Protein Family IF08560
Metagenome
Isolate
142
Members
75
Samples
105
Scaffolds
235.36
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_264517|Ga0466729_264517_7028_7852
- Length
- 274 aa
- Sequence
- MIIRIPFHKCLDNFHGRKVTEKYRNSDNLTWFLYLCIRMKGKNKTIGRRILIWIRNFVLFLFLSSLLAVVALRFIPVYYTPLMFICVYEQKKAGKKAKIDHHWVPISEINNSLVLAVCSSEDNRFMTHKGFDFEQIGKAREEAEKGKRVRGASTISQQTAKNVFLWPGKTYVRKGLEAYFTILIELIWSKERIMEVYLNSIEMGDGIYGAEAVALAHFGKHAVGLSRSDSALIAATLPNPRQRNSAKPSKYMLARQAQILSLMNKIGVIDIGHK
Sample Types
Isolate
26.1%
Metagenome
73.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
24.3%
Termitidae
21.6%
Kalotermitidae
16.2%
Unclassified
9.5%
Rhinotermitidae
8.1%
Apidae
6.8%
Termopsidae
4.1%
Hydrophilidae
2.7%
Elmidae
2.7%
Tenebrionidae
1.4%
Drosophilidae
1.4%
Passalidae
1.4%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 3 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 4 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 5 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 9 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 18 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 25 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 26 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 33 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 34 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 47 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 48 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 49 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 53 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 54 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 55 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 56 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 57 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 58 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 60 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 61 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 62 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 63 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 64 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 65 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 66 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 67 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 68 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 69 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 70 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 71 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 72 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 73 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 74 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 75 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_272299 | 3300042601 | Bacteria | 2602 |
| 2 | Ga0466716_263714 | 3300042605 | Bacteria | 11449 |
| 3 | Ga0466696_375185 | 3300042596 | Bacteria | 2421 |
| 4 | Ga0466735_172817 | 3300042624 | Bacteria | 5567 |
| 5 | Ga0466704_467531 | 3300042643 | Bacteria | 2379 |
| 6 | Ga0466725_204635 | 3300042654 | Bacteria | 6310 |
| 7 | Ga0466727_044212 | 3300042655 | Bacteria | 34323 |
