Protein Family IF08545

Metagenome Isolate
118 Members
42 Samples
115 Scaffolds
210.14 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_229961|Ga0466729_229961_422_1186
Length
254 aa
Sequence
MIKIQACTIFFRQNRFFFINLLGITKKSSNFALGIINIDIWRRHRKIMEVQEYMHHLLGNEKAVLKELYRQTHLCVPTPEMISGHAQGRLLSMFSKMIRPDRILEIGTFTGYSAICLAEGLSPEGVLHTIEQNEELREMASAFFQKAGLGEKIILHTGDALDIVPTLEGCFDLVFVDAAKKRYLDYYQAVFDKVRSGGYILIDNILWYNKVADMSVKDATTEKLRAFNAFVLNDARVEKAVVQNRDGLFILRKK

📊 Sample Types

Isolate 2.5%
Metagenome 97.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.9%
Kalotermitidae 31.0%
Unclassified 9.5%
Termopsidae 7.1%
Passalidae 4.8%
Armadillidiidae 2.4%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
4 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
5 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
6 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
16 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
17 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
18 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
19 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
25 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
26 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
27 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_084896 3300042598 Bacteria 1202
2 Ga0466713_148569 3300042602 Bacteria 10310
3 Ga0123353_10089597 3300010167 Bacteria 4953
4 Ga0466691_032657 3300042593 Bacteria 10386
5 Ga0466691_120140 3300042593 Bacteria 2979
6 Ga0466696_110894 3300042596 Bacteria 4452
7 IMNBL1DRAFT_c0000093 3300000062 Bacteria 77928
8 JGI24702J35022_10002709 3300002462 Bacteria 10753
9 JGI24702J35022_10008713 3300002462 Bacteria 5727
10 JGI24702J35022_10017937 3300002462 Bacteria 3864
11 Ga0466731_298924 3300042622 Bacteria 1225
12 Ga0466725_098069 3300042654 Bacteria 2645
13 Ga0466719_110821 3300042606 Bacteria 6782
14 Ga0123353_10130004 3300010167 Bacteria 4042
15 Ga0123353_11373541 3300010167 Bacteria 911
16 Ga0123354_10136811 3300010882 Bacteria 3057
17 Ga0160433_100003 3300012846 Bacteria 588956
18 2227482153 2225789004 Bacteria 4389
19 JGI24705J35276_12232623 3300002504 Bacteria 4413
20 Ga0466702_157842 3300042635 Bacteria 2966
21 Ga0466704_341425 3300042643 Bacteria 28565
22 Ga0466708_164439 3300042652 Bacteria 15099
23 Ga0466727_150535 3300042655 Bacteria 6724
24 Ga0466728_101376 3300042620 Bacteria 11229
25 Ga0466728_302502 3300042620 Bacteria 12342
26 Ga0466717_226439 3300042604 Unclassified 1981
27 Ga0466719_003852 3300042606 Bacteria 1059
28 Ga0123353_10071841 3300010167 Bacteria 5561
29 Ga0123353_11404003 3300010167 Bacteria 897
30 Ga0123353_11799144 3300010167 Bacteria 761
31 Ga0466696_217132 3300042596 Unclassified 6944
32 2227441923 2225789004 Bacteria 5487
33 2227535719 2225789004 Bacteria 59646
34 IMNBL1DRAFT_c0009606 3300000062 Bacteria 4754
35 Ga0466735_024604 3300042624 Bacteria 1551
36 Ga0466735_180755 3300042624 Bacteria 3151
37 Ga0466703_084735 3300042636 Bacteria 6570
38 Ga0466703_337432 3300042636 Bacteria 3145
39 Ga0466709_148427 3300042648 Bacteria 52590
40 Ga0466708_018881 3300042652 Bacteria 10687
41 Ga0466708_433246 3300042652 Bacteria 18152
42 Ga0466726_163749 3300042619 Bacteria 3567
43 Ga0466697_058798 3300042611 Bacteria 2145
44 Ga0466705_161989 3300042612 Bacteria 14116
45 Ga0466733_054452 3300042659 Bacteria 5519
46 Ga0123356_10104036 3300010049 Bacteria 2728
47 Ga0123353_10052613 3300010167 Unclassified 6504
48 Ga0123353_10888140 3300010167 Bacteria 1215
49 Ga0123354_10200970 3300010882 Unclassified 2191
