Protein Family IF08603

Metagenome Isolate
203 Members
48 Samples
201 Scaffolds
328.94 Avg Length

🧬 Representative Sequence

ID
3300042622|Ga0466731_198671|Ga0466731_198671_1922_3076
Length
384 aa
Sequence
MGFKRTWSWVSAEDLGLDIVGIIKKPSSLVNDKSSWYFRVMPVKTAPGYLASFLDRLQQLTESYLSYRKRKILVRKEKQKKKNVLRDWLEAFLWAAGMVLLINQYLFQAYQIPSGSMIDTLLIGDRIFVNKTVYGPELLPGFGKLPSPVKPKRNDVIIFENPSYISRGTAFDIVQRIIYMLTLTMVDINRDEHGQPRAQFLIKRAAGMGGDRFIQEQGYMRFRPAGESRWIDENEFREQRAMAHNLIRLMDESAYPALEAAGRAAGYRDIGLPVPASLQAQASAASRIEFPDYIAHEKARLETLRGAFPHESRYSVLLARHNQGYYVPETRIMPLGDSRDNSRDGRYFGPVAYSKILGKGAIVYWPGEFRTKRFGAFQRFGAIR

📊 Sample Types

Isolate 1.0%
Metagenome 99.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.3%
Kalotermitidae 30.4%
Rhinotermitidae 8.7%
Unclassified 8.7%
Termopsidae 6.5%
Hodotermitidae 2.2%
Blaberidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 193
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
26 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
29 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
30 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
31 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 2772190975 Treponema sp. RmG30 Isolate Blaberidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_050485 3300042612 Bacteria 7423
2 Ga0466705_196488 3300042612 Bacteria 6297
3 Ga0466732_100504 3300042656 Bacteria 7132
4 Ga0466715_001062 3300042616 Bacteria 1799
5 Ga0466715_091879 3300042616 Bacteria 83726
6 Ga0466718_043885 3300042617 Unclassified 1951
7 Ga0466718_119801 3300042617 Bacteria 6113
8 Ga0466729_008786 3300042621 Bacteria 1277
9 Ga0466690_028902 3300042590 Bacteria 2190
10 Ga0466691_130702 3300042593 Bacteria 35179
11 Ga0466691_137511 3300042593 Bacteria 3468
12 Ga0466694_144469 3300042594 Bacteria 1926
13 Ga0123357_10209146 3300009784 Bacteria 2197
14 Ga0123353_10007623 3300010167 Bacteria 14667
15 Ga0072940_1203681 3300005200 Unclassified 2930
16 Ga0466713_040273 3300042602 Bacteria 1815
17 Ga0466713_065048 3300042602 Bacteria 4678
18 Ga0466720_087531 3300042607 Bacteria 9926
19 Ga0466722_011431 3300042609 Bacteria 3513
20 Ga0466698_039739 3300042610 Bacteria 2293
21 Ga0466703_026456 3300042636 Bacteria 8006
22 Ga0466703_364328 3300042636 Bacteria 4874
23 Ga0466704_552175 3300042643 Bacteria 3805
24 Ga0466709_206117 3300042648 Bacteria 1210
25 Ga0466709_356593 3300042648 Bacteria 6710
26 Ga0466708_120289 3300042652 Bacteria 12515
27 Ga0466708_333299 3300042652 Bacteria 1533
28 Ga0466727_235316 3300042655 Bacteria 6867
29 Ga0466705_506932 3300042612 Bacteria 4416
30 Ga0466712_157083 3300042614 Bacteria 6046
31 Ga0466711_146423 3300042615 Bacteria 13229
32 Ga0466715_085266 3300042616 Bacteria 14198
33 Ga0466718_044412 3300042617 Bacteria 3759
34 Ga0466718_154204 3300042617 Bacteria 1957
35 Ga0466726_120361 3300042619 Bacteria 14893
36 Ga0466726_460321 3300042619 Bacteria 2228
37 Ga0466726_475920 3300042619 Bacteria 3943
