Protein Family IF08551

Metagenome Isolate
114 Members
43 Samples
108 Scaffolds
310.83 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_248721|Ga0466729_248721_71_970
Length
299 aa
Sequence
VIAASGTFGYGKEYAGLLDIASLGGICTKGLTLYPRPGNSGVRLHETSAGLMNSIGLENPGIPDFIDKELPALCSLGPVVIANLSGSTIEEYTEGARLLDTASVDMVELNISCPNVKAGGMAFGLDAEAAASVTKPVRNALHKPLVVKLSPNVADIAAVARACVNAGADVLSLVNTFKAMAIDVARGRPVFDNVSAGLSGPAIKPLALRMVWELYNALADCKALVPIIGMGGIASAFDALEFLMAGAVAIQIGSATFSHPPVMTEIIAGIAEYMEQKGIKHVEALNIRAHKITSFNCVL

📊 Sample Types

Isolate 5.3%
Metagenome 94.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.9%
Kalotermitidae 26.8%
Unclassified 17.1%
Rhinotermitidae 7.3%
Termopsidae 4.9%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
4 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
5 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
6 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
9 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
10 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
11 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
12 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
13 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
14 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
15 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
16 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
17 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_231127 3300042601 Bacteria 3169
2 Ga0466722_242431 3300042609 Bacteria 8800
3 Ga0466694_123440 3300042594 Bacteria 50310
4 Ga0123353_10336625 3300010167 Bacteria 2282
5 Ga0466705_513769 3300042612 Bacteria 2630
6 Ga0466712_155462 3300042614 Bacteria 13803
7 JGI24698J34947_10004436 3300002449 Bacteria 7640
8 JGI24698J34947_10124889 3300002449 Unclassified 1110
9 Ga0466732_185824 3300042656 Bacteria 2839
10 Ga0466732_270489 3300042656 Bacteria 1690
11 Ga0466720_065204 3300042607 Bacteria 12621
12 Ga0466699_119861 3300042597 Bacteria 3506
13 Ga0123357_10023120 3300009784 Bacteria 8348
14 Ga0466712_073550 3300042614 Bacteria 8937
15 Ga0466712_154954 3300042614 Bacteria 2792
16 Ga0466715_174394 3300042616 Bacteria 13909
17 Ga0466726_145874 3300042619 Bacteria 1893
18 Ga0466726_252112 3300042619 Bacteria 1574
19 Ga0466729_248721 3300042621 Bacteria 1350
20 Ga0466704_072004 3300042643 Bacteria 8653
21 JGI24698J34947_10000498 3300002449 Bacteria 18505
22 JGI24698J34947_10008677 3300002449 Bacteria 5577
23 JGI24698J34947_10099559 3300002449 Bacteria 1311
24 JGI24695J34938_10002109 3300002450 Bacteria 15578
25 Ga0072940_1001818 3300005200 Bacteria 7055
26 Ga0074263_115646 3300005485 Bacteria 1336
27 Ga0466732_065017 3300042656 Bacteria 11408
28 Ga0466700_190304 3300042600 Bacteria 1286
29 Ga0466720_071326 3300042607 Bacteria 9803
30 Ga0466720_132912 3300042607 Bacteria 1318
31 Ga0466722_124518 3300042609 Bacteria 5585
32 Ga0466691_168888 3300042593 Bacteria 17728
33 Ga0466691_181119 3300042593 Bacteria 6263
34 Ga0466699_070191 3300042597 Bacteria 6270
35 Ga0466699_221174 3300042597 Bacteria 1155
36 Ga0466704_616659 3300042643 Bacteria 6397
37 Ga0466708_045285 3300042652 Bacteria 41948
38 Ga0466727_111734 3300042655 Bacteria 1738
39 JGI24698J34947_10000601 3300002449 Bacteria 17232
40 JGI24698J34947_10005104 3300002449 Bacteria 7195
41 JGI24702J35022_10084622 3300002462 Bacteria 1721
42 Ga0466720_014328 3300042607 Bacteria 4922
43 Ga0466720_062745 3300042607 Bacteria 1841