| 8 | Ga0466715_096655 | 3300042616 | Bacteria | 9257 |
| 9 | Ga0123353_10196288 | 3300010167 | Bacteria | 3181 |
| 10 | JGI24699J35502_11133072 | 3300002509 | Bacteria | 8538 |
| 11 | Ga0072941_1042687 | 3300005201 | Bacteria | 4764 |
| 12 | Ga0466713_003460 | 3300042602 | Bacteria | 8953 |
| 13 | Ga0466719_147541 | 3300042606 | Bacteria | 4662 |
| 14 | Ga0466703_023239 | 3300042636 | Bacteria | 13241 |
| 15 | Ga0466711_258909 | 3300042615 | Unclassified | 1072 |
| 16 | Ga0466715_589396 | 3300042616 | Bacteria | 12774 |
| 17 | Ga0466726_273197 | 3300042619 | Bacteria | 4975 |
| 18 | Ga0466726_320301 | 3300042619 | Bacteria | 2579 |
| 19 | Ga0123357_10006182 | 3300009784 | Bacteria | 14525 |
| 20 | Ga0123357_10000610 | 3300009784 | Bacteria | 35456 |
| 21 | Ga0466701_036771 | 3300042598 | Bacteria | 249987 |
| 22 | Ga0466707_294599 | 3300042601 | Bacteria | 2222 |
| 23 | Ga0466713_120509 | 3300042602 | Bacteria | 47742 |
| 24 | Ga0466693_266577 | 3300042592 | Unclassified | 1858 |
| 25 | Ga0466694_112937 | 3300042594 | Bacteria | 1270 |
| 26 | Ga0466696_499062 | 3300042596 | Bacteria | 27716 |
| 27 | Ga0466704_188446 | 3300042643 | Bacteria | 2714 |
| 28 | Ga0466727_030719 | 3300042655 | Bacteria | 10786 |
| 29 | Ga0466705_497288 | 3300042612 | Bacteria | 2822 |
| 30 | Ga0466711_147184 | 3300042615 | Bacteria | 5621 |
| 31 | Ga0123357_10004606 | 3300009784 | Bacteria | 16255 |
| 32 | Ga0123354_10051129 | 3300010882 | Bacteria | 6243 |
| 33 | JGI24702J35022_10005407 | 3300002462 | Bacteria | 7476 |
| 34 | JGI24699J35502_11133282 | 3300002509 | Bacteria | 9610 |
| 35 | Ga0466733_186368 | 3300042659 | Bacteria | 5962 |
| 36 | Ga0466716_289995 | 3300042605 | Bacteria | 8463 |
| 37 | Ga0466722_072763 | 3300042609 | Bacteria | 9170 |
| 38 | Ga0466722_225453 | 3300042609 | Bacteria | 1580 |
| 39 | Ga0466722_247400 | 3300042609 | Bacteria | 1822 |
| 40 | Ga0466690_285891 | 3300042590 | Bacteria | 8306 |
| 41 | Ga0466692_094153 | 3300042591 | Bacteria | 23788 |
| 42 | Ga0466730_075792 | 3300042625 | Unclassified | 3351 |
| 43 | Ga0466727_172044 | 3300042655 | Bacteria | 11172 |
| 44 | Ga0466711_005130 | 3300042615 | Bacteria | 6633 |
| 45 | Ga0466711_083575 | 3300042615 | Bacteria | 31587 |
| 46 | Ga0123357_10204490 | 3300009784 | Bacteria | 2238 |
| 47 | Ga0123354_10077698 | 3300010882 | Bacteria | 4726 |
| 48 | Ga0123354_10389694 | 3300010882 | Unclassified | 1193 |
| 49 | Ga0104048_1029256 | 3300007143 | Bacteria | 5860 |
| 50 | Ga0466713_016871 | 3300042602 | Bacteria | 29897 |
| 51 | Ga0466716_247276 | 3300042605 | Bacteria | 14230 |
| 52 | Ga0466719_069434 | 3300042606 | Bacteria | 2405 |
| 53 | Ga0466729_264517 | 3300042621 | Bacteria | 26130 |
| 54 | Ga0466703_314908 | 3300042636 | Bacteria | 14200 |
| 55 | Ga0466708_052688 | 3300042652 | Bacteria | 18489 |
| 56 | Ga0466725_208009 | 3300042654 | Bacteria | 11330 |
| 57 | Ga0466727_105304 | 3300042655 | Bacteria | 15804 |
| 58 | Ga0123357_10005407 | 3300009784 | Bacteria | 15290 |
| 59 | Ga0123357_10267602 | 3300009784 | Bacteria | 1793 |
| 60 | Ga0466701_089428 | 3300042598 | Bacteria | 9441 |
| 61 | Ga0466700_120486 | 3300042600 | Bacteria | 2054 |
