | 9608 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007188 | Ga0103264_1000041 | Ga0103264_100004112 | 196 |
| 2 | 3300002934 | CVPL005W_1003775 | CVPL005W_10037752 | 197 |
| 3 | 3300042601 | Ga0466707_260043 | Ga0466707_260043_12259_12909 | 198 |
| 4 | 3300042603 | Ga0466714_167951 | Ga0466714_167951_1670_2335 | 203 |
| 5 | 3300010049 | Ga0123356_10169397 | Ga0123356_101693972 | 205 |
| 6 | 3300042603 | Ga0466714_112072 | Ga0466714_112072_1348_2013 | 205 |
| 7 | 3300042582 | Ga0466657_355207 | Ga0466657_355207_2592_3287 | 206 |
| 8 | 3300042656 | Ga0466732_041734 | Ga0466732_041734_52661_53287 | 208 |
| 9 | 3300042599 | Ga0466706_126281 | Ga0466706_126281_4540_5169 | 209 |
| 10 | 3300007129 | Ga0102734_1000846 | Ga0102734_10008466 | 210 |
| 11 | 3300028910 | Ga0309902_000011 | Ga0309902_000011_9666_10346 | 210 |
| 12 | 3300029809 | Ga0309903_100046 | Ga0309903_1000469 | 210 |
| 13 | 3300042550 | Ga0466656_004977 | Ga0466656_004977_11998_12678 | 210 |
| 14 | 3300042616 | Ga0466715_233740 | Ga0466715_233740_204_884 | 210 |
| 15 | 3300042603 | Ga0466714_074198 | Ga0466714_074198_712563_713198 | 211 |
| 16 | 3300042597 | Ga0466699_306308 | Ga0466699_306308_5172_5810 | 212 |
| 17 | 3300029810 | Ga0309904_1000366 | Ga0309904_10003662 | 213 |
| 18 | 3300042655 | Ga0466727_105253 | Ga0466727_105253_593_1234 | 213 |
| 19 | 2225789004 | 2227480177 | 2227938439 | 214 |
| 20 | 3300042599 | Ga0466706_096426 | Ga0466706_096426_341_985 | 214 |
| 21 | 3300042623 | Ga0466734_035264 | Ga0466734_035264_340_984 | 214 |
| 22 | 3300042624 | Ga0466735_156416 | Ga0466735_156416_10988_11683 | 214 |
| 23 | 3300042655 | Ga0466727_071993 | Ga0466727_071993_2347_2991 | 214 |
| 24 | 3300000062 | IMNBL1DRAFT_c0000117 | IMNBL1DRAFT_000011781 | 215 |
| 25 | 3300000062 | IMNBL1DRAFT_c0000410 | IMNBL1DRAFT_000041018 | 215 |
| 26 | 3300000062 | IMNBL1DRAFT_c0012793 | IMNBL1DRAFT_00127933 | 215 |
| 27 | 3300042599 | Ga0466706_027441 | Ga0466706_027441_3023_3670 | 215 |
| 28 | 3300042659 | Ga0466733_009233 | Ga0466733_009233_742_1389 | 215 |
| 29 | 3300042659 | Ga0466733_204569 | Ga0466733_204569_835_1482 | 215 |
| 30 | iso_pr_bacteria | 2636416028 | 2638994189 | 215 |
| 31 | iso_pr_bacteria | 2820533259 | 2820533306 | 215 |
| 32 | iso_pr_bacteria | 2820789850 | 2820790069 | 215 |
| 33 | iso_pr_bacteria | 3002023891 | 3002024186 | 215 |
| 34 | iso_pr_bacteria | 3002025727 | 3002025967 | 215 |
| 35 | 3300007153 | Ga0104050_1000499 | Ga0104050_100049910 | 216 |
| 36 | 3300007224 | Ga0104147_1036359 | Ga0104147_10363598 | 216 |
| 37 | 3300009826 | Ga0123355_10000054 | Ga0123355_10000054110 | 216 |
| 38 | 3300009826 | Ga0123355_10004418 | Ga0123355_1000441813 | 216 |
| 39 | 3300042596 | Ga0466696_279012 | Ga0466696_279012_408_1058 | 216 |
| 40 | 3300042606 | Ga0466719_514576 | Ga0466719_514576_86_736 | 216 |
| 41 | 3300042612 | Ga0466705_201574 | Ga0466705_201574_715_1365 | 216 |
| 42 | 3300042636 | Ga0466703_430886 | Ga0466703_430886_7873_8523 | 216 |