38 Ga0415639_100080 3300038395 Bacteria 4310
39 Ga0466696_051225 3300042596 Bacteria 5250
40 Ga0123357_10104839 3300009784 Bacteria 3629
41 AustNasuHG_c1000552 3300000089 Bacteria 13157
42 JGI24702J35022_10004450 3300002462 Bacteria 8320
43 Ga0466700_113532 3300042600 Bacteria 1127
44 Ga0466716_074062 3300042605 Bacteria 4510
45 Ga0466716_297581 3300042605 Bacteria 3560
46 Ga0466719_347973 3300042606 Bacteria 4193
47 Ga0466719_507080 3300042606 Bacteria 12712
48 Ga0466722_036364 3300042609 Bacteria 10739
49 Ga0466722_108259 3300042609 Bacteria 11379
50 Ga0466703_371941 3300042636 Bacteria 5101
51 Ga0466704_114169 3300042643 Bacteria 1604
52 Ga0466705_062691 3300042612 Bacteria 11161
53 Ga0466732_412089 3300042656 Unclassified 3139
54 Ga0466712_023729 3300042614 Unclassified 10246
55 Ga0466712_040335 3300042614 Bacteria 8452
56 Ga0466715_619875 3300042616 Bacteria 4535
57 Ga0466723_143114 3300042618 Bacteria 2571
58 Ga0466726_427243 3300042619 Bacteria 17847
59 Ga0264413_121215 3300024493 Bacteria 7067
60 Ga0466692_171013 3300042591 Bacteria 10749
61 Ga0466696_297210 3300042596 Bacteria 7106
62 Ga0123353_10083984 3300010167 Bacteria 5126
63 Ga0466704_094942 3300042643 Bacteria 57318
64 Ga0466704_239099 3300042643 Bacteria 4991
65 Ga0466727_177987 3300042655 Bacteria 3700
66 Ga0466727_332810 3300042655 Bacteria 1981
67 Ga0466705_525528 3300042612 Bacteria 8756
68 Ga0466712_055581 3300042614 Bacteria 2001
69 Ga0466712_078961 3300042614 Bacteria 1827
70 Ga0466715_316211 3300042616 Bacteria 16355
71 Ga0466723_130527 3300042618 Bacteria 8168
72 Ga0466726_340371 3300042619 Bacteria 1256
73 Ga0466728_004738 3300042620 Bacteria 32651
74 Ga0466728_160193 3300042620 Bacteria 15278
75 Ga0466728_408412 3300042620 Bacteria 2849
76 Ga0466692_096352 3300042591 Bacteria 1412
77 Ga0466691_044438 3300042593 Bacteria 3321
78 Ga0123354_10079986 3300010882 Bacteria 4631
79 JGI24698J34947_10034046 3300002449 Bacteria 2669
80 Ga0466720_160418 3300042607 Bacteria 7190
81 Ga0466722_046250 3300042609 Bacteria 3748
82 Ga0466731_198671 3300042622 Bacteria 4042
83 Ga0466735_027835 3300042624 Bacteria 3995
84 Ga0466703_043333 3300042636 Bacteria 3696
85 Ga0466704_049686 3300042643 Bacteria 9727
86 Ga0466704_234812 3300042643 Bacteria 7928
87 Ga0466708_010700 3300042652 Bacteria 13876
88 Ga0466708_219643 3300042652 Bacteria 5430
89 Ga0466705_219458 3300042612 Bacteria 14353
90 Ga0466712_062451 3300042614 Bacteria 9485
91 Ga0466711_030200 3300042615 Bacteria 9456
92 Ga0466723_209976 3300042618 Bacteria 5978
93 Ga0466723_292498 3300042618 Bacteria 3125
94 Ga0466726_126559 3300042619 Unclassified 7782
95 Ga0466728_217427 3300042620 Bacteria 15359
96 Ga0456237_0010656 3300041968 Bacteria 1354
97 Ga0466693_036457 3300042592 Bacteria 20135
98 Ga0466691_091314 3300042593 Bacteria 7514
99 Ga0466699_169977 3300042597 Bacteria 8838
100 Ga0123357_10074959 3300009784 Bacteria 4473
101 Ga0123353_10979630 3300010167 Bacteria 1139
