Protein Family IF08562

Metagenome Metatranscriptome Isolate
164 Members
55 Samples
154 Scaffolds
172.52 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_265539|Ga0466729_265539_52_633
Length
193 aa
Sequence
MSGNNVRRKKDKFNKREESMCENCNCQQGSVADFSSLAPVIEKYGKVQGSLITILQKAQDIYGYLSIDAINYISEKTGIKPAKIYGVATFYTQFRLKPIGKNLIMLCKGTACHVNGADAIEEAITEFLEIQDGETTADGIFTLNNVACLGCCSLAPVMMIKNAEGEETFGNLTKDTAKAILAEMRQREQEVAV

📊 Sample Types

Isolate 6.1%
Metagenome 93.3%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.2%
Kalotermitidae 25.5%
Unclassified 23.6%
Rhinotermitidae 5.5%
Termopsidae 5.5%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 1
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
2 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
3 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
4 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
15 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
16 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
17 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
42 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_258164 3300042611 Bacteria 1090
2 Ga0123355_10226957 3300009826 Bacteria 2674
3 Ga0123355_10853838 3300009826 Bacteria 1001
4 Ga0123356_10053627 3300010049 Bacteria 3753
5 Ga0123356_10131092 3300010049 Bacteria 2456
6 Ga0123356_10332305 3300010049 Unclassified 1637
7 Ga0123356_10385449 3300010049 Bacteria 1535
8 Ga0123356_10416201 3300010049 Bacteria 1485
9 Ga0123353_10334937 3300010167 Bacteria 2288
10 Ga0123353_10376941 3300010167 Bacteria 2124
11 Ga0123353_11041366 3300010167 Bacteria 1094
12 Ga0123354_10043839 3300010882 Bacteria 6869
13 Ga0123354_10356306 3300010882 Bacteria 1297
14 Ga0466706_197604 3300042599 Bacteria 3796
15 Ga0466700_210474 3300042600 Bacteria 75558
16 Ga0466707_178948 3300042601 Bacteria 22633
17 Ga0466722_085278 3300042609 Bacteria 2319
18 Ga0466722_258932 3300042609 Bacteria 5641
19 JGI24696J40584_12922671 3300002834 Bacteria 1367
20 Ga0068305_10032869 3300005083 Bacteria 24471
21 Ga0466718_060376 3300042617 Bacteria 6149
22 Ga0466694_037316 3300042594 Bacteria 1098
23 Ga0466703_305192 3300042636 Bacteria 6007
24 Ga0466704_128107 3300042643 Bacteria 1361
25 Ga0466704_264752 3300042643 Unclassified 5469
26 Ga0123357_10414087 3300009784 Bacteria 1211
27 Ga0123355_10133225 3300009826 Bacteria 3824
28 Ga0123355_10148815 3300009826 Bacteria 3562
29 Ga0123356_10031024 3300010049 Bacteria 5002
30 Ga0123356_10825903 3300010049 Bacteria 1098
31 Ga0123353_10116714 3300010167 Bacteria 4295
32 Ga0123353_10211826 3300010167 Bacteria 3039
33 Ga0123353_10406646 3300010167 Bacteria 2023
34 Ga0123353_10470519 3300010167 Bacteria 1843
35 Ga0123354_10079569 3300010882 Unclassified 4649
36 Ga0466707_123777 3300042601 Bacteria 3671
37 Ga0466707_409571 3300042601 Bacteria 70690
38 Ga0466713_130503 3300042602 Bacteria 31469
39 Ga0466714_035606 3300042603 Bacteria 1669
40 Ga0068305_10924613 3300005083 Bacteria 833
41 Ga0466715_474817 3300042616 Bacteria 2169
42 Ga0466728_027037 3300042620 Bacteria 10383