| 43 | 3300042648 | Ga0466709_123017 | Ga0466709_123017_10406_11095 | 216 |
| 44 | iso_pr_bacteria | 2695420931 | 2698108836 | 216 |
| 45 | iso_pr_bacteria | 2820516196 | 2820516666 | 216 |
| 46 | iso_pr_bacteria | 2940228231 | 2940228753 | 216 |
| 47 | iso_pr_bacteria | 3002025161 | 3002025431 | 216 |
| 48 | 3300002501 | JGI24703J35330_11468843 | JGI24703J35330_114688431 | 217 |
| 49 | 3300009826 | Ga0123355_10238030 | Ga0123355_102380303 | 217 |
| 50 | 3300009826 | Ga0123355_10489495 | Ga0123355_104894951 | 217 |
| 51 | 3300010049 | Ga0123356_11142289 | Ga0123356_111422891 | 217 |
| 52 | 3300010167 | Ga0123353_10367034 | Ga0123353_103670343 | 217 |
| 53 | 3300010167 | Ga0123353_11188326 | Ga0123353_111883262 | 217 |
| 54 | 3300010882 | Ga0123354_10036940 | Ga0123354_100369402 | 217 |
| 55 | 3300042593 | Ga0466691_039123 | Ga0466691_039123_31908_32561 | 217 |
| 56 | 3300042620 | Ga0466728_057283 | Ga0466728_057283_114_767 | 217 |
| 57 | iso_pr_bacteria | 2518645548 | 2518801758 | 217 |
| 58 | iso_pr_bacteria | 3002002099 | 3002002389 | 217 |
| 59 | iso_pr_bacteria | 3002004631 | 3002004906 | 217 |
| 60 | iso_pr_bacteria | 3002005847 | 3002006141 | 217 |
| 61 | iso_pr_bacteria | 3002007112 | 3002007406 | 217 |
| 62 | iso_pr_bacteria | 3002007740 | 3002008033 | 217 |
| 63 | iso_pr_bacteria | 3002008367 | 3002008661 | 217 |
| 64 | iso_pr_bacteria | 3002023256 | 3002023554 | 217 |
| 65 | iso_pr_bacteria | 3002024525 | 3002024823 | 217 |
| 66 | iso_pr_bacteria | 3002027480 | 3002027782 | 217 |
| 67 | iso_pr_bacteria | 3002030550 | 3002030847 | 217 |
| 68 | iso_pr_bacteria | 3002031185 | 3002031483 | 217 |
| 69 | iso_pr_bacteria | 3002031819 | 3002032093 | 217 |
| 70 | iso_pr_bacteria | 3002033046 | 3002033342 | 217 |
| 71 | iso_pr_bacteria | 8071415077 | 8071415374 | 217 |
| 72 | 2225789004 | 2227533799 | 2228048272 | 218 |
| 73 | 3300005083 | Ga0068305_10008178 | Ga0068305_100081783 | 218 |
| 74 | 3300010049 | Ga0123356_11580150 | Ga0123356_115801501 | 218 |
| 75 | 3300010167 | Ga0123353_10107009 | Ga0123353_101070092 | 218 |
| 76 | 3300010167 | Ga0123353_10336783 | Ga0123353_103367833 | 218 |
| 77 | 3300042582 | Ga0466657_203004 | Ga0466657_203004_1432_2088 | 218 |
| 78 | 3300042602 | Ga0466713_137226 | Ga0466713_137226_6770_7426 | 218 |
| 79 | 3300042606 | Ga0466719_269122 | Ga0466719_269122_6695_7351 | 218 |
| 80 | iso_pr_bacteria | 2511231112 | 2511677511 | 218 |
| 81 | iso_pr_bacteria | 2833030225 | 2833030560 | 218 |
| 82 | iso_pr_bacteria | 2833033236 | 2833033581 | 218 |
| 83 | iso_pr_bacteria | 2833033875 | 2833034211 | 218 |
| 84 | iso_pr_bacteria | 2833034481 | 2833034812 | 218 |
| 85 | iso_pr_bacteria | 2833037493 | 2833037827 | 218 |
| 86 | iso_pr_bacteria | 2833042786 | 2833043123 | 218 |
| 87 | iso_pr_bacteria | 2833043393 | 2833043732 | 218 |
| 88 | iso_pr_bacteria | 2833044002 | 2833044333 | 218 |
| 89 | iso_pr_bacteria | 2833047020 | 2833047354 | 218 |
| 90 | iso_pr_bacteria | 2833050843 | 2833051180 | 218 |