102 JGI24698J34947_10000195 3300002449 Bacteria 24539
103 JGI24698J34947_10004199 3300002449 Bacteria 7831
104 JGI24698J34947_10008798 3300002449 Bacteria 5537
105 JGI24698J34947_10018864 3300002449 Bacteria 3724
106 Ga0466700_111240 3300042600 Bacteria 2049
107 Ga0466722_067278 3300042609 Bacteria 1570
108 Ga0466735_028092 3300042624 Bacteria 11120
109 Ga0466735_117208 3300042624 Bacteria 5163
110 Ga0466703_330768 3300042636 Bacteria 4830
111 Ga0466704_159058 3300042643 Bacteria 14165
112 Ga0466704_505875 3300042643 Bacteria 7018
113 Ga0466704_596100 3300042643 Bacteria 4510
114 Ga0466704_606207 3300042643 Unclassified 4801
115 Ga0466705_044428 3300042612 Bacteria 3986
116 Ga0466705_146047 3300042612 Bacteria 8415
117 Ga0466705_154988 3300042612 Bacteria 4632
118 Ga0466732_238551 3300042656 Bacteria 2317
119 Ga0466712_058877 3300042614 Bacteria 25182
120 Ga0466711_073694 3300042615 Bacteria 1840
121 Ga0466715_022857 3300042616 Bacteria 7901
122 Ga0466718_053847 3300042617 Bacteria 7652
123 Ga0466723_056195 3300042618 Bacteria 3840
124 Ga0466723_204079 3300042618 Bacteria 8093
125 Ga0466690_341481 3300042590 Unclassified 6723
126 Ga0466690_395441 3300042590 Bacteria 1592
127 Ga0466692_158500 3300042591 Bacteria 8006
128 Ga0466691_105088 3300042593 Bacteria 4814
129 Ga0466694_086413 3300042594 Bacteria 3433
130 Ga0466696_213613 3300042596 Bacteria 4265
131 JGI24698J34947_10002270 3300002449 Bacteria 10308
132 Ga0072941_1005290 3300005201 Bacteria 15986
133 Ga0466700_124055 3300042600 Bacteria 1862
134 Ga0466716_027376 3300042605 Bacteria 6232
135 Ga0466716_247556 3300042605 Bacteria 5657
136 Ga0466716_364395 3300042605 Bacteria 2068
137 Ga0466716_525054 3300042605 Bacteria 1661
138 Ga0466722_120713 3300042609 Bacteria 23735
139 Ga0466703_132686 3300042636 Bacteria 3305
140 Ga0466704_242271 3300042643 Bacteria 3014
141 Ga0466709_229798 3300042648 Bacteria 12445
142 Ga0466708_218194 3300042652 Bacteria 3165
143 Ga0466727_110030 3300042655 Bacteria 6046
144 Ga0466705_474941 3300042612 Bacteria 29700
145 Ga0466715_210163 3300042616 Bacteria 48320
146 Ga0466728_207140 3300042620 Bacteria 11170
147 Ga0466690_044900 3300042590 Bacteria 17921
148 Ga0466695_162681 3300042595 Bacteria 8790
149 Ga0466696_211883 3300042596 Bacteria 5088
150 Ga0466696_385616 3300042596 Bacteria 5814
151 Ga0466699_208291 3300042597 Bacteria 1630
152 Ga0123353_10235733 3300010167 Bacteria 2848
153 JGI24698J34947_10015678 3300002449 Unclassified 4122
154 JGI24698J34947_10027810 3300002449 Bacteria 2999
155 JGI24702J35022_10000854 3300002462 Bacteria 18852
156 Ga0466707_087831 3300042601 Bacteria 2366
157 Ga0466719_198832 3300042606 Bacteria 3345
158 Ga0466719_288816 3300042606 Bacteria 4782
159 Ga0466719_403685 3300042606 Bacteria 1420
160 Ga0466722_018865 3300042609 Bacteria 10970
161 Ga0466729_212381 3300042621 Bacteria 1486
162 Ga0466703_066767 3300042636 Bacteria 8797
163 Ga0466703_076898 3300042636 Bacteria 76177