44 Ga0466720_098651 3300042607 Bacteria 30361
45 Ga0466720_234432 3300042607 Bacteria 7179
46 Ga0466722_082551 3300042609 Bacteria 20980
47 Ga0466722_178213 3300042609 Bacteria 6518
48 Ga0264413_100162 3300024493 Bacteria 9257
49 Ga0466694_012922 3300042594 Bacteria 4743
50 Ga0466699_297663 3300042597 Bacteria 1396
51 Ga0466699_299789 3300042597 Bacteria 1900
52 Ga0466699_302763 3300042597 Bacteria 1373
53 Ga0123353_11051702 3300010167 Bacteria 1087
54 Ga0466712_136525 3300042614 Unclassified 7014
55 Ga0466712_188058 3300042614 Unclassified 6839
56 Ga0466723_097622 3300042618 Bacteria 4381
57 Ga0466726_195726 3300042619 Bacteria 2469
58 Ga0466704_106809 3300042643 Bacteria 6711
59 Ga0466727_176897 3300042655 Bacteria 1187
60 JGI24698J34947_10000856 3300002449 Bacteria 15317
61 JGI24698J34947_10076249 3300002449 Unclassified 1590
62 Ga0466732_132877 3300042656 Bacteria 27559
63 Ga0466716_533892 3300042605 Bacteria 3572
64 Ga0466698_046547 3300042610 Bacteria 3313
65 Ga0415639_038453 3300038395 Bacteria 1201
66 Ga0466690_022811 3300042590 Bacteria 6826
67 Ga0466694_250173 3300042594 Bacteria 1694
68 Ga0466699_149706 3300042597 Bacteria 6776
69 Ga0466699_211009 3300042597 Bacteria 48420
70 Ga0466699_332107 3300042597 Bacteria 7869
71 Ga0466712_000314 3300042614 Bacteria 10727
72 Ga0466712_036333 3300042614 Bacteria 33114
73 Ga0466718_056138 3300042617 Bacteria 9183
74 Ga0466727_055689 3300042655 Bacteria 3404
75 AustNasuHG_c1014297 3300000089 Bacteria 2704
76 AustNasuHG_c1030224 3300000089 Bacteria 1564
77 JGI24698J34947_10000933 3300002449 Bacteria 14857
78 Ga0466705_318672 3300042612 Bacteria 4063
79 Ga0466720_218533 3300042607 Bacteria 7675
80 Ga0466699_179599 3300042597 Bacteria 4061
81 Ga0466699_282133 3300042597 Bacteria 1908
82 Ga0123354_10037862 3300010882 Bacteria 7500
83 Ga0466712_262012 3300042614 Bacteria 15848
84 Ga0466715_019046 3300042616 Bacteria 1843
85 JGI24698J34947_10033789 3300002449 Bacteria 2681
86 Ga0466719_059146 3300042606 Bacteria 4249
87 Ga0466720_120821 3300042607 Bacteria 1499
88 Ga0466722_048847 3300042609 Bacteria 2230
89 Ga0466696_254933 3300042596 Bacteria 2867
90 Ga0123353_10229495 3300010167 Bacteria 2896
91 Ga0466723_018641 3300042618 Bacteria 57830
92 Ga0466726_236459 3300042619 Bacteria 1362
93 Ga0466728_308392 3300042620 Bacteria 9071
94 JGI24698J34947_10000937 3300002449 Bacteria 14836
95 JGI24698J34947_10003595 3300002449 Bacteria 8421
96 JGI24698J34947_10017194 3300002449 Bacteria 3921
97 JGI24695J34938_10019902 3300002450 Bacteria 3314
98 Ga0466720_125366 3300042607 Bacteria 14214
99 Ga0466698_427830 3300042610 Bacteria 3004
100 Ga0456237_0005952 3300041968 Bacteria 1923
101 Ga0466699_053392 3300042597 Bacteria 12258
102 Ga0466699_275694 3300042597 Bacteria 7802
103 Ga0466699_365231 3300042597 Bacteria 1325
104 Ga0466712_236240 3300042614 Bacteria 12620
105 Ga0466704_094999 3300042643 Bacteria 61949
106 Ga0466727_187051 3300042655 Bacteria 1620
107 Ga0466727_328549 3300042655 Bacteria 1877
108 Ga0072941_1048681 3300005201 Bacteria 13067

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_097622 Ga0466723_097622_243_1106 287
2 3300042612 Ga0466705_318672 Ga0466705_318672_2472_3341 289
3 3300042655 Ga0466727_328549 Ga0466727_328549_36_917 293
4 3300042620 Ga0466728_308392 Ga0466728_308392_175_1113 294
5 3300042643 Ga0466704_616659 Ga0466704_616659_2562_3533 298