50 Ga0466690_269685 3300042590 Bacteria 7441
51 Ga0466690_419055 3300042590 Bacteria 2805
52 Ga0466696_106869 3300042596 Bacteria 6337
53 Ga0466696_395311 3300042596 Bacteria 10238
54 Ga0466704_224378 3300042643 Bacteria 27509
55 Ga0466709_182411 3300042648 Bacteria 7949
56 Ga0466715_251968 3300042616 Bacteria 19641
57 Ga0466701_065918 3300042598 Bacteria 1126
58 Ga0123356_10585372 3300010049 Unclassified 1280
59 Ga0123353_10043201 3300010167 Bacteria 7139
60 Ga0123353_10386954 3300010167 Bacteria 2089
61 Ga0123354_10028980 3300010882 Bacteria 8715
62 Ga0466690_133594 3300042590 Bacteria 8272
63 Ga0466690_286561 3300042590 Bacteria 9372
64 Ga0466693_095086 3300042592 Bacteria 1599
65 Ga0466696_163586 3300042596 Bacteria 20546
66 Ga0466729_229961 3300042621 Bacteria 1299
67 Ga0466703_015039 3300042636 Bacteria 1663
68 Ga0466725_007590 3300042654 Bacteria 1155
69 Ga0466727_112574 3300042655 Bacteria 2299
70 Ga0466723_221958 3300042618 Bacteria 6687
71 Ga0466713_087298 3300042602 Bacteria 9208
72 Ga0466714_028186 3300042603 Bacteria 1903
73 Ga0466705_140041 3300042612 Bacteria 12807
74 Ga0466733_003487 3300042659 Bacteria 5971
75 Ga0466733_006168 3300042659 Bacteria 26705
76 Ga0466733_108422 3300042659 Bacteria 6239
77 Ga0123353_10222724 3300010167 Bacteria 2948
78 IMNBL1DRAFT_c0021379 3300000062 Bacteria 2591
79 JGI24705J35276_12221051 3300002504 Bacteria 2310
80 JGI24696J40584_12956469 3300002834 Bacteria 3123
81 Ga0466734_117858 3300042623 Bacteria 1503
82 Ga0466727_251144 3300042655 Bacteria 12873
83 Ga0466711_267284 3300042615 Bacteria 10139
84 Ga0466715_064477 3300042616 Bacteria 18975
85 Ga0466715_337260 3300042616 Bacteria 33337
86 Ga0466723_252266 3300042618 Bacteria 4364
87 Ga0466726_393821 3300042619 Bacteria 3391
88 Ga0466717_097603 3300042604 Bacteria 2419
89 Ga0466719_135640 3300042606 Bacteria 1669
90 Ga0466719_345085 3300042606 Unclassified 2022
91 Ga0123356_10374438 3300010049 Bacteria 1555
92 Ga0123353_10039749 3300010167 Bacteria 7411
93 Ga0123353_10082923 3300010167 Bacteria 5158
94 Ga0123353_10360422 3300010167 Bacteria 2185
95 Ga0123353_10871425 3300010167 Bacteria 1231
96 Ga0123353_11481035 3300010167 Bacteria 866
97 Ga0466696_279170 3300042596 Unclassified 3888
98 IMNBL1DRAFT_c0000829 3300000062 Bacteria 24334
99 JGI24702J35022_10043304 3300002462 Bacteria 2397
100 Ga0466703_398616 3300042636 Bacteria 2749
101 Ga0466727_144023 3300042655 Bacteria 8766
102 Ga0466710_244308 3300042613 Bacteria 1102
103 Ga0466711_275755 3300042615 Bacteria 30959
104 Ga0466723_061252 3300042618 Bacteria 9557
105 Ga0466726_133685 3300042619 Bacteria 10162
106 Ga0466714_149966 3300042603 Bacteria 61855
107 Ga0123353_10014907 3300010167 Bacteria 11248
108 Ga0123353_11430500 3300010167 Bacteria 886
109 Ga0466690_144454 3300042590 Bacteria 3734
110 Ga0466699_406504 3300042597 Bacteria 1392
111 IMNBL1DRAFT_c0002181 3300000062 Bacteria 13807
112 IMNBL1DRAFT_c0076318 3300000062 Bacteria 951
113 Ga0466709_305978 3300042648 Bacteria 14201
114 Ga0466715_217399 3300042616 Bacteria 37947
115 Ga0466715_316208 3300042616 Bacteria 15437

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_224378 Ga0466704_224378_21226_21753 175
2 3300042606 Ga0466719_345085 Ga0466719_345085_1048_1590 180
3 3300042620 Ga0466728_302502 Ga0466728_302502_1145_1789 182
4 3300042655 Ga0466727_251144 Ga0466727_251144_12310_12858 182
5 3300042618 Ga0466723_221958 Ga0466723_221958_5336_5980 183
6 3300042620 Ga0466728_101376 Ga0466728_101376_7135_7779 183
7 3300042652 Ga0466708_018881 Ga0466708_018881_8885_9532 184