| 62 | Ga0466700_241924 | 3300042600 | Bacteria | 1161 |
| 63 | Ga0466707_403008 | 3300042601 | Bacteria | 2359 |
| 64 | Ga0466716_085926 | 3300042605 | Bacteria | 4722 |
| 65 | Ga0466719_303380 | 3300042606 | Bacteria | 2954 |
| 66 | Ga0466703_236057 | 3300042636 | Bacteria | 3284 |
| 67 | Ga0466703_264503 | 3300042636 | Bacteria | 10954 |
| 68 | Ga0466704_064342 | 3300042643 | Bacteria | 12076 |
| 69 | Ga0466709_324409 | 3300042648 | Bacteria | 6207 |
| 70 | Ga0466715_609492 | 3300042616 | Bacteria | 9096 |
| 71 | Ga0123357_10380016 | 3300009784 | Bacteria | 1312 |
| 72 | Ga0123354_10085568 | 3300010882 | Bacteria | 4415 |
| 73 | Ga0123354_10138266 | 3300010882 | Bacteria | 3031 |
| 74 | IMNBL1DRAFT_c0003228 | 3300000062 | Bacteria | 10659 |
| 75 | JGI24696J40584_12934677 | 3300002834 | Bacteria | 1544 |
| 76 | Ga0466705_060603 | 3300042612 | Bacteria | 10055 |
| 77 | Ga0466733_142411 | 3300042659 | Bacteria | 3336 |
| 78 | Ga0466713_067684 | 3300042602 | Bacteria | 5512 |
| 79 | Ga0466692_032068 | 3300042591 | Bacteria | 25323 |
| 80 | Ga0466696_070671 | 3300042596 | Bacteria | 2638 |
| 81 | Ga0466735_156278 | 3300042624 | Bacteria | 1126 |
| 82 | Ga0466735_223720 | 3300042624 | Bacteria | 4157 |
| 83 | Ga0466709_349525 | 3300042648 | Bacteria | 4678 |
| 84 | Ga0466727_260058 | 3300042655 | Bacteria | 3178 |
| 85 | Ga0466711_163307 | 3300042615 | Bacteria | 57894 |
| 86 | Ga0466711_392107 | 3300042615 | Bacteria | 21134 |
| 87 | Ga0466726_243016 | 3300042619 | Bacteria | 9525 |
| 88 | Ga0123357_10058319 | 3300009784 | Bacteria | 5184 |
| 89 | Ga0123354_10029273 | 3300010882 | Bacteria | 8667 |
| 90 | Ga0123354_10052241 | 3300010882 | Bacteria | 6159 |
| 91 | JGI24705J35276_12160613 | 3300002504 | Bacteria | 1231 |
| 92 | Ga0466713_153450 | 3300042602 | Bacteria | 4530 |
| 93 | Ga0466714_125951 | 3300042603 | Bacteria | 7817 |
| 94 | Ga0466716_285075 | 3300042605 | Bacteria | 11543 |
| 95 | Ga0466703_216904 | 3300042636 | Bacteria | 24151 |
| 96 | Ga0466704_073764 | 3300042643 | Bacteria | 58999 |
| 97 | Ga0466704_471861 | 3300042643 | Bacteria | 6301 |
| 98 | Ga0466708_069144 | 3300042652 | Bacteria | 4400 |
| 99 | Ga0466705_490117 | 3300042612 | Bacteria | 18099 |
| 100 | Ga0466711_169603 | 3300042615 | Bacteria | 13461 |
| 101 | Ga0466723_190032 | 3300042618 | Bacteria | 1611 |
| 102 | Ga0466729_177732 | 3300042621 | Bacteria | 1126 |
| 103 | Ga0123356_10474203 | 3300010049 | Bacteria | 1403 |
| 104 | Ga0123354_10040937 | 3300010882 | Bacteria | 7163 |
| 105 | IMNBL1DRAFT_c0002048 | 3300000062 | Bacteria | 14421 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042594 | Ga0466694_112937 | Ga0466694_112937_201_776 | 191 |
| 2 | 3300042596 | Ga0466696_070671 | Ga0466696_070671_1786_2481 | 216 |
| 3 | 3300005201 | Ga0072941_1042687 | Ga0072941_10426875 | 220 |
| 4 | 3300042592 | Ga0466693_266577 | Ga0466693_266577_25_750 | 220 |
| 5 | 3300042601 | Ga0466707_294599 | Ga0466707_294599_1091_1756 | 221 |
| 6 | 3300010882 | Ga0123354_10077698 | Ga0123354_100776982 | 222 |
| 7 | 3300042605 | Ga0466716_247276 | Ga0466716_247276_193_903 | 222 |
| 8 | 3300002509 | JGI24699J35502_11133072 | JGI24699J35502_111330725 | 223 |
