Protein Family IF08569

Metagenome Isolate
153 Members
109 Samples
105 Scaffolds
262.86 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_304931|Ga0466729_304931_297_1163
Length
288 aa
Sequence
LTAAGFNTPFCSGIPGTEFMSVPIRVAIAGASGRMGRMLIEAALQDEGIVLASAFDRPGSAFIGRDAGEAAGVASGVTIIDDASAAIAAADCLIDFTRPEGTLAHLGEAVRFGKSAVIGTTGFDAAGKAAIAEAARSVPVVFAPNMAVGVNAVFRLLEVAAKILSKGYDVEVIEAHHRFKVDAPSGTALRMGEVVARAMGRDLGECAIYGREGVTGERKPETIGFSAIRGGDVVGDHTVLFAGIGERIEITHQSGSRMPYALGSLRAARFLAGRAPGLFDMQDVLGLR

📊 Sample Types

Isolate 31.4%
Metagenome 68.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 19.8%
Apidae 17.8%
Termitidae 17.8%
Kalotermitidae 11.9%
Culicidae 5.9%
Armadillidiidae 5.0%
Elmidae 4.0%
Rhinotermitidae 4.0%
Curculionidae 4.0%
Passalidae 3.0%
Termopsidae 2.0%
Lysianassidae 1.0%
Hodotermitidae 1.0%
Siricidae 1.0%
Gryllidae 1.0%
Drosophilidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2846366200 Snodgrassella alvi Gris3-4 Isolate Apidae
2 2846370940 Snodgrassella alvi Nev3CBA3 Isolate Apidae
3 2857842411 Snodgrassella alvi Ruf1-X Isolate Apidae
4 2864755708 Massilia timonae S00006 Isolate Elmidae
5 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
6 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
7 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
18 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
19 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
20 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
24 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
25 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 2846359427 Snodgrassella alvi wkB273 Isolate Apidae
33 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
34 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
35 2585428048 Colwellia sp. NBT2012 Isolate
36 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
37 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
38 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
39 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
40 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
41 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
42 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
43 8052469819 Pseudomonas putida DZ-F23 Isolate
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
47 2846376288 Snodgrassella alvi Fer4-2 Isolate Apidae
48 2846379220 Snodgrassella alvi wkB237 Isolate Apidae
49 2849399727 Snodgrassella alvi Fer1-2 Isolate Apidae
50 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
51 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
52 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
53 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
56 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
57 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
58 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
59 2585427850 Snodgrassella alvi wkB12 Isolate Apidae
60 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
63 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
64 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
65 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
66 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
67 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
68 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
69 2854104879 Snodgrassella alvi Fer2-2 Isolate Apidae
70 2868461634 Snodgrassella alvi Gris2-3-4 Isolate Apidae
71 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
72 2585427605 Colwellia sp. MT2012 Isolate
73 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
74 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
75 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
76 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
77 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
78 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