164 Ga0466703_185995 3300042636 Bacteria 5938
165 Ga0466703_433291 3300042636 Bacteria 24943
166 Ga0466704_322932 3300042643 Bacteria 9266
167 Ga0466704_347499 3300042643 Bacteria 2701
168 Ga0466709_194846 3300042648 Bacteria 7188
169 Ga0466709_376652 3300042648 Bacteria 2143
170 Ga0466708_006069 3300042652 Bacteria 10661
171 Ga0466708_417541 3300042652 Bacteria 43144
172 Ga0466708_426990 3300042652 Bacteria 20710
173 Ga0466727_167693 3300042655 Bacteria 2575
174 Ga0466712_066625 3300042614 Bacteria 1895
175 Ga0466715_053951 3300042616 Bacteria 20752
176 Ga0466715_067308 3300042616 Bacteria 4420
177 Ga0466718_049854 3300042617 Unclassified 2833
178 Ga0466726_268006 3300042619 Bacteria 14662
179 Ga0466726_343321 3300042619 Bacteria 1743
180 Ga0264413_111293 3300024493 Bacteria 11175
181 Ga0466690_145072 3300042590 Bacteria 4878
182 Ga0466690_400616 3300042590 Bacteria 1990
183 Ga0466692_079555 3300042591 Unclassified 2583
184 Ga0466692_079793 3300042591 Bacteria 14479
185 Ga0466691_033478 3300042593 Bacteria 3824
186 Ga0466694_188429 3300042594 Bacteria 57168
187 Ga0466694_279106 3300042594 Bacteria 2348
188 Ga0123353_11004974 3300010167 Bacteria 1120
189 JGI24698J34947_10000521 3300002449 Bacteria 18150
190 JGI24698J34947_10007605 3300002449 Bacteria 5956
191 JGI24698J34947_10014255 3300002449 Bacteria 4328
192 JGI24702J35022_10039540 3300002462 Bacteria 2516
193 JGI24702J35022_10067943 3300002462 Bacteria 1915
194 Ga0068305_10025194 3300005083 Bacteria 16801
195 Ga0466706_260895 3300042599 Bacteria 7181
196 Ga0466722_025146 3300042609 Bacteria 6377
197 Ga0466704_012354 3300042643 Bacteria 2211
198 Ga0466704_173997 3300042643 Bacteria 7270
199 Ga0466704_381443 3300042643 Bacteria 9348
200 Ga0466727_061194 3300042655 Bacteria 25961
201 Ga0466727_140506 3300042655 Bacteria 2269

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_012354 Ga0466704_012354_1235_2143 302
2 3300005201 Ga0072941_1005290 Ga0072941_10052906 304
3 3300042590 Ga0466690_400616 Ga0466690_400616_1012_1929 305
4 3300041968 Ga0456237_0010656 Ga0456237_0010656_17_1021 308
5 3300042591 Ga0466692_079793 Ga0466692_079793_7128_8132 308
6 3300042618 Ga0466723_292498 Ga0466723_292498_17_1000 309
7 3300042643 Ga0466704_606207 Ga0466704_606207_1426_2406 309
8 3300042655 Ga0466727_332810 Ga0466727_332810_708_1688 310
9 3300002449 JGI24698J34947_10000521 JGI24698J34947_100005217 311
10 3300042606 Ga0466719_198832 Ga0466719_198832_1636_2622 311
11 3300042612 Ga0466705_196488 Ga0466705_196488_3486_4472 311
12 3300042643 Ga0466704_234812 Ga0466704_234812_4938_5924 311
13 3300042643 Ga0466704_552175 Ga0466704_552175_316_1302 311
14 3300042591 Ga0466692_096352 Ga0466692_096352_335_1348 312
15 3300042605 Ga0466716_074062 Ga0466716_074062_1848_2834 312
16 3300042612 Ga0466705_050485 Ga0466705_050485_2694_3680 312
17 3300042615 Ga0466711_146423 Ga0466711_146423_9705_10691 312
18 3300042617 Ga0466718_154204 Ga0466718_154204_945_1883 312