| 9 | 3300009784 | Ga0123357_10267602 | Ga0123357_102676022 | 223 |
| 10 | 3300042605 | Ga0466716_085926 | Ga0466716_085926_2247_2933 | 223 |
| 11 | 3300042624 | Ga0466735_223720 | Ga0466735_223720_2312_3058 | 223 |
| 12 | 3300010882 | Ga0123354_10052241 | Ga0123354_100522414 | 224 |
| 13 | 3300042600 | Ga0466700_120486 | Ga0466700_120486_1080_1814 | 224 |
| 14 | 3300042609 | Ga0466722_247400 | Ga0466722_247400_711_1406 | 225 |
| 15 | 3300010882 | Ga0123354_10051129 | Ga0123354_100511295 | 226 |
| 16 | 3300010882 | Ga0123354_10138266 | Ga0123354_101382663 | 226 |
| 17 | 3300010882 | Ga0123354_10389694 | Ga0123354_103896942 | 226 |
| 18 | 3300042602 | Ga0466713_003460 | Ga0466713_003460_6645_7325 | 226 |
| 19 | 3300042659 | Ga0466733_186368 | Ga0466733_186368_1337_2017 | 226 |
| 20 | iso_pr_bacteria | 2695420317 | 2695486350 | 226 |
| 21 | iso_pr_bacteria | 2873600114 | 2873601020 | 226 |
| 22 | iso_pr_bacteria | 2873610414 | 2873611358 | 226 |
| 23 | iso_pr_bacteria | 2910930387 | 2910932759 | 226 |
| 24 | iso_pr_bacteria | 2910930387 | 2910933148 | 226 |
| 25 | iso_pr_bacteria | 8100157865 | 8100160521 | 226 |
| 26 | 3300042615 | Ga0466711_258909 | Ga0466711_258909_188_895 | 227 |
| 27 | 3300002462 | JGI24702J35022_10005407 | JGI24702J35022_100054079 | 228 |
| 28 | 3300009784 | Ga0123357_10058319 | Ga0123357_100583192 | 228 |
| 29 | 3300010882 | Ga0123354_10040937 | Ga0123354_1004093710 | 228 |
| 30 | 3300042643 | Ga0466704_064342 | Ga0466704_064342_4986_5672 | 228 |
| 31 | 3300009784 | Ga0123357_10004606 | Ga0123357_100046066 | 229 |
| 32 | 3300009784 | Ga0123357_10006182 | Ga0123357_1000618210 | 229 |
| 33 | 3300010167 | Ga0123353_10196288 | Ga0123353_101962883 | 229 |
| 34 | 3300042602 | Ga0466713_016871 | Ga0466713_016871_134_865 | 229 |
| 35 | 3300042609 | Ga0466722_072763 | Ga0466722_072763_4777_5469 | 230 |
| 36 | 3300042615 | Ga0466711_163307 | Ga0466711_163307_19605_20297 | 230 |
| 37 | 3300042616 | Ga0466715_609492 | Ga0466715_609492_2975_3667 | 230 |
| 38 | 3300042643 | Ga0466704_471861 | Ga0466704_471861_2279_2971 | 230 |
| 39 | 3300002834 | JGI24696J40584_12934677 | JGI24696J40584_129346772 | 231 |
| 40 | 3300010882 | Ga0123354_10029273 | Ga0123354_100292737 | 231 |
| 41 | 3300042598 | Ga0466701_089428 | Ga0466701_089428_3656_4351 | 231 |
| 42 | 3300042609 | Ga0466722_225453 | Ga0466722_225453_655_1350 | 231 |
| 43 | 3300042615 | Ga0466711_169603 | Ga0466711_169603_1718_2464 | 231 |
| 44 | 3300042648 | Ga0466709_349525 | Ga0466709_349525_1768_2463 | 231 |
| 45 | 3300042652 | Ga0466708_069144 | Ga0466708_069144_1678_2421 | 231 |
| 46 | 3300000062 | IMNBL1DRAFT_c0003228 | IMNBL1DRAFT_000322811 | 232 |
| 47 | 3300042598 | Ga0466701_036771 | Ga0466701_036771_174180_174878 | 232 |
| 48 | 3300042619 | Ga0466726_273197 | Ga0466726_273197_2191_2940 | 232 |
| 49 | 3300042655 | Ga0466727_172044 | Ga0466727_172044_2202_2900 | 232 |
| 50 | 3300007143 | Ga0104048_1029256 | Ga0104048_10292562 | 233 |
| 51 | 3300042619 | Ga0466726_320301 | Ga0466726_320301_1623_2324 | 233 |
| 52 | 3300042643 | Ga0466704_467531 | Ga0466704_467531_949_1650 | 233 |
| 53 | 3300042654 | Ga0466725_208009 | Ga0466725_208009_10068_10769 | 233 |