79 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
80 2843301220 Snodgrassella alvi Nev4-2 Isolate Apidae
81 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
82 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
83 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
84 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
85 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
86 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
87 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
88 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
89 637000219 Pseudomonas entomophila L48 Isolate Unclassified
90 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
91 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
92 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
93 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
94 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
95 2846373876 Snodgrassella alvi Gris1-3 Isolate Apidae
96 2848751009 Snodgrassella alvi App2-2 Isolate Apidae
97 2854084220 Snodgrassella alvi Snod2-1-5 Isolate Apidae
98 2854102457 Snodgrassella alvi Gris1-6 Isolate Apidae
99 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
100 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
101 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
102 2585427851 Snodgrassella alvi wkB29 Isolate Apidae
103 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
104 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
105 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
106 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
107 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
108 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
109 8035422605 Pseudomonas monteilii CY06 Isolate

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_079285 3300042612 Bacteria 5370
2 Ga0466706_261649 3300042599 Bacteria 15885
3 Ga0466714_111184 3300042603 Bacteria 1338
4 Ga0466715_137614 3300042616 Bacteria 38477
5 Ga0160470_101759 3300012813 Bacteria 4795
6 Ga0160468_101680 3300012819 Bacteria 4928
7 Ga0160448_103465 3300012854 Bacteria 4603
8 Ga0160448_106173 3300012854 Unclassified 3033
9 DPOL_contig13647 2035918003 Bacteria 9812
10 2227174980 2225789004 Bacteria 1511
11 IMNBGM34_c000054 3300000036 Bacteria 32127
12 JGI24702J35022_10000909 3300002462 Bacteria 18428
13 Ga0466732_019599 3300042656 Bacteria 1857
14 Ga0466717_071135 3300042604 Unclassified 3614
15 Ga0466719_295496 3300042606 Bacteria 3440
16 Ga0466722_259999 3300042609 Bacteria 18788
17 Ga0466723_270128 3300042618 Bacteria 34165
18 Ga0466726_159397 3300042619 Bacteria 36011
19 Ga0466729_067268 3300042621 Bacteria 33521
20 Ga0466703_054978 3300042636 Bacteria 1966
21 Ga0466704_258426 3300042643 Bacteria 95131
22 Ga0123357_10312737 3300009784 Bacteria 1566
23 Ga0123355_10012885 3300009826 Unclassified 12979
24 Ga0123353_10015594 3300010167 Bacteria 11053
25 Ga0160471_100049 3300012812 Bacteria 163291
26 Ga0160469_105661 3300012824 Bacteria 1293
27 SWWA_contig31839__length_5123___numreads_351 2100351016 Bacteria 5123
28 Ga0123357_10000908 3300009784 Bacteria 30102
29 Ga0466707_151113 3300042601 Bacteria 11427
30 Ga0466716_196380 3300042605 Bacteria 1082
31 Ga0466727_169080 3300042655 Bacteria 19731
32 Ga0123353_10111167 3300010167 Unclassified 4413
33 Ga0160472_100109 3300012839 Bacteria 129853
34 Ga0466657_191819 3300042582 Bacteria 13756
35 Ga0466657_396192 3300042582 Bacteria 43448
36 Ga0466692_076165 3300042591 Bacteria 58218
37 Ga0466691_055841 3300042593 Bacteria 7993
38 Ga0466701_018917 3300042598 Bacteria 69268
39 Ga0466714_117517 3300042603 Bacteria 27171
40 Ga0466722_181429 3300042609 Bacteria 1616
41 Ga0466715_509823 3300042616 Unclassified 5603
42 Ga0466703_249289 3300042636 Bacteria 1404
43 Ga0466709_399485 3300042648 Bacteria 5797
44 Ga0123356_10336606 3300010049 Bacteria 1628
