Protein Family IF08545
Metagenome
Isolate
118
Members
42
Samples
115
Scaffolds
210.14
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_229961|Ga0466729_229961_422_1186
- Length
- 254 aa
- Sequence
- MIKIQACTIFFRQNRFFFINLLGITKKSSNFALGIINIDIWRRHRKIMEVQEYMHHLLGNEKAVLKELYRQTHLCVPTPEMISGHAQGRLLSMFSKMIRPDRILEIGTFTGYSAICLAEGLSPEGVLHTIEQNEELREMASAFFQKAGLGEKIILHTGDALDIVPTLEGCFDLVFVDAAKKRYLDYYQAVFDKVRSGGYILIDNILWYNKVADMSVKDATTEKLRAFNAFVLNDARVEKAVVQNRDGLFILRKK
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
31.0%
Unclassified
9.5%
Termopsidae
7.1%
Passalidae
4.8%
Armadillidiidae
2.4%
Rhinotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 4 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 18 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 19 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_084896 | 3300042598 | Bacteria | 1202 |
| 2 | Ga0466713_148569 | 3300042602 | Bacteria | 10310 |
| 3 | Ga0123353_10089597 | 3300010167 | Bacteria | 4953 |
| 4 | Ga0466691_032657 | 3300042593 | Bacteria | 10386 |
| 5 | Ga0466691_120140 | 3300042593 | Bacteria | 2979 |
| 6 | Ga0466696_110894 | 3300042596 | Bacteria | 4452 |
| 7 | IMNBL1DRAFT_c0000093 | 3300000062 | Bacteria | 77928 |
| 8 | JGI24702J35022_10002709 | 3300002462 | Bacteria | 10753 |
| 9 | JGI24702J35022_10008713 | 3300002462 | Bacteria | 5727 |
| 10 | JGI24702J35022_10017937 | 3300002462 | Bacteria | 3864 |
| 11 | Ga0466731_298924 | 3300042622 | Bacteria | 1225 |
| 12 | Ga0466725_098069 | 3300042654 | Bacteria | 2645 |
| 13 | Ga0466719_110821 | 3300042606 | Bacteria | 6782 |
| 14 | Ga0123353_10130004 | 3300010167 | Bacteria | 4042 |
| 15 | Ga0123353_11373541 | 3300010167 | Bacteria | 911 |
| 16 | Ga0123354_10136811 | 3300010882 | Bacteria | 3057 |
| 17 | Ga0160433_100003 | 3300012846 | Bacteria | 588956 |
| 18 | 2227482153 | 2225789004 | Bacteria | 4389 |
| 19 | JGI24705J35276_12232623 | 3300002504 | Bacteria | 4413 |
| 20 | Ga0466702_157842 | 3300042635 | Bacteria | 2966 |
| 21 | Ga0466704_341425 | 3300042643 | Bacteria | 28565 |
| 22 | Ga0466708_164439 | 3300042652 | Bacteria | 15099 |
| 23 | Ga0466727_150535 | 3300042655 | Bacteria | 6724 |
| 24 | Ga0466728_101376 | 3300042620 | Bacteria | 11229 |
| 25 | Ga0466728_302502 | 3300042620 | Bacteria | 12342 |
| 26 | Ga0466717_226439 | 3300042604 | Unclassified | 1981 |
| 27 | Ga0466719_003852 | 3300042606 | Bacteria | 1059 |
| 28 | Ga0123353_10071841 | 3300010167 | Bacteria | 5561 |
| 29 | Ga0123353_11404003 | 3300010167 | Bacteria | 897 |
| 30 | Ga0123353_11799144 | 3300010167 | Bacteria | 761 |
| 31 | Ga0466696_217132 | 3300042596 | Unclassified | 6944 |
| 32 | 2227441923 | 2225789004 | Bacteria | 5487 |
| 33 | 2227535719 | 2225789004 | Bacteria | 59646 |
| 34 | IMNBL1DRAFT_c0009606 | 3300000062 | Bacteria | 4754 |
| 35 | Ga0466735_024604 | 3300042624 | Bacteria | 1551 |
| 36 | Ga0466735_180755 | 3300042624 | Bacteria | 3151 |