43 Ga0223683_1007266 3300021245 Bacteria 2396
44 Ga0466690_155085 3300042590 Bacteria 1323
45 Ga0466703_154051 3300042636 Bacteria 12754
46 Ga0466703_257416 3300042636 Bacteria 8220
47 Ga0466709_379506 3300042648 Bacteria 2109
48 Ga0466708_322579 3300042652 Bacteria 35124
49 Ga0123356_10101606 3300010049 Bacteria 2759
50 Ga0123356_10137796 3300010049 Bacteria 2402
51 Ga0123353_10835553 3300010167 Bacteria 1265
52 Ga0123353_10915719 3300010167 Bacteria 1191
53 Ga0123353_11410961 3300010167 Bacteria 894
54 Ga0123354_10548693 3300010882 Unclassified 873
55 Ga0466707_004051 3300042601 Bacteria 1678
56 Ga0466707_015396 3300042601 Bacteria 44812
57 Ga0466707_263143 3300042601 Bacteria 2010
58 Ga0466714_030563 3300042603 Unclassified 1238
59 Ga0466719_498250 3300042606 Bacteria 4597
60 Ga0466721_015151 3300042608 Bacteria 16308
61 Ga0068302_10151599 3300005071 Unclassified 3688
62 Ga0466711_042163 3300042615 Bacteria 3577
63 Ga0466723_069406 3300042618 Bacteria 2491
64 Ga0466726_360933 3300042619 Bacteria 7935
65 Ga0466704_510167 3300042643 Bacteria 3388
66 Ga0466725_333627 3300042654 Bacteria 1927
67 Ga0466727_273825 3300042655 Bacteria 7293
68 Ga0123357_10663217 3300009784 Unclassified 766
69 Ga0123355_10052080 3300009826 Bacteria 6643
70 Ga0466719_032446 3300042606 Bacteria 2598
71 Ga0466722_216127 3300042609 Bacteria 7707
72 JGI24705J35276_11956761 3300002504 Bacteria 800
73 JGI24700J35501_10929780 3300002508 Unclassified 10166
74 Ga0466711_288620 3300042615 Unclassified 2040
75 Ga0466715_067556 3300042616 Bacteria 2467
76 Ga0466723_052022 3300042618 Bacteria 10379
77 Ga0466723_145579 3300042618 Bacteria 24568
78 Ga0466728_044983 3300042620 Bacteria 17405
79 Ga0415639_014916 3300038395 Bacteria 13445
80 Ga0466691_114417 3300042593 Unclassified 6387
81 Ga0466704_339216 3300042643 Bacteria 4749
82 Ga0466727_130526 3300042655 Bacteria 15106
83 Ga0123355_10232056 3300009826 Unclassified 2633
84 Ga0123356_10034966 3300010049 Bacteria 4696
85 Ga0123353_10002040 3300010167 Bacteria 24948
86 Ga0123353_10765635 3300010167 Bacteria 1340
87 Ga0466706_217298 3300042599 Bacteria 1387
88 Ga0466700_009729 3300042600 Bacteria 1579
89 Ga0466707_087373 3300042601 Bacteria 11377
90 Ga0466713_064097 3300042602 Bacteria 36072
91 Ga0466722_141564 3300042609 Bacteria 4713
92 Ga0466696_312502 3300042596 Bacteria 1047
93 Ga0466702_280184 3300042635 Bacteria 2332
94 Ga0466703_260503 3300042636 Bacteria 1430
95 Ga0466724_39650 3300042649 Bacteria 1089
96 Ga0466705_136074 3300042612 Bacteria 25520
97 Ga0466705_382835 3300042612 Bacteria 6171
98 Ga0123355_10100364 3300009826 Bacteria 4559
99 Ga0123355_10122941 3300009826 Unclassified 4021
100 Ga0123355_11533145 3300009826 Bacteria 647
101 Ga0123356_10002890 3300010049 Bacteria 18193
102 Ga0123356_10074472 3300010049 Bacteria 3195
103 Ga0123356_10079256 3300010049 Bacteria 3102
104 Ga0123356_10362656 3300010049 Bacteria 1576
105 Ga0123356_10883146 3300010049 Bacteria 1065
106 Ga0123353_10000354 3300010167 Bacteria 56099
107 Ga0466701_075754 3300042598 Bacteria 3418