19 3300042643 Ga0466704_049686 Ga0466704_049686_7758_8744 312
20 3300042648 Ga0466709_376652 Ga0466709_376652_547_1530 312
21 3300042621 Ga0466729_212381 Ga0466729_212381_432_1418 313
22 3300042636 Ga0466703_132686 Ga0466703_132686_440_1426 313
23 3300010882 Ga0123354_10079986 Ga0123354_100799864 314
24 3300042600 Ga0466700_124055 Ga0466700_124055_747_1733 314
25 3300042612 Ga0466705_044428 Ga0466705_044428_1851_2837 314
26 3300042616 Ga0466715_210163 Ga0466715_210163_17623_18606 314
27 3300042620 Ga0466728_217427 Ga0466728_217427_9446_10432 314
28 3300042617 Ga0466718_044412 Ga0466718_044412_342_1337 315
29 3300042643 Ga0466704_505875 Ga0466704_505875_2474_3460 315
30 3300042656 Ga0466732_100504 Ga0466732_100504_4393_5388 315
31 3300042596 Ga0466696_297210 Ga0466696_297210_5334_6320 316
32 3300042599 Ga0466706_260895 Ga0466706_260895_1811_2761 316
33 3300042605 Ga0466716_027376 Ga0466716_027376_2682_3665 316
34 3300042605 Ga0466716_247556 Ga0466716_247556_2188_3180 316
35 3300042614 Ga0466712_040335 Ga0466712_040335_6978_7928 316
36 3300042616 Ga0466715_001062 Ga0466715_001062_564_1550 316
37 3300042618 Ga0466723_209976 Ga0466723_209976_582_1568 316
38 3300042619 Ga0466726_340371 Ga0466726_340371_28_1017 316
39 3300042621 Ga0466729_008786 Ga0466729_008786_103_1089 316
40 3300042590 Ga0466690_044900 Ga0466690_044900_13438_14421 317
41 3300042593 Ga0466691_105088 Ga0466691_105088_1152_2138 317
42 3300042596 Ga0466696_213613 Ga0466696_213613_556_1554 317
43 3300042624 Ga0466735_028092 Ga0466735_028092_5928_6914 317
44 3300042636 Ga0466703_185995 Ga0466703_185995_3167_4150 317
45 3300042643 Ga0466704_347499 Ga0466704_347499_1593_2588 317
46 3300042652 Ga0466708_010700 Ga0466708_010700_12281_13267 317
47 3300042593 Ga0466691_044438 Ga0466691_044438_1327_2322 318
48 3300042609 Ga0466722_067278 Ga0466722_067278_18_974 318
49 3300042612 Ga0466705_146047 Ga0466705_146047_6811_7803 318
50 3300042636 Ga0466703_026456 Ga0466703_026456_359_1354 318
51 3300042643 Ga0466704_381443 Ga0466704_381443_5762_6748 318
52 3300042652 Ga0466708_218194 Ga0466708_218194_1388_2383 318
53 3300042593 Ga0466691_033478 Ga0466691_033478_893_1888 319
54 3300042593 Ga0466691_091314 Ga0466691_091314_2549_3535 319
55 3300042593 Ga0466691_130702 Ga0466691_130702_30660_31652 319
56 3300042612 Ga0466705_219458 Ga0466705_219458_1946_2926 319
57 3300042616 Ga0466715_067308 Ga0466715_067308_1854_2840 319
58 3300042620 Ga0466728_004738 Ga0466728_004738_12388_13374 319
59 3300042620 Ga0466728_160193 Ga0466728_160193_12117_13109 319
60 3300042609 Ga0466722_036364 Ga0466722_036364_6989_7975 320
61 3300042609 Ga0466722_120713 Ga0466722_120713_3905_4906 320
62 3300042612 Ga0466705_154988 Ga0466705_154988_1415_2377 320
63 3300042643 Ga0466704_173997 Ga0466704_173997_2039_3001 320
64 3300042648 Ga0466709_356593 Ga0466709_356593_3117_4109 320
65 3300042652 Ga0466708_120289 Ga0466708_120289_5859_6845 320