8 3300042652 Ga0466708_164439 Ga0466708_164439_5370_6014 185
9 3300010049 Ga0123356_10104036 Ga0123356_101040363 192
10 3300042598 Ga0466701_084896 Ga0466701_084896_513_1094 193
11 3300042616 Ga0466715_316208 Ga0466715_316208_8828_9472 195
12 3300042616 Ga0466715_064477 Ga0466715_064477_7115_7762 198
13 3300010167 Ga0123353_10888140 Ga0123353_108881402 201
14 3300042615 Ga0466711_275755 Ga0466711_275755_17137_17808 204
15 3300042636 Ga0466703_337432 Ga0466703_337432_1818_2462 205
16 3300000062 IMNBL1DRAFT_c0021379 IMNBL1DRAFT_00213793 206
17 3300042615 Ga0466711_267284 Ga0466711_267284_5037_5660 207
18 3300042616 Ga0466715_337260 Ga0466715_337260_21123_21746 207
19 3300042619 Ga0466726_133685 Ga0466726_133685_5218_5841 207
20 3300042624 Ga0466735_024604 Ga0466735_024604_288_911 207
21 iso_pr_bacteria 2820741847 2820744273 207
22 3300000062 IMNBL1DRAFT_c0000093 IMNBL1DRAFT_000009358 208
23 3300000062 IMNBL1DRAFT_c0009606 IMNBL1DRAFT_00096064 208
24 3300042602 Ga0466713_087298 Ga0466713_087298_7874_8500 208
25 3300042659 Ga0466733_006168 Ga0466733_006168_2294_2920 208
26 3300042659 Ga0466733_054452 Ga0466733_054452_1617_2243 208
27 3300000062 IMNBL1DRAFT_c0002181 IMNBL1DRAFT_00021814 209
28 3300042603 Ga0466714_028186 Ga0466714_028186_604_1233 209
29 3300042604 Ga0466717_097603 Ga0466717_097603_417_1046 209
30 3300042604 Ga0466717_226439 Ga0466717_226439_1019_1648 209
31 3300042611 Ga0466697_058798 Ga0466697_058798_1482_2111 209
32 3300042613 Ga0466710_244308 Ga0466710_244308_99_728 209
33 3300042623 Ga0466734_117858 Ga0466734_117858_540_1169 209
34 3300042643 Ga0466704_341425 Ga0466704_341425_9411_10040 209
35 3300042648 Ga0466709_148427 Ga0466709_148427_47397_48026 209
36 3300042659 Ga0466733_003487 Ga0466733_003487_1624_2253 209
37 3300042659 Ga0466733_108422 Ga0466733_108422_3486_4115 209
38 2225789004 2227535719 2228051792 210
39 3300002462 JGI24702J35022_10002709 JGI24702J35022_100027093 210
40 3300002504 JGI24705J35276_12221051 JGI24705J35276_122210512 210
41 3300002504 JGI24705J35276_12232623 JGI24705J35276_122326232 210
42 3300010049 Ga0123356_10374438 Ga0123356_103744381 210
43 3300010049 Ga0123356_10585372 Ga0123356_105853722 210
44 3300010167 Ga0123353_10014907 Ga0123353_1001490714 210
45 3300010167 Ga0123353_10052613 Ga0123353_100526135 210
46 3300010167 Ga0123353_10082923 Ga0123353_100829234 210
47 3300010167 Ga0123353_10360422 Ga0123353_103604222 210
48 3300010167 Ga0123353_10386954 Ga0123353_103869542 210
49 3300010167 Ga0123353_11404003 Ga0123353_114040031 210
50 3300010167 Ga0123353_11799144 Ga0123353_117991442 210
51 3300010882 Ga0123354_10028980 Ga0123354_100289805 210
52 3300042606 Ga0466719_135640 Ga0466719_135640_124_756 210
53 3300000062 IMNBL1DRAFT_c0076318 IMNBL1DRAFT_00763182 211
54 3300010167 Ga0123353_10039749 Ga0123353_100397498 211
55 3300010167 Ga0123353_10071841 Ga0123353_100718415 211
56 3300010167 Ga0123353_10130004 Ga0123353_101300044 211
57 3300010167 Ga0123353_11373541 Ga0123353_113735411 211
58 3300010167 Ga0123353_11481035 Ga0123353_114810352 211
59 3300010882 Ga0123354_10200970 Ga0123354_102009703 211
60 3300042596 Ga0466696_106869 Ga0466696_106869_1100_1735 211
61 3300042603 Ga0466714_149966 Ga0466714_149966_33851_34486 211
62 3300042654 Ga0466725_098069 Ga0466725_098069_651_1286 211
63 3300010167 Ga0123353_10089597 Ga0123353_100895973 212
64 3300042619 Ga0466726_393821 Ga0466726_393821_247_885 212
65 3300042655 Ga0466727_144023 Ga0466727_144023_5976_6614 212
66 2225789004 2227441923 2227880415 213