108 Ga0466706_283517 3300042599 Bacteria 6631
109 Ga0466700_386969 3300042600 Bacteria 1277
110 Ga0466707_203754 3300042601 Bacteria 3665
111 Ga0466721_043150 3300042608 Unclassified 2151
112 Ga0068305_10207522 3300005083 Bacteria 8971
113 Ga0466715_069964 3300042616 Bacteria 11401
114 Ga0466691_062393 3300042593 Bacteria 1405
115 Ga0466696_269050 3300042596 Bacteria 2991
116 Ga0466708_073980 3300042652 Bacteria 4188
117 Ga0466708_332359 3300042652 Bacteria 17952
118 Ga0466725_248854 3300042654 Bacteria 4821
119 Ga0466705_291477 3300042612 Bacteria 17050
120 Ga0123356_10578557 3300010049 Bacteria 1286
121 Ga0123353_10003223 3300010167 Bacteria 20554
122 Ga0123353_10185740 3300010167 Bacteria 3287
123 Ga0123353_10533043 3300010167 Bacteria 1699
124 Ga0466700_295415 3300042600 Bacteria 1061
125 Ga0466707_157350 3300042601 Bacteria 2131
126 Ga0466707_214910 3300042601 Bacteria 5868
127 Ga0466707_339854 3300042601 Bacteria 2091
128 Ga0466716_162866 3300042605 Bacteria 1422
129 Ga0466715_277359 3300042616 Bacteria 2082
130 Ga0466723_041296 3300042618 Bacteria 16340
131 Ga0466693_333416 3300042592 Bacteria 2401
132 Ga0466729_265539 3300042621 Bacteria 2975
133 Ga0466703_349787 3300042636 Bacteria 13319
134 Ga0466708_023932 3300042652 Bacteria 8095
135 Ga0466708_044368 3300042652 Bacteria 3481
136 Ga0123357_10100897 3300009784 Bacteria 3722
137 Ga0123357_10129410 3300009784 Bacteria 3150
138 Ga0123355_10040555 3300009826 Archaea 7579
139 Ga0123355_10462494 3300009826 Bacteria 1591
140 Ga0123356_11163644 3300010049 Bacteria 938
141 Ga0466707_021064 3300042601 Bacteria 1711
142 Ga0466707_051885 3300042601 Bacteria 2884
143 Ga0466707_085339 3300042601 Bacteria 9722
144 Ga0466707_177673 3300042601 Bacteria 18718
145 Ga0466714_016568 3300042603 Bacteria 1291
146 Ga0466719_445809 3300042606 Bacteria 5388
147 Ga0068305_10019772 3300005083 Bacteria 6258
148 Ga0123357_10000959 3300009784 Bacteria 29372
149 Ga0466728_167970 3300042620 Bacteria 1459
150 Ga0466692_014670 3300042591 Bacteria 29799
151 Ga0466692_135158 3300042591 Bacteria 7312
152 Ga0466696_473623 3300042596 Bacteria 1223
153 Ga0466703_130111 3300042636 Bacteria 1978
154 Ga0466704_090215 3300042643 Unclassified 11253

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10129410 Ga0123357_101294104 153
2 3300010882 Ga0123354_10079569 Ga0123354_100795691 155
3 3300010049 Ga0123356_10416201 Ga0123356_104162011 157
4 3300042599 Ga0466706_197604 Ga0466706_197604_2091_2570 159
5 iso_pr_bacteria 2820424542 2820425105 159
6 3300010049 Ga0123356_10031024 Ga0123356_100310244 160
7 3300010167 Ga0123353_10000354 Ga0123353_1000035427 160
8 3300038395 Ga0415639_014916 Ga0415639_014916_2031_2513 160
9 3300042602 Ga0466713_064097 Ga0466713_064097_28385_28870 161
10 3300042602 Ga0466713_130503 Ga0466713_130503_6273_6758 161
11 3300005083 Ga0068305_10924613 Ga0068305_109246131 162
12 3300010049 Ga0123356_11163644 Ga0123356_111636442 162
13 3300042601 Ga0466707_015396 Ga0466707_015396_31305_31793 162