45 Ga0123353_10363498 3300010167 Bacteria 2173
46 Ga0123353_10960511 3300010167 Bacteria 1154
47 Ga0160470_101021 3300012813 Bacteria 7661
48 Ga0160453_102988 3300012814 Unclassified 3749
49 Ga0160441_102417 3300012825 Unclassified 3815
50 Ga0160433_100090 3300012846 Bacteria 92891
51 Ga0466657_020368 3300042582 Bacteria 10005
52 Ga0466657_079329 3300042582 Bacteria 10810
53 Ga0466690_180938 3300042590 Bacteria 11015
54 Ga0466695_304326 3300042595 Bacteria 3812
55 Ga0466696_328576 3300042596 Bacteria 3306
56 SWWA_contig19739__length_2482___numreads_46 2100351016 Bacteria 2482
57 Ga0466706_066534 3300042599 Bacteria 37675
58 Ga0466728_062815 3300042620 Bacteria 69433
59 Ga0466725_282494 3300042654 Bacteria 6446
60 Ga0123353_10229218 3300010167 Bacteria 2898
61 FGTW_contig31070 2065487013 Bacteria 6211
62 HBC_ctgsDRAFT_1000761 3300000333 Bacteria 7162
63 JGI24705J35276_12238466 3300002504 Unclassified 23115
64 Ga0466706_234433 3300042599 Bacteria 7625
65 Ga0466726_279079 3300042619 Bacteria 1330
66 Ga0466729_304931 3300042621 Bacteria 1240
67 Ga0466724_58564 3300042649 Bacteria 10323
68 Ga0123356_10222709 3300010049 Bacteria 1944
69 Ga0123353_10077558 3300010167 Bacteria 5339
70 Ga0160445_101633 3300012847 Bacteria 6033
71 SPBB_contig09015 2044078006 Bacteria 21466
72 JGI24702J35022_10014840 3300002462 Bacteria 4292
73 Ga0466733_192046 3300042659 Bacteria 57216
74 Ga0466713_027134 3300042602 Bacteria 18419
75 Ga0466719_023074 3300042606 Bacteria 30350
76 Ga0466715_499687 3300042616 Bacteria 9677
77 Ga0466723_156707 3300042618 Bacteria 1467
78 Ga0466723_210482 3300042618 Bacteria 12612
79 Ga0466703_053190 3300042636 Bacteria 54858
80 Ga0466704_065837 3300042643 Bacteria 2272
81 Ga0466724_36896 3300042649 Bacteria 3239
82 Ga0123353_10003924 3300010167 Bacteria 19007
83 Ga0123353_10864072 3300010167 Bacteria 1237
84 Ga0160467_100188 3300012829 Bacteria 82770
85 Ga0160460_103181 3300012845 Unclassified 3037
86 Ga0160447_104723 3300012849 Bacteria 3964
87 Ga0466656_002660 3300042550 Bacteria 1367
88 Ga0466690_075827 3300042590 Bacteria 38218
89 Ga0466696_048527 3300042596 Bacteria 3816
90 IMNBGM34_c000635 3300000036 Bacteria 8654
91 Ga0466705_087780 3300042612 Bacteria 84355
92 Ga0466710_165772 3300042613 Bacteria 122681
93 Ga0466723_046663 3300042618 Bacteria 18278
94 Ga0466726_133160 3300042619 Bacteria 5967
95 Ga0466730_094350 3300042625 Bacteria 10437
96 Ga0466709_225347 3300042648 Bacteria 2535
97 Ga0123357_10019280 3300009784 Bacteria 9086
98 Ga0160454_100689 3300012798 Unclassified 7546
99 Ga0160433_100099 3300012846 Bacteria 86801
100 Ga0466690_051691 3300042590 Bacteria 18831
101 Ga0466692_040554 3300042591 Bacteria 18931
102 IMNBL1DRAFT_c0002228 3300000062 Bacteria 13675
103 JGI24702J35022_10000399 3300002462 Bacteria 25810
104 Ga0104049_1029226 3300007103 Bacteria 1714
105 Ga0123357_10000003 3300009784 Bacteria 349727

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042654 Ga0466725_282494 Ga0466725_282494_5501_6256 238
2 3300010049 Ga0123356_10222709 Ga0123356_102227093 245
3 3300010167 Ga0123353_10077558 Ga0123353_100775585 245
4 3300042595 Ga0466695_304326 Ga0466695_304326_460_1200 246
5 3300009784 Ga0123357_10000908 Ga0123357_100009088 247
6 3300010167 Ga0123353_10229218 Ga0123353_102292184 247
7 3300000333 HBC_ctgsDRAFT_1000761 HBC_ctgsDRAFT_10007612 249
8 iso_pr_bacteria 2864866972 2864867795 249
9 iso_pr_bacteria 2864934081 2864936886 249
10 iso_pr_bacteria 2864951976 2864952798 249
11 3300010167 Ga0123353_10003924 Ga0123353_100039247 250
12 3300010167 Ga0123353_10015594 Ga0123353_100155944 250
13 3300012824 Ga0160469_105661 Ga0160469_1056611 250
14 3300012829 Ga0160467_100188 Ga0160467_10018827 250
15 3300012839 Ga0160472_100109 Ga0160472_10010950 250
16 3300012846 Ga0160433_100099 Ga0160433_1000993 250
17 3300042590 Ga0466690_075827 Ga0466690_075827_6533_7339 250