| 37 | Ga0466703_084735 | 3300042636 | Bacteria | 6570 |
| 38 | Ga0466703_337432 | 3300042636 | Bacteria | 3145 |
| 39 | Ga0466709_148427 | 3300042648 | Bacteria | 52590 |
| 40 | Ga0466708_018881 | 3300042652 | Bacteria | 10687 |
| 41 | Ga0466708_433246 | 3300042652 | Bacteria | 18152 |
| 42 | Ga0466726_163749 | 3300042619 | Bacteria | 3567 |
| 43 | Ga0466697_058798 | 3300042611 | Bacteria | 2145 |
| 44 | Ga0466705_161989 | 3300042612 | Bacteria | 14116 |
| 45 | Ga0466733_054452 | 3300042659 | Bacteria | 5519 |
| 46 | Ga0123356_10104036 | 3300010049 | Bacteria | 2728 |
| 47 | Ga0123353_10052613 | 3300010167 | Unclassified | 6504 |
| 48 | Ga0123353_10888140 | 3300010167 | Bacteria | 1215 |
| 49 | Ga0123354_10200970 | 3300010882 | Unclassified | 2191 |
| 50 | Ga0466690_269685 | 3300042590 | Bacteria | 7441 |
| 51 | Ga0466690_419055 | 3300042590 | Bacteria | 2805 |
| 52 | Ga0466696_106869 | 3300042596 | Bacteria | 6337 |
| 53 | Ga0466696_395311 | 3300042596 | Bacteria | 10238 |
| 54 | Ga0466704_224378 | 3300042643 | Bacteria | 27509 |
| 55 | Ga0466709_182411 | 3300042648 | Bacteria | 7949 |
| 56 | Ga0466715_251968 | 3300042616 | Bacteria | 19641 |
| 57 | Ga0466701_065918 | 3300042598 | Bacteria | 1126 |
| 58 | Ga0123356_10585372 | 3300010049 | Unclassified | 1280 |
| 59 | Ga0123353_10043201 | 3300010167 | Bacteria | 7139 |
| 60 | Ga0123353_10386954 | 3300010167 | Bacteria | 2089 |
| 61 | Ga0123354_10028980 | 3300010882 | Bacteria | 8715 |
| 62 | Ga0466690_133594 | 3300042590 | Bacteria | 8272 |
| 63 | Ga0466690_286561 | 3300042590 | Bacteria | 9372 |
| 64 | Ga0466693_095086 | 3300042592 | Bacteria | 1599 |
| 65 | Ga0466696_163586 | 3300042596 | Bacteria | 20546 |
| 66 | Ga0466729_229961 | 3300042621 | Bacteria | 1299 |
| 67 | Ga0466703_015039 | 3300042636 | Bacteria | 1663 |
| 68 | Ga0466725_007590 | 3300042654 | Bacteria | 1155 |
| 69 | Ga0466727_112574 | 3300042655 | Bacteria | 2299 |
| 70 | Ga0466723_221958 | 3300042618 | Bacteria | 6687 |
| 71 | Ga0466713_087298 | 3300042602 | Bacteria | 9208 |
| 72 | Ga0466714_028186 | 3300042603 | Bacteria | 1903 |
| 73 | Ga0466705_140041 | 3300042612 | Bacteria | 12807 |
| 74 | Ga0466733_003487 | 3300042659 | Bacteria | 5971 |
| 75 | Ga0466733_006168 | 3300042659 | Bacteria | 26705 |
| 76 | Ga0466733_108422 | 3300042659 | Bacteria | 6239 |
| 77 | Ga0123353_10222724 | 3300010167 | Bacteria | 2948 |
| 78 | IMNBL1DRAFT_c0021379 | 3300000062 | Bacteria | 2591 |
| 79 | JGI24705J35276_12221051 | 3300002504 | Bacteria | 2310 |
| 80 | JGI24696J40584_12956469 | 3300002834 | Bacteria | 3123 |
| 81 | Ga0466734_117858 | 3300042623 | Bacteria | 1503 |
| 82 | Ga0466727_251144 | 3300042655 | Bacteria | 12873 |
| 83 | Ga0466711_267284 | 3300042615 | Bacteria | 10139 |
| 84 | Ga0466715_064477 | 3300042616 | Bacteria | 18975 |
| 85 | Ga0466715_337260 | 3300042616 | Bacteria | 33337 |
| 86 | Ga0466723_252266 | 3300042618 | Bacteria | 4364 |