14 3300042601 Ga0466707_021064 Ga0466707_021064_443_931 162
15 3300042599 Ga0466706_283517 Ga0466706_283517_3987_4478 163
16 iso_pr_bacteria 2820412446 2820413596 164
17 iso_pr_bacteria 2820444930 2820446910 164
18 3300010167 Ga0123353_10185740 Ga0123353_101857402 165
19 3300010882 Ga0123354_10043839 Ga0123354_100438391 165
20 3300042600 Ga0466700_386969 Ga0466700_386969_204_701 165
21 3300042612 Ga0466705_291477 Ga0466705_291477_1150_1647 165
22 3300009784 Ga0123357_10414087 Ga0123357_104140872 166
23 3300010049 Ga0123356_10385449 Ga0123356_103854492 166
24 3300042615 Ga0466711_288620 Ga0466711_288620_1077_1577 166
25 3300010049 Ga0123356_10332305 Ga0123356_103323051 167
26 3300042615 Ga0466711_042163 Ga0466711_042163_1277_1780 167
27 3300005083 Ga0068305_10032869 Ga0068305_1003286911 168
28 3300010049 Ga0123356_10002890 Ga0123356_100028903 168
29 3300010167 Ga0123353_10470519 Ga0123353_104705192 168
30 3300042606 Ga0466719_032446 Ga0466719_032446_1204_1710 168
31 3300042606 Ga0466719_445809 Ga0466719_445809_4129_4635 168
32 3300042620 Ga0466728_027037 Ga0466728_027037_5193_5699 168
33 3300042643 Ga0466704_339216 Ga0466704_339216_1744_2250 168
34 3300042652 Ga0466708_322579 Ga0466708_322579_29755_30261 168
35 3300002834 JGI24696J40584_12922671 JGI24696J40584_129226712 169
36 3300010049 Ga0123356_10131092 Ga0123356_101310922 169
37 3300010167 Ga0123353_10002040 Ga0123353_1000204011 169
38 3300010882 Ga0123354_10548693 Ga0123354_105486931 169
39 3300042599 Ga0466706_217298 Ga0466706_217298_193_702 169
40 3300042603 Ga0466714_030563 Ga0466714_030563_168_677 169
41 3300042609 Ga0466722_085278 Ga0466722_085278_935_1444 169
42 iso_pr_bacteria 2820336130 2820336511 169
43 3300009826 Ga0123355_10148815 Ga0123355_101488153 170
44 3300010049 Ga0123356_10074472 Ga0123356_100744724 170
45 3300010167 Ga0123353_10211826 Ga0123353_102118262 170
46 3300010167 Ga0123353_10376941 Ga0123353_103769411 170
47 3300021245 Ga0223683_1007266 Ga0223683_10072661 170
48 3300042600 Ga0466700_210474 Ga0466700_210474_47364_47876 170
49 3300042601 Ga0466707_004051 Ga0466707_004051_427_939 170
50 3300042601 Ga0466707_157350 Ga0466707_157350_960_1472 170
51 3300042601 Ga0466707_178948 Ga0466707_178948_14157_14669 170
52 3300042601 Ga0466707_214910 Ga0466707_214910_4774_5286 170
53 3300042601 Ga0466707_339854 Ga0466707_339854_597_1109 170
54 3300042605 Ga0466716_162866 Ga0466716_162866_843_1355 170
55 3300042612 Ga0466705_382835 Ga0466705_382835_3038_3550 170
56 3300042636 Ga0466703_154051 Ga0466703_154051_12113_12625 170
57 3300042636 Ga0466703_257416 Ga0466703_257416_6385_6897 170
58 3300042643 Ga0466704_264752 Ga0466704_264752_4941_5453 170
59 iso_pr_bacteria 2820447167 2820447298 170
60 3300005071 Ga0068302_10151599 Ga0068302_101515993 171
61 3300009784 Ga0123357_10100897 Ga0123357_101008973 171
62 3300009784 Ga0123357_10663217 Ga0123357_106632171 171
63 3300009826 Ga0123355_10040555 Ga0123355_100405556 171
64 3300010049 Ga0123356_10034966 Ga0123356_100349663 171
65 3300010049 Ga0123356_10883146 Ga0123356_108831461 171