18 3300000036 IMNBGM34_c000054 IMNBGM34_00005419 251
19 3300042616 Ga0466715_137614 Ga0466715_137614_33363_34118 251
20 3300042618 Ga0466723_156707 Ga0466723_156707_370_1176 251
21 3300042619 Ga0466726_279079 Ga0466726_279079_75_830 251
22 3300042590 Ga0466690_180938 Ga0466690_180938_1679_2485 252
23 3300042606 Ga0466719_023074 Ga0466719_023074_22836_23594 252
24 3300010167 Ga0123353_10864072 Ga0123353_108640721 253
25 3300042643 Ga0466704_258426 Ga0466704_258426_51065_51871 253
26 3300009784 Ga0123357_10312737 Ga0123357_103127371 254
27 3300042582 Ga0466657_020368 Ga0466657_020368_3005_3769 254
28 3300042582 Ga0466657_079329 Ga0466657_079329_9757_10521 254
29 3300042593 Ga0466691_055841 Ga0466691_055841_1266_2072 254
30 3300042604 Ga0466717_071135 Ga0466717_071135_702_1466 254
31 3300042659 Ga0466733_192046 Ga0466733_192046_3422_4225 254
32 3300010167 Ga0123353_10111167 Ga0123353_101111674 255
33 3300042550 Ga0466656_002660 Ga0466656_002660_98_913 255
34 3300010167 Ga0123353_10363498 Ga0123353_103634982 256
35 3300042598 Ga0466701_018917 Ga0466701_018917_61899_62669 256
36 3300042656 Ga0466732_019599 Ga0466732_019599_460_1269 256
37 2225789004 2227174980 2227590541 257
38 3300009784 Ga0123357_10000003 Ga0123357_1000000336 257
39 3300042596 Ga0466696_048527 Ga0466696_048527_1047_1820 257
40 3300042603 Ga0466714_111184 Ga0466714_111184_33_806 257
41 3300042612 Ga0466705_087780 Ga0466705_087780_43671_44477 257
42 3300042616 Ga0466715_509823 Ga0466715_509823_3460_4233 257
43 3300042618 Ga0466723_270128 Ga0466723_270128_1843_2616 257
44 3300042619 Ga0466726_159397 Ga0466726_159397_17546_18319 257
45 3300042620 Ga0466728_062815 Ga0466728_062815_44981_45754 257
46 3300042621 Ga0466729_067268 Ga0466729_067268_23934_24707 257
47 iso_pr_bacteria 2772190893 2773438309 257
48 iso_pr_bacteria 2772190894 2773439295 257
49 3300002462 JGI24702J35022_10000399 JGI24702J35022_100003992 258
50 3300042599 Ga0466706_066534 Ga0466706_066534_33387_34163 258
51 3300042609 Ga0466722_181429 Ga0466722_181429_705_1481 258
52 iso_pr_bacteria 2772190889 2773431834 258
53 3300009784 Ga0123357_10019280 Ga0123357_100192805 259
54 3300042590 Ga0466690_051691 Ga0466690_051691_4016_4795 259
55 3300042603 Ga0466714_117517 Ga0466714_117517_10645_11424 259
56 3300042612 Ga0466705_079285 Ga0466705_079285_2420_3199 259
57 iso_pr_bacteria 2754412482 2755215425 259
58 iso_pr_bacteria 2772190891 2773433967 259
59 3300009826 Ga0123355_10012885 Ga0123355_100128858 260
60 3300002462 JGI24702J35022_10000909 JGI24702J35022_1000090911 261
61 2100351016 SWWA_contig19739__length_2482___numreads_46 SWWA_02263310 262
62 2100351016 SWWA_contig31839__length_5123___numreads_351 SWWA_02618200 262
63 3300012798 Ga0160454_100689 Ga0160454_1006891 262
64 3300012846 Ga0160433_100090 Ga0160433_10009054 262
65 3300002504 JGI24705J35276_12238466 JGI24705J35276_1223846623 263
66 3300012847 Ga0160445_101633 Ga0160445_1016333 263
67 3300042601 Ga0466707_151113 Ga0466707_151113_43_837 264
68 3300042609 Ga0466722_259999 Ga0466722_259999_14231_15028 265
69 3300042625 Ga0466730_094350 Ga0466730_094350_6485_7282 265
70 3300012812 Ga0160471_100049 Ga0160471_100049110 266
71 3300012813 Ga0160470_101759 Ga0160470_1017597 266
72 iso_pr_bacteria 2834230000 2834230763 266
73 3300042596 Ga0466696_328576 Ga0466696_328576_1349_2152 267
74 3300042599 Ga0466706_261649 Ga0466706_261649_8356_9159 267
75 3300042606 Ga0466719_295496 Ga0466719_295496_1549_2352 267
76 3300042649 Ga0466724_36896 Ga0466724_36896_2075_2878 267
77 iso_pr_bacteria 2556921622 2558099309 267
78 iso_pr_bacteria 2820123897 2820123933 267
79 iso_pr_bacteria 2870361953 2870364650 267
80 iso_pr_bacteria 3000478755 3000481747 267
81 iso_pr_bacteria 637000219 637999876 267
82 iso_pr_bacteria 8035422605 8035427701 267
83 iso_pr_bacteria 8052469819 8052472957 267
84 2035918003 DPOL_contig13647 DPOLB_1979390 268