66 3300042648 Ga0466709_194846 Ga0466709_194846_2658_3623 321
67 3300042597 Ga0466699_169977 Ga0466699_169977_1985_2968 322
68 3300042609 Ga0466722_046250 Ga0466722_046250_2392_3393 323
69 3300042618 Ga0466723_056195 Ga0466723_056195_528_1514 323
70 3300042619 Ga0466726_475920 Ga0466726_475920_1569_2579 323
71 3300042643 Ga0466704_094942 Ga0466704_094942_28397_29404 323
72 3300042643 Ga0466704_322932 Ga0466704_322932_6177_7163 323
73 3300042616 Ga0466715_022857 Ga0466715_022857_5277_6251 324
74 3300042618 Ga0466723_204079 Ga0466723_204079_173_1183 324
75 3300042643 Ga0466704_159058 Ga0466704_159058_9262_10263 324
76 3300042591 Ga0466692_079555 Ga0466692_079555_1263_2240 325
77 3300042591 Ga0466692_158500 Ga0466692_158500_2647_3624 325
78 3300042591 Ga0466692_171013 Ga0466692_171013_1006_1983 325
79 3300042606 Ga0466719_507080 Ga0466719_507080_660_1658 325
80 3300042636 Ga0466703_433291 Ga0466703_433291_16995_17972 325
81 3300042596 Ga0466696_211883 Ga0466696_211883_2331_3311 326
82 3300042602 Ga0466713_040273 Ga0466713_040273_709_1689 326
83 3300042605 Ga0466716_297581 Ga0466716_297581_1887_2867 326
84 3300042605 Ga0466716_364395 Ga0466716_364395_965_1945 326
85 3300042605 Ga0466716_525054 Ga0466716_525054_229_1227 326
86 3300042606 Ga0466719_403685 Ga0466719_403685_34_1014 326
87 3300042612 Ga0466705_474941 Ga0466705_474941_21265_22245 326
88 3300042612 Ga0466705_506932 Ga0466705_506932_2456_3436 326
89 3300042616 Ga0466715_085266 Ga0466715_085266_6719_7699 326
90 3300042616 Ga0466715_316211 Ga0466715_316211_10856_11836 326
91 3300042619 Ga0466726_343321 Ga0466726_343321_520_1500 326
92 3300042620 Ga0466728_207140 Ga0466728_207140_7763_8776 326
93 3300042620 Ga0466728_408412 Ga0466728_408412_1531_2541 326
94 3300042636 Ga0466703_043333 Ga0466703_043333_1848_2828 326
95 3300042636 Ga0466703_076898 Ga0466703_076898_54949_55929 326
96 3300042636 Ga0466703_371941 Ga0466703_371941_1896_2876 326
97 3300042648 Ga0466709_229798 Ga0466709_229798_2150_3130 326
98 3300042652 Ga0466708_417541 Ga0466708_417541_19992_20972 326
99 3300042596 Ga0466696_051225 Ga0466696_051225_3223_4206 327
100 3300042612 Ga0466705_062691 Ga0466705_062691_8991_10028 327
101 3300042619 Ga0466726_126559 Ga0466726_126559_1816_2799 327
102 3300042624 Ga0466735_027835 Ga0466735_027835_847_1848 327
103 3300042590 Ga0466690_028902 Ga0466690_028902_316_1302 328
104 3300042590 Ga0466690_145072 Ga0466690_145072_3645_4631 328
105 3300042593 Ga0466691_137511 Ga0466691_137511_611_1597 328
106 3300042609 Ga0466722_025146 Ga0466722_025146_2735_3766 328
107 3300042612 Ga0466705_525528 Ga0466705_525528_3662_4648 328
108 3300042618 Ga0466723_130527 Ga0466723_130527_717_1703 328
109 3300042619 Ga0466726_427243 Ga0466726_427243_3413_4399 328
110 3300042636 Ga0466703_364328 Ga0466703_364328_2761_3768 328
111 3300042643 Ga0466704_114169 Ga0466704_114169_456_1442 328
112 3300042643 Ga0466704_239099 Ga0466704_239099_3270_4307 328