66 3300042596 Ga0466696_269050 Ga0466696_269050_1085_1600 171
67 3300042616 Ga0466715_474817 Ga0466715_474817_755_1270 171
68 3300042617 Ga0466718_060376 Ga0466718_060376_4904_5419 171
69 3300042635 Ga0466702_280184 Ga0466702_280184_370_885 171
70 iso_pr_bacteria 2820535361 2820535687 171
71 3300002504 JGI24705J35276_11956761 JGI24705J35276_119567611 172
72 3300009784 Ga0123357_10000959 Ga0123357_1000095920 172
73 3300009826 Ga0123355_10052080 Ga0123355_100520802 172
74 3300009826 Ga0123355_10853838 Ga0123355_108538382 172
75 3300010167 Ga0123353_10835553 Ga0123353_108355532 172
76 3300042608 Ga0466721_015151 Ga0466721_015151_2299_2817 172
77 3300042608 Ga0466721_043150 Ga0466721_043150_306_824 172
78 3300042655 Ga0466727_273825 Ga0466727_273825_2515_3033 172
79 iso_pr_bacteria 2820280018 2820281289 172
80 3300010049 Ga0123356_10101606 Ga0123356_101016062 173
81 3300010167 Ga0123353_10003223 Ga0123353_1000322316 173
82 3300010167 Ga0123353_10116714 Ga0123353_101167145 173
83 3300010167 Ga0123353_10406646 Ga0123353_104066462 173
84 3300042590 Ga0466690_155085 Ga0466690_155085_664_1185 173
85 3300042592 Ga0466693_333416 Ga0466693_333416_10_531 173
86 3300042593 Ga0466691_062393 Ga0466691_062393_395_916 173
87 3300042593 Ga0466691_114417 Ga0466691_114417_3595_4116 173
88 3300042596 Ga0466696_473623 Ga0466696_473623_231_752 173
89 3300042598 Ga0466701_075754 Ga0466701_075754_2122_2643 173
90 3300042601 Ga0466707_409571 Ga0466707_409571_1413_1934 173
91 3300042606 Ga0466719_498250 Ga0466719_498250_22_543 173
92 3300042609 Ga0466722_258932 Ga0466722_258932_1308_1829 173
93 3300042612 Ga0466705_136074 Ga0466705_136074_19112_19633 173
94 3300042616 Ga0466715_067556 Ga0466715_067556_512_1033 173
95 3300042618 Ga0466723_041296 Ga0466723_041296_15479_16000 173
96 3300042618 Ga0466723_052022 Ga0466723_052022_8377_8898 173
97 3300042618 Ga0466723_145579 Ga0466723_145579_12635_13156 173
98 3300042620 Ga0466728_044983 Ga0466728_044983_515_1036 173
99 3300042636 Ga0466703_260503 Ga0466703_260503_826_1347 173
100 3300042643 Ga0466704_090215 Ga0466704_090215_3114_3635 173
101 3300042648 Ga0466709_379506 Ga0466709_379506_1026_1547 173
102 3300042649 Ga0466724_39650 Ga0466724_39650_316_837 173
103 3300042652 Ga0466708_023932 Ga0466708_023932_7015_7536 173
104 3300042652 Ga0466708_332359 Ga0466708_332359_1833_2354 173
105 3300005083 Ga0068305_10207522 Ga0068305_102075223 174
106 3300009826 Ga0123355_10462494 Ga0123355_104624942 174
107 3300009826 Ga0123355_11533145 Ga0123355_115331452 174
108 3300010049 Ga0123356_10079256 Ga0123356_100792562 174
109 3300010049 Ga0123356_10578557 Ga0123356_105785572 174
110 3300010167 Ga0123353_10334937 Ga0123353_103349372 174
111 3300042591 Ga0466692_014670 Ga0466692_014670_6827_7351 174
112 3300042596 Ga0466696_312502 Ga0466696_312502_227_751 174
113 3300042600 Ga0466700_295415 Ga0466700_295415_269_793 174
114 3300042601 Ga0466707_087373 Ga0466707_087373_521_1045 174
115 3300042601 Ga0466707_177673 Ga0466707_177673_12913_13437 174
116 3300042601 Ga0466707_203754 Ga0466707_203754_1990_2514 174