| 91 | iso_pr_bacteria | 2833051446 | 2833051782 | 218 |
| 92 | iso_pr_bacteria | 3002004002 | 3002004289 | 218 |
| 93 | iso_pr_bacteria | 3002022645 | 3002022928 | 218 |
| 94 | 3300000062 | IMNBL1DRAFT_c0000441 | IMNBL1DRAFT_000044126 | 219 |
| 95 | 3300005083 | Ga0068305_10000087 | Ga0068305_10000087364 | 219 |
| 96 | 3300005200 | Ga0072940_1329965 | Ga0072940_13299652 | 219 |
| 97 | 3300010049 | Ga0123356_10025417 | Ga0123356_100254174 | 219 |
| 98 | 3300010167 | Ga0123353_10091152 | Ga0123353_100911526 | 219 |
| 99 | iso_pr_bacteria | 2576861701 | 2579268155 | 219 |
| 100 | iso_pr_bacteria | 3002003370 | 3002003659 | 219 |
| 101 | iso_pr_bacteria | 3002005207 | 3002005503 | 219 |
| 102 | iso_pr_bacteria | 3002028747 | 3002029033 | 219 |
| 103 | 2084038013 | AglaG_contig16050 | AglaG_04600360 | 220 |
| 104 | 3300002504 | JGI24705J35276_12213936 | JGI24705J35276_122139363 | 220 |
| 105 | 3300010167 | Ga0123353_10104424 | Ga0123353_101044244 | 220 |
| 106 | 3300010882 | Ga0123354_10349170 | Ga0123354_103491702 | 220 |
| 107 | 3300042598 | Ga0466701_088756 | Ga0466701_088756_79380_80042 | 220 |
| 108 | 3300042599 | Ga0466706_096390 | Ga0466706_096390_79_741 | 220 |
| 109 | 3300042610 | Ga0466698_505588 | Ga0466698_505588_6790_7470 | 220 |
| 110 | 3300056790 | Ga0562379_0016 | Ga0562379_0016_258441_259103 | 220 |
| 111 | 3300056790 | Ga0562379_0085 | Ga0562379_0085_62480_63142 | 220 |
| 112 | 3300056790 | Ga0562379_0496 | Ga0562379_0496_70073_70735 | 220 |
| 113 | 3300056814 | Ga0562378_0063 | Ga0562378_0063_280360_281022 | 220 |
| 114 | 3300056814 | Ga0562378_2657 | Ga0562378_2657_4735_5397 | 220 |
| 115 | 3300056857 | Ga0562376_0761 | Ga0562376_0761_44877_45539 | 220 |
| 116 | 3300056857 | Ga0562376_2685 | Ga0562376_2685_19030_19692 | 220 |
| 117 | 3300056857 | Ga0562376_4772 | Ga0562376_4772_2662_3324 | 220 |
| 118 | 3300057007 | Ga0562374_1046 | Ga0562374_1046_8517_9179 | 220 |
| 119 | 3300057007 | Ga0562374_1818 | Ga0562374_1818_789_1451 | 220 |
| 120 | iso_pr_bacteria | 2820451402 | 2820451431 | 220 |
| 121 | iso_pr_bacteria | 3002026254 | 3002026530 | 220 |
| 122 | iso_pr_bacteria | 3002028123 | 3002028413 | 220 |
| 123 | iso_pr_bacteria | 3002029927 | 3002030219 | 220 |
| 124 | iso_pr_bacteria | 3002032411 | 3002032707 | 220 |
| 125 | iso_pr_bacteria | 8012935351 | 8012936493 | 220 |
| 126 | 3300000062 | IMNBL1DRAFT_c0000004 | IMNBL1DRAFT_00000047 | 221 |
| 127 | 3300002834 | JGI24696J40584_12896529 | JGI24696J40584_128965291 | 221 |
| 128 | 3300010167 | Ga0123353_10000881 | Ga0123353_1000088130 | 221 |
| 129 | 3300010882 | Ga0123354_10234866 | Ga0123354_102348661 | 221 |
| 130 | 3300042599 | Ga0466706_102889 | Ga0466706_102889_63306_63971 | 221 |
| 131 | 3300042603 | Ga0466714_013676 | Ga0466714_013676_7336_8001 | 221 |
| 132 | 3300056856 | Ga0562375_1396 | Ga0562375_1396_18029_18694 | 221 |
| 133 | iso_pr_bacteria | 2858110640 | 2858110913 | 221 |
| 134 | iso_pr_bacteria | 2967491045 | 2967491976 | 221 |