113 3300042643 Ga0466704_596100 Ga0466704_596100_999_1985 328
114 3300042648 Ga0466709_206117 Ga0466709_206117_111_1097 328
115 3300042656 Ga0466732_238551 Ga0466732_238551_577_1563 328
116 3300005083 Ga0068305_10025194 Ga0068305_100251946 329
117 3300009784 Ga0123357_10209146 Ga0123357_102091461 329
118 3300010167 Ga0123353_10235733 Ga0123353_102357332 329
119 3300042614 Ga0466712_055581 Ga0466712_055581_96_1085 329
120 3300042616 Ga0466715_091879 Ga0466715_091879_48379_49368 329
121 3300042617 Ga0466718_053847 Ga0466718_053847_5633_6649 329
122 3300042619 Ga0466726_460321 Ga0466726_460321_60_1049 329
123 3300042655 Ga0466727_167693 Ga0466727_167693_978_1967 329
124 3300002449 JGI24698J34947_10015678 JGI24698J34947_100156783 330
125 3300002462 JGI24702J35022_10000854 JGI24702J35022_100008546 330
126 3300042597 Ga0466699_208291 Ga0466699_208291_540_1532 330
127 3300042606 Ga0466719_347973 Ga0466719_347973_2906_3898 330
128 3300042614 Ga0466712_066625 Ga0466712_066625_313_1305 330
129 3300042655 Ga0466727_061194 Ga0466727_061194_11733_12725 330
130 3300042616 Ga0466715_053951 Ga0466715_053951_18868_19863 331
131 3300042615 Ga0466711_030200 Ga0466711_030200_4375_5373 332
132 3300042616 Ga0466715_619875 Ga0466715_619875_1492_2490 332
133 3300042617 Ga0466718_043885 Ga0466718_043885_388_1422 332
134 3300042618 Ga0466723_143114 Ga0466723_143114_373_1371 332
135 3300042619 Ga0466726_120361 Ga0466726_120361_2451_3449 332
136 3300042624 Ga0466735_117208 Ga0466735_117208_3543_4541 332
137 3300042643 Ga0466704_242271 Ga0466704_242271_1140_2138 332
138 3300042652 Ga0466708_333299 Ga0466708_333299_76_1074 332
139 3300042655 Ga0466727_110030 Ga0466727_110030_1742_2791 332
140 3300042655 Ga0466727_235316 Ga0466727_235316_5374_6372 332
141 3300042596 Ga0466696_385616 Ga0466696_385616_2821_3822 333
142 3300042602 Ga0466713_065048 Ga0466713_065048_1273_2274 333
143 3300042615 Ga0466711_073694 Ga0466711_073694_505_1506 333
144 3300042652 Ga0466708_219643 Ga0466708_219643_1595_2596 333
145 3300010167 Ga0123353_10979630 Ga0123353_109796301 334
146 3300042594 Ga0466694_188429 Ga0466694_188429_3895_4932 334
147 3300042619 Ga0466726_268006 Ga0466726_268006_2045_3049 334
148 3300042636 Ga0466703_330768 Ga0466703_330768_1305_2363 334
149 3300042652 Ga0466708_426990 Ga0466708_426990_11876_12880 334
150 3300010167 Ga0123353_11004974 Ga0123353_110049741 336
151 3300042594 Ga0466694_279106 Ga0466694_279106_791_1831 336
152 3300042655 Ga0466727_140506 Ga0466727_140506_417_1427 336
153 3300042601 Ga0466707_087831 Ga0466707_087831_750_1763 337
154 3300042609 Ga0466722_108259 Ga0466722_108259_2460_3473 337
155 3300038395 Ga0415639_100080 Ga0415639_100080_2212_3228 338
156 3300042609 Ga0466722_018865 Ga0466722_018865_2734_3750 338
157 3300024493 Ga0264413_111293 Ga0264413_11129311 339
158 3300042617 Ga0466718_049854 Ga0466718_049854_590_1609 339
159 3300042617 Ga0466718_119801 Ga0466718_119801_3312_4331 339