| 87 | Ga0466726_393821 | 3300042619 | Bacteria | 3391 |
| 88 | Ga0466717_097603 | 3300042604 | Bacteria | 2419 |
| 89 | Ga0466719_135640 | 3300042606 | Bacteria | 1669 |
| 90 | Ga0466719_345085 | 3300042606 | Unclassified | 2022 |
| 91 | Ga0123356_10374438 | 3300010049 | Bacteria | 1555 |
| 92 | Ga0123353_10039749 | 3300010167 | Bacteria | 7411 |
| 93 | Ga0123353_10082923 | 3300010167 | Bacteria | 5158 |
| 94 | Ga0123353_10360422 | 3300010167 | Bacteria | 2185 |
| 95 | Ga0123353_10871425 | 3300010167 | Bacteria | 1231 |
| 96 | Ga0123353_11481035 | 3300010167 | Bacteria | 866 |
| 97 | Ga0466696_279170 | 3300042596 | Unclassified | 3888 |
| 98 | IMNBL1DRAFT_c0000829 | 3300000062 | Bacteria | 24334 |
| 99 | JGI24702J35022_10043304 | 3300002462 | Bacteria | 2397 |
| 100 | Ga0466703_398616 | 3300042636 | Bacteria | 2749 |
| 101 | Ga0466727_144023 | 3300042655 | Bacteria | 8766 |
| 102 | Ga0466710_244308 | 3300042613 | Bacteria | 1102 |
| 103 | Ga0466711_275755 | 3300042615 | Bacteria | 30959 |
| 104 | Ga0466723_061252 | 3300042618 | Bacteria | 9557 |
| 105 | Ga0466726_133685 | 3300042619 | Bacteria | 10162 |
| 106 | Ga0466714_149966 | 3300042603 | Bacteria | 61855 |
| 107 | Ga0123353_10014907 | 3300010167 | Bacteria | 11248 |
| 108 | Ga0123353_11430500 | 3300010167 | Bacteria | 886 |
| 109 | Ga0466690_144454 | 3300042590 | Bacteria | 3734 |
| 110 | Ga0466699_406504 | 3300042597 | Bacteria | 1392 |
| 111 | IMNBL1DRAFT_c0002181 | 3300000062 | Bacteria | 13807 |
| 112 | IMNBL1DRAFT_c0076318 | 3300000062 | Bacteria | 951 |
| 113 | Ga0466709_305978 | 3300042648 | Bacteria | 14201 |
| 114 | Ga0466715_217399 | 3300042616 | Bacteria | 37947 |
| 115 | Ga0466715_316208 | 3300042616 | Bacteria | 15437 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042643 | Ga0466704_224378 | Ga0466704_224378_21226_21753 | 175 |
| 2 | 3300042606 | Ga0466719_345085 | Ga0466719_345085_1048_1590 | 180 |
| 3 | 3300042620 | Ga0466728_302502 | Ga0466728_302502_1145_1789 | 182 |
| 4 | 3300042655 | Ga0466727_251144 | Ga0466727_251144_12310_12858 | 182 |
| 5 | 3300042618 | Ga0466723_221958 | Ga0466723_221958_5336_5980 | 183 |
| 6 | 3300042620 | Ga0466728_101376 | Ga0466728_101376_7135_7779 | 183 |
| 7 | 3300042652 | Ga0466708_018881 | Ga0466708_018881_8885_9532 | 184 |
| 8 | 3300042652 | Ga0466708_164439 | Ga0466708_164439_5370_6014 | 185 |
| 9 | 3300010049 | Ga0123356_10104036 | Ga0123356_101040363 | 192 |
| 10 | 3300042598 | Ga0466701_084896 | Ga0466701_084896_513_1094 | 193 |
| 11 | 3300042616 | Ga0466715_316208 | Ga0466715_316208_8828_9472 | 195 |
| 12 | 3300042616 | Ga0466715_064477 | Ga0466715_064477_7115_7762 | 198 |
| 13 | 3300010167 | Ga0123353_10888140 | Ga0123353_108881402 | 201 |
| 14 | 3300042615 | Ga0466711_275755 | Ga0466711_275755_17137_17808 | 204 |
| 15 | 3300042636 | Ga0466703_337432 | Ga0466703_337432_1818_2462 | 205 |
| 16 | 3300000062 | IMNBL1DRAFT_c0021379 | IMNBL1DRAFT_00213793 | 206 |