| 135 | iso_pr_bacteria | 3001995318 | 3001995613 | 221 |
| 136 | iso_pr_bacteria | 3002002726 | 3002003025 | 221 |
| 137 | iso_pr_bacteria | 3002006476 | 3002006771 | 221 |
| 138 | iso_pr_bacteria | 3002008998 | 3002009297 | 221 |
| 139 | iso_pr_bacteria | 650716011 | 650720115 | 221 |
| 140 | iso_pr_bacteria | 651324002 | 651580041 | 221 |
| 141 | 3300007192 | Ga0103268_1009869 | Ga0103268_10098692 | 222 |
| 142 | 3300009784 | Ga0123357_10045317 | Ga0123357_100453172 | 222 |
| 143 | 3300009826 | Ga0123355_10309335 | Ga0123355_103093353 | 222 |
| 144 | 3300010167 | Ga0123353_10536176 | Ga0123353_105361762 | 222 |
| 145 | 3300042655 | Ga0466727_145974 | Ga0466727_145974_557_1225 | 222 |
| 146 | iso_pr_bacteria | 2540341224 | 2540962333 | 222 |
| 147 | iso_pr_bacteria | 2551306396 | 2552922591 | 222 |
| 148 | iso_pr_bacteria | 2983866074 | 2983866826 | 222 |
| 149 | 3300010049 | Ga0123356_10046767 | Ga0123356_100467672 | 223 |
| 150 | 3300042592 | Ga0466693_358406 | Ga0466693_358406_518_1189 | 223 |
| 151 | 3300042659 | Ga0466733_045594 | Ga0466733_045594_664_1335 | 223 |
| 152 | iso_pr_bacteria | 2597490292 | 2598961645 | 223 |
| 153 | iso_pr_bacteria | 2834852038 | 2834853298 | 223 |
| 154 | iso_pr_bacteria | 2854518031 | 2854518196 | 223 |
| 155 | iso_pr_bacteria | 2854548700 | 2854549746 | 223 |
| 156 | iso_pr_bacteria | 2858102877 | 2858103382 | 223 |
| 157 | iso_pr_bacteria | 2858119979 | 2858122218 | 223 |
| 158 | iso_pr_bacteria | 2858129007 | 2858130575 | 223 |
| 159 | iso_pr_bacteria | 2868677537 | 2868678037 | 223 |
| 160 | 2209111014 | 2217918850 | 2217810181 | 224 |
| 161 | 3300002931 | CVPL010W_10001139 | CVPL010W_1000113912 | 224 |
| 162 | 3300007129 | Ga0102734_1003825 | Ga0102734_10038252 | 224 |
| 163 | 3300009784 | Ga0123357_10179545 | Ga0123357_101795452 | 224 |
| 164 | 3300010882 | Ga0123354_10070589 | Ga0123354_100705892 | 224 |
| 165 | 3300026175 | Ga0255572_1000001 | Ga0255572_1000001146 | 224 |
| 166 | 3300038942 | Ga0120204_000101 | Ga0120204_000101_718_1392 | 224 |
| 167 | 3300042596 | Ga0466696_189727 | Ga0466696_189727_4814_5488 | 224 |
| 168 | 3300042611 | Ga0466697_106503 | Ga0466697_106503_64_738 | 224 |
| 169 | iso_pr_bacteria | 2540341172 | 2540828763 | 224 |
| 170 | iso_pr_bacteria | 2547132200 | 2547772446 | 224 |
| 171 | iso_pr_bacteria | 2561511192 | 2562427477 | 224 |
| 172 | iso_pr_bacteria | 2585427698 | 2586252862 | 224 |
| 173 | iso_pr_bacteria | 2588253760 | 2588633094 | 224 |
| 174 | iso_pr_bacteria | 2806310987 | 2808320942 | 224 |
| 175 | iso_pr_bacteria | 2816332478 | 2818027741 | 224 |
| 176 | iso_pr_bacteria | 2820580397 | 2820580654 | 224 |
| 177 | iso_pr_bacteria | 2854536247 | 2854539946 | 224 |
| 178 | iso_pr_bacteria | 2858089842 | 2858091285 | 224 |
| 179 | iso_pr_bacteria | 2884843004 | 2884844467 | 224 |
| 180 | iso_pr_bacteria | 2993991113 | 2993992459 | 224 |
| 181 | iso_pr_bacteria | 3002821025 | 3002822378 | 224 |