160 3300005200 Ga0072940_1203681 Ga0072940_12036812 340
161 3300042590 Ga0466690_395441 Ga0466690_395441_439_1461 340
162 3300042600 Ga0466700_111240 Ga0466700_111240_668_1729 340
163 3300042600 Ga0466700_113532 Ga0466700_113532_22_1083 340
164 3300042606 Ga0466719_288816 Ga0466719_288816_2092_3114 340
165 3300000089 AustNasuHG_c1000552 AustNasuHG_10005526 341
166 3300002462 JGI24702J35022_10039540 JGI24702J35022_100395402 341
167 3300042655 Ga0466727_177987 Ga0466727_177987_431_1477 341
168 3300010167 Ga0123353_10083984 Ga0123353_100839845 342
169 3300024493 Ga0264413_121215 Ga0264413_1212155 342
170 3300042590 Ga0466690_341481 Ga0466690_341481_2506_3576 342
171 3300042595 Ga0466695_162681 Ga0466695_162681_352_1380 342
172 3300042609 Ga0466722_011431 Ga0466722_011431_1051_2082 343
173 3300002462 JGI24702J35022_10004450 JGI24702J35022_100044502 344
174 3300002462 JGI24702J35022_10067943 JGI24702J35022_100679432 344
175 3300042607 Ga0466720_160418 Ga0466720_160418_3886_4920 344
176 3300042652 Ga0466708_006069 Ga0466708_006069_9379_10413 344
177 3300042656 Ga0466732_412089 Ga0466732_412089_568_1602 344
178 iso_pr_bacteria 2772190975 2773723104 344
179 3300042636 Ga0466703_066767 Ga0466703_066767_1588_2652 345
180 3300042594 Ga0466694_144469 Ga0466694_144469_58_1101 347
181 iso_pr_bacteria 2781125694 2781436597 348
182 3300010167 Ga0123353_10007623 Ga0123353_100076233 349
183 3300002449 JGI24698J34947_10007605 JGI24698J34947_100076056 350
184 3300042607 Ga0466720_087531 Ga0466720_087531_3516_4568 350
185 3300042614 Ga0466712_157083 Ga0466712_157083_4726_5778 350
186 3300042592 Ga0466693_036457 Ga0466693_036457_2733_3827 351
187 3300042594 Ga0466694_086413 Ga0466694_086413_1222_2280 352
188 3300009784 Ga0123357_10104839 Ga0123357_101048392 355
189 3300042610 Ga0466698_039739 Ga0466698_039739_980_2047 355
190 3300042614 Ga0466712_023729 Ga0466712_023729_8778_9848 356
191 3300042614 Ga0466712_058877 Ga0466712_058877_20573_21643 356
192 3300042614 Ga0466712_062451 Ga0466712_062451_853_1923 356
193 3300042614 Ga0466712_078961 Ga0466712_078961_576_1646 356
194 3300002449 JGI24698J34947_10000195 JGI24698J34947_1000019513 357
195 3300002449 JGI24698J34947_10002270 JGI24698J34947_1000227012 357
196 3300002449 JGI24698J34947_10004199 JGI24698J34947_100041998 357
197 3300002449 JGI24698J34947_10008798 JGI24698J34947_100087983 357
198 3300002449 JGI24698J34947_10014255 JGI24698J34947_100142553 357
199 3300002449 JGI24698J34947_10018864 JGI24698J34947_100188644 357
200 3300002449 JGI24698J34947_10027810 JGI24698J34947_100278105 357
201 3300009784 Ga0123357_10074959 Ga0123357_100749593 358
202 3300002449 JGI24698J34947_10034046 JGI24698J34947_100340463 366
203 3300042622 Ga0466731_198671 Ga0466731_198671_1922_3076 384

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10502 Peptidase_S26 Signal peptidase, peptidase S26 86 212 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.