| 17 | 3300042615 | Ga0466711_267284 | Ga0466711_267284_5037_5660 | 207 |
| 18 | 3300042616 | Ga0466715_337260 | Ga0466715_337260_21123_21746 | 207 |
| 19 | 3300042619 | Ga0466726_133685 | Ga0466726_133685_5218_5841 | 207 |
| 20 | 3300042624 | Ga0466735_024604 | Ga0466735_024604_288_911 | 207 |
| 21 | iso_pr_bacteria | 2820741847 | 2820744273 | 207 |
| 22 | 3300000062 | IMNBL1DRAFT_c0000093 | IMNBL1DRAFT_000009358 | 208 |
| 23 | 3300000062 | IMNBL1DRAFT_c0009606 | IMNBL1DRAFT_00096064 | 208 |
| 24 | 3300042602 | Ga0466713_087298 | Ga0466713_087298_7874_8500 | 208 |
| 25 | 3300042659 | Ga0466733_006168 | Ga0466733_006168_2294_2920 | 208 |
| 26 | 3300042659 | Ga0466733_054452 | Ga0466733_054452_1617_2243 | 208 |
| 27 | 3300000062 | IMNBL1DRAFT_c0002181 | IMNBL1DRAFT_00021814 | 209 |
| 28 | 3300042603 | Ga0466714_028186 | Ga0466714_028186_604_1233 | 209 |
| 29 | 3300042604 | Ga0466717_097603 | Ga0466717_097603_417_1046 | 209 |
| 30 | 3300042604 | Ga0466717_226439 | Ga0466717_226439_1019_1648 | 209 |
| 31 | 3300042611 | Ga0466697_058798 | Ga0466697_058798_1482_2111 | 209 |
| 32 | 3300042613 | Ga0466710_244308 | Ga0466710_244308_99_728 | 209 |
| 33 | 3300042623 | Ga0466734_117858 | Ga0466734_117858_540_1169 | 209 |
| 34 | 3300042643 | Ga0466704_341425 | Ga0466704_341425_9411_10040 | 209 |
| 35 | 3300042648 | Ga0466709_148427 | Ga0466709_148427_47397_48026 | 209 |
| 36 | 3300042659 | Ga0466733_003487 | Ga0466733_003487_1624_2253 | 209 |
| 37 | 3300042659 | Ga0466733_108422 | Ga0466733_108422_3486_4115 | 209 |
| 38 | 2225789004 | 2227535719 | 2228051792 | 210 |
| 39 | 3300002462 | JGI24702J35022_10002709 | JGI24702J35022_100027093 | 210 |
| 40 | 3300002504 | JGI24705J35276_12221051 | JGI24705J35276_122210512 | 210 |
| 41 | 3300002504 | JGI24705J35276_12232623 | JGI24705J35276_122326232 | 210 |
| 42 | 3300010049 | Ga0123356_10374438 | Ga0123356_103744381 | 210 |
| 43 | 3300010049 | Ga0123356_10585372 | Ga0123356_105853722 | 210 |
| 44 | 3300010167 | Ga0123353_10014907 | Ga0123353_1001490714 | 210 |
| 45 | 3300010167 | Ga0123353_10052613 | Ga0123353_100526135 | 210 |
| 46 | 3300010167 | Ga0123353_10082923 | Ga0123353_100829234 | 210 |
| 47 | 3300010167 | Ga0123353_10360422 | Ga0123353_103604222 | 210 |
| 48 | 3300010167 | Ga0123353_10386954 | Ga0123353_103869542 | 210 |
| 49 | 3300010167 | Ga0123353_11404003 | Ga0123353_114040031 | 210 |
| 50 | 3300010167 | Ga0123353_11799144 | Ga0123353_117991442 | 210 |
| 51 | 3300010882 | Ga0123354_10028980 | Ga0123354_100289805 | 210 |
| 52 | 3300042606 | Ga0466719_135640 | Ga0466719_135640_124_756 | 210 |
| 53 | 3300000062 | IMNBL1DRAFT_c0076318 | IMNBL1DRAFT_00763182 | 211 |
| 54 | 3300010167 | Ga0123353_10039749 | Ga0123353_100397498 | 211 |
| 55 | 3300010167 | Ga0123353_10071841 | Ga0123353_100718415 | 211 |
| 56 | 3300010167 | Ga0123353_10130004 | Ga0123353_101300044 | 211 |