67 3300010167 Ga0123353_11430500 Ga0123353_114305002 213
68 3300042596 Ga0466696_110894 Ga0466696_110894_2637_3278 213
69 3300042596 Ga0466696_279170 Ga0466696_279170_1175_1816 213
70 3300042636 Ga0466703_398616 Ga0466703_398616_129_770 213
71 3300042655 Ga0466727_112574 Ga0466727_112574_1628_2269 213
72 3300042590 Ga0466690_269685 Ga0466690_269685_1463_2107 214
73 3300042593 Ga0466691_032657 Ga0466691_032657_375_1019 214
74 3300042593 Ga0466691_120140 Ga0466691_120140_642_1286 214
75 3300042606 Ga0466719_003852 Ga0466719_003852_22_666 214
76 3300042616 Ga0466715_217399 Ga0466715_217399_18998_19642 214
77 3300042618 Ga0466723_061252 Ga0466723_061252_7823_8467 214
78 3300042618 Ga0466723_252266 Ga0466723_252266_3332_3976 214
79 3300042648 Ga0466709_182411 Ga0466709_182411_1466_2110 214
80 3300042652 Ga0466708_433246 Ga0466708_433246_9099_9743 214
81 2225789004 2227482153 2227943801 215
82 3300010167 Ga0123353_10871425 Ga0123353_108714252 215
83 3300042590 Ga0466690_133594 Ga0466690_133594_2106_2753 215
84 3300042596 Ga0466696_217132 Ga0466696_217132_992_1639 215
85 3300042606 Ga0466719_110821 Ga0466719_110821_2273_2920 215
86 3300042612 Ga0466705_161989 Ga0466705_161989_10005_10652 215
87 3300042619 Ga0466726_163749 Ga0466726_163749_2747_3394 215
88 3300042636 Ga0466703_015039 Ga0466703_015039_130_777 215
89 3300042655 Ga0466727_150535 Ga0466727_150535_3031_3678 215
90 3300000062 IMNBL1DRAFT_c0000829 IMNBL1DRAFT_000082917 216
91 3300042590 Ga0466690_286561 Ga0466690_286561_258_908 216
92 3300042592 Ga0466693_095086 Ga0466693_095086_837_1487 216
93 3300042598 Ga0466701_065918 Ga0466701_065918_435_1085 216
94 3300042622 Ga0466731_298924 Ga0466731_298924_393_1043 216
95 3300042648 Ga0466709_305978 Ga0466709_305978_3128_3778 216
96 3300042654 Ga0466725_007590 Ga0466725_007590_493_1143 216
97 iso_pr_bacteria 2820744581 2820746810 216
98 iso_pr_bacteria 2820765201 2820765961 216
99 3300002462 JGI24702J35022_10008713 JGI24702J35022_100087133 217
100 3300002462 JGI24702J35022_10017937 JGI24702J35022_100179372 217
101 3300002462 JGI24702J35022_10043304 JGI24702J35022_100433042 217
102 3300002834 JGI24696J40584_12956469 JGI24696J40584_129564692 217
103 3300010167 Ga0123353_10222724 Ga0123353_102227242 217
104 3300010882 Ga0123354_10136811 Ga0123354_101368112 217
105 3300012846 Ga0160433_100003 Ga0160433_100003367 217
106 3300042590 Ga0466690_144454 Ga0466690_144454_238_891 217
107 3300042602 Ga0466713_148569 Ga0466713_148569_2069_2722 217
108 3300042616 Ga0466715_251968 Ga0466715_251968_9397_10050 217
109 3300010167 Ga0123353_10043201 Ga0123353_100432013 218
110 3300042596 Ga0466696_163586 Ga0466696_163586_17449_18105 218
111 3300042624 Ga0466735_180755 Ga0466735_180755_1228_1884 218
112 3300042636 Ga0466703_084735 Ga0466703_084735_141_797 218
113 3300042590 Ga0466690_419055 Ga0466690_419055_1991_2650 219
114 3300042596 Ga0466696_395311 Ga0466696_395311_190_849 219
115 3300042612 Ga0466705_140041 Ga0466705_140041_5249_5908 219
116 3300042597 Ga0466699_406504 Ga0466699_406504_602_1264 220
117 3300042635 Ga0466702_157842 Ga0466702_157842_2149_2820 223
118 3300042621 Ga0466729_229961 Ga0466729_229961_422_1186 254

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01596 Methyltransf_3 O-methyltransferase 60 254 0.96
PF13578 Methyltransf_24 Methyltransferase domain 104 205 0.95
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 68 202 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01596 GO:0008171 O-methyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.