| 54 | 3300009784 | Ga0123357_10005407 | Ga0123357_1000540711 | 234 |
| 55 | 3300042590 | Ga0466690_285891 | Ga0466690_285891_852_1556 | 234 |
| 56 | 3300042602 | Ga0466713_067684 | Ga0466713_067684_3909_4676 | 234 |
| 57 | 3300042605 | Ga0466716_263714 | Ga0466716_263714_5724_6428 | 234 |
| 58 | 3300042605 | Ga0466716_289995 | Ga0466716_289995_1178_1882 | 234 |
| 59 | 3300042612 | Ga0466705_490117 | Ga0466705_490117_2148_2909 | 234 |
| 60 | 3300042616 | Ga0466715_096655 | Ga0466715_096655_4307_5011 | 234 |
| 61 | 3300042616 | Ga0466715_589396 | Ga0466715_589396_2965_3669 | 234 |
| 62 | 3300042636 | Ga0466703_216904 | Ga0466703_216904_12421_13125 | 234 |
| 63 | 3300042648 | Ga0466709_324409 | Ga0466709_324409_1785_2489 | 234 |
| 64 | 3300042652 | Ga0466708_052688 | Ga0466708_052688_4084_4788 | 234 |
| 65 | 3300042655 | Ga0466727_030719 | Ga0466727_030719_9187_9891 | 234 |
| 66 | 3300042655 | Ga0466727_105304 | Ga0466727_105304_6569_7273 | 234 |
| 67 | iso_pr_bacteria | 2515154048 | 2515334865 | 234 |
| 68 | iso_pr_bacteria | 2854127928 | 2854127963 | 234 |
| 69 | iso_pr_bacteria | 2873651485 | 2873652985 | 234 |
| 70 | iso_pr_bacteria | 2876014139 | 2876015762 | 234 |
| 71 | iso_pr_bacteria | 2876036378 | 2876037711 | 234 |
| 72 | 3300000062 | IMNBL1DRAFT_c0002048 | IMNBL1DRAFT_00020488 | 235 |
| 73 | 3300042615 | Ga0466711_005130 | Ga0466711_005130_4531_5238 | 235 |
| 74 | 3300042615 | Ga0466711_083575 | Ga0466711_083575_29066_29773 | 235 |
| 75 | 3300042615 | Ga0466711_147184 | Ga0466711_147184_2760_3467 | 235 |
| 76 | 3300042601 | Ga0466707_272299 | Ga0466707_272299_1782_2492 | 236 |
| 77 | 3300042624 | Ga0466735_156278 | Ga0466735_156278_386_1096 | 236 |
| 78 | iso_pr_bacteria | 2940205530 | 2940206275 | 236 |
| 79 | iso_pr_bacteria | 2940212447 | 2940213451 | 236 |
| 80 | iso_pr_bacteria | 2940298504 | 2940299246 | 236 |
| 81 | iso_pr_bacteria | 2940302308 | 2940303312 | 236 |
| 82 | iso_pr_bacteria | 2940306115 | 2940306791 | 236 |
| 83 | iso_pr_bacteria | 2940309933 | 2940310607 | 236 |
| 84 | iso_pr_bacteria | 2940313741 | 2940314678 | 236 |
| 85 | iso_pr_bacteria | 2940317558 | 2940318493 | 236 |
| 86 | iso_pr_bacteria | 2940325180 | 2940326184 | 236 |
| 87 | iso_pr_bacteria | 2940328985 | 2940329729 | 236 |
| 88 | iso_pr_bacteria | 2940332795 | 2940333471 | 236 |
| 89 | 3300042596 | Ga0466696_375185 | Ga0466696_375185_1220_1933 | 237 |
| 90 | 3300042605 | Ga0466716_285075 | Ga0466716_285075_1952_2665 | 237 |
| 91 | 3300042606 | Ga0466719_147541 | Ga0466719_147541_2876_3589 | 237 |
| 92 | 3300042612 | Ga0466705_060603 | Ga0466705_060603_8564_9277 | 237 |
| 93 | iso_pr_bacteria | 2940193328 | 2940193519 | 237 |
| 94 | iso_pr_bacteria | 2940336608 | 2940336799 | 237 |
| 95 | 3300010049 | Ga0123356_10474203 | Ga0123356_104742032 | 238 |
| 96 | 3300042600 | Ga0466700_241924 | Ga0466700_241924_342_1091 | 238 |
| 97 | 3300042602 | Ga0466713_153450 | Ga0466713_153450_1635_2351 | 238 |
| 98 | 3300042621 | Ga0466729_177732 | Ga0466729_177732_49_765 | 238 |
| 99 | 3300042643 | Ga0466704_188446 | Ga0466704_188446_1048_1764 | 238 |
| 100 | 3300009784 | Ga0123357_10380016 | Ga0123357_103800162 | 239 |