85 2044078006 SPBB_contig09015 SPBB_551190 268
86 2065487013 FGTW_contig31070 FGTW_01607070 268
87 3300000062 IMNBL1DRAFT_c0002228 IMNBL1DRAFT_00022282 268
88 3300012813 Ga0160470_101021 Ga0160470_1010212 268
89 3300012814 Ga0160453_102988 Ga0160453_1029881 268
90 3300012845 Ga0160460_103181 Ga0160460_1031813 268
91 3300042582 Ga0466657_396192 Ga0466657_396192_41488_42294 268
92 3300042591 Ga0466692_076165 Ga0466692_076165_25374_26180 268
93 3300042605 Ga0466716_196380 Ga0466716_196380_56_862 268
94 3300042613 Ga0466710_165772 Ga0466710_165772_82594_83400 268
95 3300042618 Ga0466723_046663 Ga0466723_046663_6836_7642 268
96 3300042618 Ga0466723_210482 Ga0466723_210482_393_1199 268
97 3300042619 Ga0466726_133160 Ga0466726_133160_4171_4977 268
98 3300042636 Ga0466703_054978 Ga0466703_054978_808_1614 268
99 3300042636 Ga0466703_249289 Ga0466703_249289_37_843 268
100 3300042643 Ga0466704_065837 Ga0466704_065837_1431_2237 268
101 3300042648 Ga0466709_225347 Ga0466709_225347_1463_2269 268
102 3300042649 Ga0466724_58564 Ga0466724_58564_2670_3476 268
103 3300042655 Ga0466727_169080 Ga0466727_169080_16567_17373 268
104 iso_pr_bacteria 2501651205 2501714700 268
105 iso_pr_bacteria 2528768159 2529053259 268
106 iso_pr_bacteria 2585427605 2585888743 268
107 iso_pr_bacteria 2585428048 2587693443 268
108 iso_pr_bacteria 2891720358 2891720430 268
109 iso_pr_bacteria 2997878596 2997879805 268
110 iso_pr_bacteria 3007478678 3007484462 268
111 iso_pr_bacteria 8011329375 8011333284 268
112 3300007103 Ga0104049_1029226 Ga0104049_10292262 269
113 3300010049 Ga0123356_10336606 Ga0123356_103366062 269
114 3300010167 Ga0123353_10960511 Ga0123353_109605112 269
115 3300012825 Ga0160441_102417 Ga0160441_1024171 269
116 3300012849 Ga0160447_104723 Ga0160447_1047232 269
117 3300012854 Ga0160448_106173 Ga0160448_1061733 269
118 3300042582 Ga0466657_191819 Ga0466657_191819_10242_11051 269
119 3300042602 Ga0466713_027134 Ga0466713_027134_15320_16129 269
120 iso_pr_bacteria 2820062699 2820064551 269
121 iso_pr_bacteria 2820065746 2820066896 269
122 iso_pr_bacteria 2820089333 2820091756 269
123 iso_pr_bacteria 2820121232 2820122381 269
124 3300002462 JGI24702J35022_10014840 JGI24702J35022_100148403 270
125 3300042599 Ga0466706_234433 Ga0466706_234433_5061_5873 270
126 3300042636 Ga0466703_053190 Ga0466703_053190_7396_8208 270
127 iso_pr_bacteria 2571042003 2571061609 270
128 iso_pr_bacteria 2585427850 2586974267 270
129 iso_pr_bacteria 2585427851 2586976364 270
130 iso_pr_bacteria 2820071837 2820072263 270
131 iso_pr_bacteria 2843301220 2843301235 270
132 iso_pr_bacteria 2846359427 2846359987 270
133 iso_pr_bacteria 2846366200 2846367617 270
134 iso_pr_bacteria 2846370940 2846373713 270
135 iso_pr_bacteria 2846373876 2846375971 270
136 iso_pr_bacteria 2846376288 2846378915 270
137 iso_pr_bacteria 2846379220 2846379965 270
138 iso_pr_bacteria 2848751009 2848753140 270
139 iso_pr_bacteria 2849399727 2849401839 270
140 iso_pr_bacteria 2854084220 2854084559 270
141 iso_pr_bacteria 2854102457 2854104227 270
142 iso_pr_bacteria 2854104879 2854105489 270
143 iso_pr_bacteria 2857842411 2857844444 270
144 iso_pr_bacteria 2864755708 2864760250 270
145 iso_pr_bacteria 2868461634 2868463926 270
146 3300042648 Ga0466709_399485 Ga0466709_399485_580_1395 271
147 3300000036 IMNBGM34_c000635 IMNBGM34_0006357 273
148 3300042616 Ga0466715_499687 Ga0466715_499687_7159_8037 274
149 3300012819 Ga0160468_101680 Ga0160468_1016802 276
150 3300012854 Ga0160448_103465 Ga0160448_1034652 277
151 iso_pr_bacteria 2820103659 2820104161 281
152 3300042591 Ga0466692_040554 Ga0466692_040554_5037_5885 282
153 3300042621 Ga0466729_304931 Ga0466729_304931_297_1163 288

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus 24 146 0.99
PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus 149 285 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.