| 182 | iso_pr_bacteria | 642555168 | 642696395 | 224 |
| 183 | iso_pr_bacteria | 642979308 | 643188426 | 224 |
| 184 | 3300002934 | CVPL005W_1003077 | CVPL005W_10030773 | 225 |
| 185 | 3300007188 | Ga0103264_1004902 | Ga0103264_10049027 | 225 |
| 186 | 3300009453 | Ga0127656_106831 | Ga0127656_1068317 | 225 |
| 187 | 3300009459 | Ga0127655_1001095 | Ga0127655_10010954 | 225 |
| 188 | 3300010049 | Ga0123356_10012209 | Ga0123356_100122095 | 225 |
| 189 | 3300010049 | Ga0123356_10565379 | Ga0123356_105653792 | 225 |
| 190 | 3300042598 | Ga0466701_062899 | Ga0466701_062899_1362_2039 | 225 |
| 191 | 3300042601 | Ga0466707_115517 | Ga0466707_115517_1701_2378 | 225 |
| 192 | iso_pr_bacteria | 2568526663 | 2570726442 | 225 |
| 193 | iso_pr_bacteria | 2619619280 | 2621227483 | 225 |
| 194 | iso_pr_bacteria | 2718218474 | 2721605442 | 225 |
| 195 | iso_pr_bacteria | 2721755752 | 2723833119 | 225 |
| 196 | iso_pr_bacteria | 2820223845 | 2820225495 | 225 |
| 197 | iso_pr_bacteria | 2827179085 | 2827183224 | 225 |
| 198 | iso_pr_bacteria | 2845997892 | 2845997987 | 225 |
| 199 | iso_pr_bacteria | 2846015620 | 2846015719 | 225 |
| 200 | iso_pr_bacteria | 2854520951 | 2854521720 | 225 |
| 201 | iso_pr_bacteria | 651324000 | 651475914 | 225 |
| 202 | 3300002462 | JGI24702J35022_10001253 | JGI24702J35022_100012539 | 226 |
| 203 | 3300010167 | Ga0123353_10156040 | Ga0123353_101560403 | 226 |
| 204 | 3300042600 | Ga0466700_322733 | Ga0466700_322733_369_1049 | 226 |
| 205 | 3300042612 | Ga0466705_321026 | Ga0466705_321026_712_1392 | 226 |
| 206 | 3300042636 | Ga0466703_227408 | Ga0466703_227408_1380_2060 | 226 |
| 207 | 3300042636 | Ga0466703_415911 | Ga0466703_415911_5941_6621 | 226 |
| 208 | iso_pr_bacteria | 2513237282 | 2514344631 | 226 |
| 209 | iso_pr_bacteria | 2513237285 | 2514349770 | 226 |
| 210 | iso_pr_bacteria | 2517572215 | 2518166591 | 226 |
| 211 | iso_pr_bacteria | 2540341171 | 2540827739 | 226 |
| 212 | iso_pr_bacteria | 2834326310 | 2834326913 | 226 |
| 213 | iso_pr_bacteria | 2834327606 | 2834327884 | 226 |
| 214 | iso_pr_bacteria | 2840666718 | 2840666727 | 226 |
| 215 | iso_pr_bacteria | 2840963544 | 2840965060 | 226 |
| 216 | iso_pr_bacteria | 2843484624 | 2843485100 | 226 |
| 217 | iso_pr_bacteria | 2843491798 | 2843492425 | 226 |
| 218 | iso_pr_bacteria | 2845988041 | 2845988171 | 226 |
| 219 | iso_pr_bacteria | 2845999109 | 2846000517 | 226 |
| 220 | iso_pr_bacteria | 2846025955 | 2846026973 | 226 |
| 221 | iso_pr_bacteria | 2846028689 | 2846030180 | 226 |
| 222 | iso_pr_bacteria | 2848715743 | 2848716879 | 226 |
| 223 | iso_pr_bacteria | 2884841417 | 2884842588 | 226 |
| 224 | iso_pr_bacteria | 2896279687 | 2896280242 | 226 |
| 225 | iso_pr_bacteria | 2896342394 | 2896342980 | 226 |
| 226 | iso_pr_bacteria | 3002026852 | 3002027146 | 226 |
| 227 | iso_pr_bacteria | 3002825763 | 3002827027 | 226 |
| 228 | iso_pr_bacteria | 637000340 | 637629879 | 226 |
| 229 | iso_pr_bacteria | 638341232 | 638477894 | 226 |