| 101 | 3300042591 | Ga0466692_032068 | Ga0466692_032068_23431_24150 | 239 |
| 102 | 3300042606 | Ga0466719_069434 | Ga0466719_069434_976_1728 | 239 |
| 103 | iso_pr_bacteria | 2609459943 | 2610742559 | 239 |
| 104 | iso_pr_bacteria | 2830041218 | 2830044628 | 239 |
| 105 | iso_pr_bacteria | 2899132286 | 2899132539 | 239 |
| 106 | 3300002509 | JGI24699J35502_11133282 | JGI24699J35502_111332824 | 240 |
| 107 | 3300042606 | Ga0466719_303380 | Ga0466719_303380_671_1393 | 240 |
| 108 | 3300042636 | Ga0466703_264503 | Ga0466703_264503_5991_6713 | 240 |
| 109 | iso_pr_bacteria | 2695420931 | 2698108974 | 240 |
| 110 | iso_pr_bacteria | 2820778767 | 2820779543 | 240 |
| 111 | 3300009784 | Ga0123357_10000610 | Ga0123357_1000061025 | 241 |
| 112 | 3300042654 | Ga0466725_204635 | Ga0466725_204635_3146_3871 | 241 |
| 113 | 3300042612 | Ga0466705_497288 | Ga0466705_497288_36_764 | 242 |
| 114 | 3300042636 | Ga0466703_314908 | Ga0466703_314908_526_1254 | 242 |
| 115 | 3300042643 | Ga0466704_073764 | Ga0466704_073764_5805_6533 | 242 |
| 116 | 3300042655 | Ga0466727_044212 | Ga0466727_044212_4786_5586 | 242 |
| 117 | 3300042602 | Ga0466713_120509 | Ga0466713_120509_32597_33328 | 243 |
| 118 | 3300042625 | Ga0466730_075792 | Ga0466730_075792_1085_1816 | 243 |
| 119 | 3300042659 | Ga0466733_142411 | Ga0466733_142411_1750_2481 | 243 |
| 120 | 3300042591 | Ga0466692_094153 | Ga0466692_094153_16664_17398 | 244 |
| 121 | iso_pr_bacteria | 2940202316 | 2940204824 | 244 |
| 122 | 3300009784 | Ga0123357_10204490 | Ga0123357_102044902 | 245 |
| 123 | 3300042655 | Ga0466727_260058 | Ga0466727_260058_510_1247 | 245 |
| 124 | 3300010882 | Ga0123354_10085568 | Ga0123354_100855684 | 246 |
| 125 | iso_pr_bacteria | 8100166142 | 8100166494 | 246 |
| 126 | 3300002504 | JGI24705J35276_12160613 | JGI24705J35276_121606132 | 247 |
| 127 | 3300042618 | Ga0466723_190032 | Ga0466723_190032_29_796 | 247 |
| 128 | 3300042619 | Ga0466726_243016 | Ga0466726_243016_840_1637 | 247 |
| 129 | 3300042624 | Ga0466735_172817 | Ga0466735_172817_2564_3307 | 247 |
| 130 | 3300042636 | Ga0466703_023239 | Ga0466703_023239_10203_10946 | 247 |
| 131 | iso_pr_bacteria | 2695420314 | 2695470709 | 247 |
| 132 | 3300042615 | Ga0466711_392107 | Ga0466711_392107_3996_4769 | 248 |
| 133 | 3300042603 | Ga0466714_125951 | Ga0466714_125951_121_870 | 249 |
| 134 | 3300042596 | Ga0466696_499062 | Ga0466696_499062_14791_15543 | 250 |
| 135 | 3300042636 | Ga0466703_236057 | Ga0466703_236057_505_1257 | 250 |
| 136 | 3300042601 | Ga0466707_403008 | Ga0466707_403008_1130_1888 | 252 |
| 137 | iso_pr_bacteria | 2940244548 | 2940245977 | 254 |
| 138 | iso_pr_bacteria | 2940248789 | 2940249801 | 254 |
| 139 | iso_pr_bacteria | 2940253009 | 2940253876 | 254 |
| 140 | iso_pr_bacteria | 2864878056 | 2864878179 | 262 |
| 141 | iso_pr_bacteria | 2864886855 | 2864888135 | 262 |
| 142 | 3300042621 | Ga0466729_264517 | Ga0466729_264517_7028_7852 | 274 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00912 | Transgly | Transglycosylase | 98 | 263 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.76 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.