6 3300042655 Ga0466727_111734 Ga0466727_111734_243_1139 298
7 3300042621 Ga0466729_248721 Ga0466729_248721_71_970 299
8 3300002449 JGI24698J34947_10004436 JGI24698J34947_100044366 301
9 iso_pr_bacteria 2781125691 2781428884 301
10 3300042597 Ga0466699_053392 Ga0466699_053392_8979_9887 302
11 3300042597 Ga0466699_070191 Ga0466699_070191_1557_2465 302
12 3300042597 Ga0466699_149706 Ga0466699_149706_3679_4587 302
13 3300042597 Ga0466699_179599 Ga0466699_179599_2844_3752 302
14 3300042597 Ga0466699_221174 Ga0466699_221174_13_921 302
15 3300042597 Ga0466699_275694 Ga0466699_275694_3435_4343 302
16 3300042597 Ga0466699_365231 Ga0466699_365231_215_1123 302
17 3300005200 Ga0072940_1001818 Ga0072940_100181811 303
18 3300042606 Ga0466719_059146 Ga0466719_059146_1300_2211 303
19 3300002449 JGI24698J34947_10033789 JGI24698J34947_100337891 304
20 3300024493 Ga0264413_100162 Ga0264413_10016212 304
21 3300042607 Ga0466720_062745 Ga0466720_062745_858_1772 304
22 3300042614 Ga0466712_154954 Ga0466712_154954_27_941 304
23 iso_pr_bacteria 2781125655 2781318490 304
24 3300002449 JGI24698J34947_10003595 JGI24698J34947_100035953 305
25 3300002449 JGI24698J34947_10005104 JGI24698J34947_100051044 305
26 3300002449 JGI24698J34947_10017194 JGI24698J34947_100171941 305
27 3300002449 JGI24698J34947_10076249 JGI24698J34947_100762492 305
28 3300002449 JGI24698J34947_10099559 JGI24698J34947_100995592 305
29 3300002449 JGI24698J34947_10124889 JGI24698J34947_101248891 305
30 3300042597 Ga0466699_282133 Ga0466699_282133_278_1195 305
31 3300042612 Ga0466705_513769 Ga0466705_513769_255_1208 305
32 3300042597 Ga0466699_299789 Ga0466699_299789_878_1798 306
33 3300042643 Ga0466704_094999 Ga0466704_094999_35960_36880 306
34 iso_pr_bacteria 2781125651 2781309534 306
35 3300002450 JGI24695J34938_10002109 JGI24695J34938_1000210911 307
36 3300042597 Ga0466699_119861 Ga0466699_119861_2204_3127 307
37 3300042597 Ga0466699_332107 Ga0466699_332107_2849_3772 307
38 3300042614 Ga0466712_073550 Ga0466712_073550_2734_3657 307
39 iso_pr_bacteria 2781125652 2781312772 307
40 3300042590 Ga0466690_022811 Ga0466690_022811_2178_3104 308
41 3300042593 Ga0466691_181119 Ga0466691_181119_3475_4401 308
42 3300042597 Ga0466699_297663 Ga0466699_297663_442_1368 308
43 3300042607 Ga0466720_065204 Ga0466720_065204_8902_9828 308
44 3300042614 Ga0466712_000314 Ga0466712_000314_8398_9324 308
45 3300000089 AustNasuHG_c1014297 AustNasuHG_10142971 309
46 3300009784 Ga0123357_10023120 Ga0123357_100231203 309
47 3300042614 Ga0466712_136525 Ga0466712_136525_4531_5460 309
48 3300042614 Ga0466712_188058 Ga0466712_188058_2801_3730 309
49 iso_pr_bacteria 2781125640 2781287932 309
50 3300002449 JGI24698J34947_10000933 JGI24698J34947_100009339 310
51 3300042607 Ga0466720_014328 Ga0466720_014328_833_1765 310
52 3300042607 Ga0466720_120821 Ga0466720_120821_486_1418 310
53 3300042607 Ga0466720_218533 Ga0466720_218533_3703_4635 310
54 3300042609 Ga0466722_178213 Ga0466722_178213_5298_6230 310
55 3300042617 Ga0466718_056138 Ga0466718_056138_4061_4993 310
56 3300042619 Ga0466726_145874 Ga0466726_145874_762_1694 310
57 iso_pr_bacteria 2781125688 2781422973 310
58 3300010882 Ga0123354_10037862 Ga0123354_100378621 311
59 3300038395 Ga0415639_038453 Ga0415639_038453_219_1154 311
60 3300042607 Ga0466720_071326 Ga0466720_071326_7333_8268 311
61 3300042607 Ga0466720_125366 Ga0466720_125366_12235_13170 311
62 3300042614 Ga0466712_236240 Ga0466712_236240_6680_7615 311