117 3300042603 Ga0466714_016568 Ga0466714_016568_184_708 174
118 3300042603 Ga0466714_035606 Ga0466714_035606_68_592 174
119 3300042611 Ga0466697_258164 Ga0466697_258164_162_686 174
120 3300042616 Ga0466715_069964 Ga0466715_069964_6828_7352 174
121 3300042636 Ga0466703_130111 Ga0466703_130111_893_1417 174
122 3300042643 Ga0466704_128107 Ga0466704_128107_524_1048 174
123 3300042655 Ga0466727_130526 Ga0466727_130526_2968_3492 174
124 3300009826 Ga0123355_10133225 Ga0123355_101332253 175
125 3300010882 Ga0123354_10356306 Ga0123354_103563062 175
126 3300042601 Ga0466707_123777 Ga0466707_123777_1451_1978 175
127 3300042616 Ga0466715_277359 Ga0466715_277359_296_823 175
128 3300042618 Ga0466723_069406 Ga0466723_069406_1463_1990 175
129 3300042654 Ga0466725_248854 Ga0466725_248854_667_1194 175
130 3300005083 Ga0068305_10019772 Ga0068305_100197726 176
131 3300010049 Ga0123356_10362656 Ga0123356_103626562 176
132 3300010167 Ga0123353_10533043 Ga0123353_105330432 176
133 3300042601 Ga0466707_085339 Ga0466707_085339_3118_3648 176
134 3300042654 Ga0466725_333627 Ga0466725_333627_1118_1648 176
135 3300010167 Ga0123353_10915719 Ga0123353_109157191 177
136 3300010167 Ga0123353_11041366 Ga0123353_110413662 177
137 3300010167 Ga0123353_11410961 Ga0123353_114109611 177
138 3300042594 Ga0466694_037316 Ga0466694_037316_531_1064 177
139 3300042619 Ga0466726_360933 Ga0466726_360933_6632_7165 177
140 3300042652 Ga0466708_073980 Ga0466708_073980_2541_3074 177
141 3300010049 Ga0123356_10825903 Ga0123356_108259031 178
142 3300042600 Ga0466700_009729 Ga0466700_009729_604_1140 178
143 3300042636 Ga0466703_349787 Ga0466703_349787_7466_8002 178
144 iso_pr_bacteria 2819994798 2819996114 178
145 3300002508 JGI24700J35501_10929780 JGI24700J35501_109297803 179
146 3300042601 Ga0466707_263143 Ga0466707_263143_353_892 179
147 3300042652 Ga0466708_044368 Ga0466708_044368_1428_1967 179
148 3300042591 Ga0466692_135158 Ga0466692_135158_1091_1636 181
149 3300042636 Ga0466703_305192 Ga0466703_305192_5124_5669 181
150 3300042643 Ga0466704_510167 Ga0466704_510167_1230_1775 181
151 iso_pr_bacteria 2820464928 2820465383 181
152 3300042609 Ga0466722_216127 Ga0466722_216127_5619_6167 182
153 3300042620 Ga0466728_167970 Ga0466728_167970_737_1285 182
154 3300009826 Ga0123355_10226957 Ga0123355_102269572 183
155 3300009826 Ga0123355_10232056 Ga0123355_102320562 183
156 3300042601 Ga0466707_051885 Ga0466707_051885_933_1484 183
157 3300010167 Ga0123353_10765635 Ga0123353_107656352 184
158 iso_pr_bacteria 2820362221 2820364158 185
159 3300010049 Ga0123356_10137796 Ga0123356_101377963 188
160 3300042609 Ga0466722_141564 Ga0466722_141564_3455_4030 191
161 3300042621 Ga0466729_265539 Ga0466729_265539_52_633 193
162 3300009826 Ga0123355_10100364 Ga0123355_101003643 194
163 3300009826 Ga0123355_10122941 Ga0123355_101229413 209
164 3300010049 Ga0123356_10053627 Ga0123356_100536272 209

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin 40 184 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.