| 230 | iso_pr_bacteria | 643692055 | 643740055 | 226 |
| 231 | 2225789004 | 2227638494 | 2228226626 | 227 |
| 232 | 3300002732 | WW0001_100065 | WW0001_10006527 | 227 |
| 233 | 3300002938 | CVPL005L_10003286 | CVPL005L_1000328612 | 227 |
| 234 | 3300009460 | Ga0127649_101337 | Ga0127649_1013372 | 227 |
| 235 | 3300010167 | Ga0123353_10042770 | Ga0123353_100427706 | 227 |
| 236 | 3300010167 | Ga0123353_10599322 | Ga0123353_105993222 | 227 |
| 237 | 3300042606 | Ga0466719_151914 | Ga0466719_151914_477_1160 | 227 |
| 238 | iso_pr_bacteria | 2835143510 | 2835145577 | 227 |
| 239 | iso_pr_bacteria | 2839785767 | 2839789304 | 227 |
| 240 | 3300002938 | CVPL005L_10000004 | CVPL005L_1000000446 | 228 |
| 241 | 3300009826 | Ga0123355_10009635 | Ga0123355_100096355 | 228 |
| 242 | 3300029809 | Ga0309903_100011 | Ga0309903_10001117 | 228 |
| 243 | iso_pr_bacteria | 2884844624 | 2884845276 | 228 |
| 244 | 3300029810 | Ga0309904_1000034 | Ga0309904_10000347 | 229 |
| 245 | 3300042598 | Ga0466701_084025 | Ga0466701_084025_316_1005 | 229 |
| 246 | 3300042616 | Ga0466715_381400 | Ga0466715_381400_2899_3588 | 229 |
| 247 | iso_pr_bacteria | 2820234266 | 2820235119 | 229 |
| 248 | 3300010167 | Ga0123353_10016145 | Ga0123353_100161453 | 230 |
| 249 | 3300042625 | Ga0466730_002648 | Ga0466730_002648_176_868 | 230 |
| 250 | 3300009460 | Ga0127649_113261 | Ga0127649_11326112 | 231 |
| 251 | 3300012835 | Ga0160446_100113 | Ga0160446_10011347 | 231 |
| 252 | 3300012839 | Ga0160472_100015 | Ga0160472_100015288 | 231 |
| 253 | iso_pr_bacteria | 2806310572 | 2806769578 | 231 |
| 254 | 3300002504 | JGI24705J35276_12237375 | JGI24705J35276_122373757 | 233 |
| 255 | 3300042604 | Ga0466717_230734 | Ga0466717_230734_461_1162 | 233 |
| 256 | 3300042612 | Ga0466705_107675 | Ga0466705_107675_303_1004 | 233 |
| 257 | 3300002504 | JGI24705J35276_12232645 | JGI24705J35276_122326456 | 234 |
| 258 | 3300012848 | Ga0160443_102049 | Ga0160443_1020494 | 234 |
| 259 | 3300042600 | Ga0466700_118084 | Ga0466700_118084_136_840 | 234 |
| 260 | 3300010167 | Ga0123353_10054469 | Ga0123353_100544693 | 236 |
| 261 | 3300010167 | Ga0123353_10243827 | Ga0123353_102438273 | 236 |
| 262 | 3300042598 | Ga0466701_099968 | Ga0466701_099968_130_840 | 236 |
| 263 | iso_pr_bacteria | 2820094617 | 2820094708 | 236 |
| 264 | iso_pr_bacteria | 8067483258 | 8067487121 | 238 |
| 265 | 3300010049 | Ga0123356_10525620 | Ga0123356_105256201 | 239 |
| 266 | 3300042652 | Ga0466708_083964 | Ga0466708_083964_8574_9308 | 244 |
| 267 | 3300042620 | Ga0466728_039571 | Ga0466728_039571_6795_7562 | 245 |
| 268 | 3300042599 | Ga0466706_216003 | Ga0466706_216003_96925_97674 | 249 |
| 269 | 3300042607 | Ga0466720_196216 | Ga0466720_196216_169_918 | 249 |
| 270 | 3300042622 | Ga0466731_306108 | Ga0466731_306108_388_1155 | 255 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00834 | Ribul_P_3_epim | Ribulose-phosphate 3 epimerase family | 33 | 238 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.