63 3300042652 Ga0466708_045285 Ga0466708_045285_36740_37675 311
64 3300042656 Ga0466732_132877 Ga0466732_132877_9495_10430 311
65 3300042656 Ga0466732_185824 Ga0466732_185824_956_1891 311
66 3300042656 Ga0466732_270489 Ga0466732_270489_264_1199 311
67 3300002449 JGI24698J34947_10000498 JGI24698J34947_100004983 312
68 3300002449 JGI24698J34947_10000937 JGI24698J34947_100009376 312
69 3300010167 Ga0123353_11051702 Ga0123353_110517021 312
70 3300042609 Ga0466722_124518 Ga0466722_124518_1230_2168 312
71 3300042610 Ga0466698_046547 Ga0466698_046547_800_1738 312
72 3300042614 Ga0466712_262012 Ga0466712_262012_422_1360 312
73 3300042643 Ga0466704_106809 Ga0466704_106809_4167_5105 312
74 3300010167 Ga0123353_10229495 Ga0123353_102294952 313
75 3300042619 Ga0466726_195726 Ga0466726_195726_43_984 313
76 3300042619 Ga0466726_252112 Ga0466726_252112_156_1097 313
77 3300042655 Ga0466727_055689 Ga0466727_055689_2278_3219 313
78 3300042594 Ga0466694_123440 Ga0466694_123440_30077_31021 314
79 3300042594 Ga0466694_250173 Ga0466694_250173_678_1622 314
80 3300042601 Ga0466707_231127 Ga0466707_231127_872_1816 314
81 3300042607 Ga0466720_098651 Ga0466720_098651_523_1467 314
82 3300042607 Ga0466720_132912 Ga0466720_132912_136_1080 314
83 3300042609 Ga0466722_242431 Ga0466722_242431_4873_5817 314
84 3300002450 JGI24695J34938_10019902 JGI24695J34938_1001990210 315
85 3300005485 Ga0074263_115646 Ga0074263_1156461 315
86 3300042594 Ga0466694_012922 Ga0466694_012922_390_1337 315
87 3300042597 Ga0466699_211009 Ga0466699_211009_12466_13413 315
88 3300042600 Ga0466700_190304 Ga0466700_190304_97_1044 315
89 3300042609 Ga0466722_048847 Ga0466722_048847_1161_2108 315
90 3300042643 Ga0466704_072004 Ga0466704_072004_7214_8161 315
91 3300042656 Ga0466732_065017 Ga0466732_065017_9225_10172 315
92 3300041968 Ga0456237_0005952 Ga0456237_0005952_285_1235 316
93 3300042609 Ga0466722_082551 Ga0466722_082551_11166_12119 317
94 3300042610 Ga0466698_427830 Ga0466698_427830_1756_2709 317
95 3300042593 Ga0466691_168888 Ga0466691_168888_15552_16508 318
96 3300042614 Ga0466712_155462 Ga0466712_155462_6293_7249 318
97 3300042655 Ga0466727_187051 Ga0466727_187051_419_1375 318
98 3300002449 JGI24698J34947_10000601 JGI24698J34947_100006019 319
99 3300002462 JGI24702J35022_10084622 JGI24702J35022_100846222 319
100 3300042597 Ga0466699_302763 Ga0466699_302763_185_1144 319
101 3300042619 Ga0466726_236459 Ga0466726_236459_171_1136 321
102 3300042616 Ga0466715_019046 Ga0466715_019046_243_1214 323
103 3300042607 Ga0466720_234432 Ga0466720_234432_4418_5392 324
104 3300042616 Ga0466715_174394 Ga0466715_174394_6089_7063 324
105 3300000089 AustNasuHG_c1030224 AustNasuHG_10302242 325
106 3300042614 Ga0466712_036333 Ga0466712_036333_31282_32259 325
107 3300002449 JGI24698J34947_10000856 JGI24698J34947_100008562 326
108 3300002449 JGI24698J34947_10008677 JGI24698J34947_100086776 326
109 3300005201 Ga0072941_1048681 Ga0072941_10486814 326
110 3300010167 Ga0123353_10336625 Ga0123353_103366252 328
111 3300042596 Ga0466696_254933 Ga0466696_254933_601_1587 328
112 3300042605 Ga0466716_533892 Ga0466716_533892_1814_2809 331
113 3300042618 Ga0466723_018641 Ga0466723_018641_32817_33824 335
114 3300042655 Ga0466727_176897 Ga0466727_176897_50_1057 335

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01180 DHO_dh Dihydroorotate dehydrogenase 1 274 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.