| 57 | 3300010167 | Ga0123353_11373541 | Ga0123353_113735411 | 211 |
| 58 | 3300010167 | Ga0123353_11481035 | Ga0123353_114810352 | 211 |
| 59 | 3300010882 | Ga0123354_10200970 | Ga0123354_102009703 | 211 |
| 60 | 3300042596 | Ga0466696_106869 | Ga0466696_106869_1100_1735 | 211 |
| 61 | 3300042603 | Ga0466714_149966 | Ga0466714_149966_33851_34486 | 211 |
| 62 | 3300042654 | Ga0466725_098069 | Ga0466725_098069_651_1286 | 211 |
| 63 | 3300010167 | Ga0123353_10089597 | Ga0123353_100895973 | 212 |
| 64 | 3300042619 | Ga0466726_393821 | Ga0466726_393821_247_885 | 212 |
| 65 | 3300042655 | Ga0466727_144023 | Ga0466727_144023_5976_6614 | 212 |
| 66 | 2225789004 | 2227441923 | 2227880415 | 213 |
| 67 | 3300010167 | Ga0123353_11430500 | Ga0123353_114305002 | 213 |
| 68 | 3300042596 | Ga0466696_110894 | Ga0466696_110894_2637_3278 | 213 |
| 69 | 3300042596 | Ga0466696_279170 | Ga0466696_279170_1175_1816 | 213 |
| 70 | 3300042636 | Ga0466703_398616 | Ga0466703_398616_129_770 | 213 |
| 71 | 3300042655 | Ga0466727_112574 | Ga0466727_112574_1628_2269 | 213 |
| 72 | 3300042590 | Ga0466690_269685 | Ga0466690_269685_1463_2107 | 214 |
| 73 | 3300042593 | Ga0466691_032657 | Ga0466691_032657_375_1019 | 214 |
| 74 | 3300042593 | Ga0466691_120140 | Ga0466691_120140_642_1286 | 214 |
| 75 | 3300042606 | Ga0466719_003852 | Ga0466719_003852_22_666 | 214 |
| 76 | 3300042616 | Ga0466715_217399 | Ga0466715_217399_18998_19642 | 214 |
| 77 | 3300042618 | Ga0466723_061252 | Ga0466723_061252_7823_8467 | 214 |
| 78 | 3300042618 | Ga0466723_252266 | Ga0466723_252266_3332_3976 | 214 |
| 79 | 3300042648 | Ga0466709_182411 | Ga0466709_182411_1466_2110 | 214 |
| 80 | 3300042652 | Ga0466708_433246 | Ga0466708_433246_9099_9743 | 214 |
| 81 | 2225789004 | 2227482153 | 2227943801 | 215 |
| 82 | 3300010167 | Ga0123353_10871425 | Ga0123353_108714252 | 215 |
| 83 | 3300042590 | Ga0466690_133594 | Ga0466690_133594_2106_2753 | 215 |
| 84 | 3300042596 | Ga0466696_217132 | Ga0466696_217132_992_1639 | 215 |
| 85 | 3300042606 | Ga0466719_110821 | Ga0466719_110821_2273_2920 | 215 |
| 86 | 3300042612 | Ga0466705_161989 | Ga0466705_161989_10005_10652 | 215 |
| 87 | 3300042619 | Ga0466726_163749 | Ga0466726_163749_2747_3394 | 215 |
| 88 | 3300042636 | Ga0466703_015039 | Ga0466703_015039_130_777 | 215 |
| 89 | 3300042655 | Ga0466727_150535 | Ga0466727_150535_3031_3678 | 215 |
| 90 | 3300000062 | IMNBL1DRAFT_c0000829 | IMNBL1DRAFT_000082917 | 216 |
| 91 | 3300042590 | Ga0466690_286561 | Ga0466690_286561_258_908 | 216 |
| 92 | 3300042592 | Ga0466693_095086 | Ga0466693_095086_837_1487 | 216 |
| 93 | 3300042598 | Ga0466701_065918 | Ga0466701_065918_435_1085 | 216 |
| 94 | 3300042622 | Ga0466731_298924 | Ga0466731_298924_393_1043 | 216 |
| 95 | 3300042648 | Ga0466709_305978 | Ga0466709_305978_3128_3778 | 216 |
| 96 | 3300042654 | Ga0466725_007590 | Ga0466725_007590_493_1143 | 216 |
| 97 | iso_pr_bacteria | 2820744581 | 2820746810 | 216 |
| 98 | iso_pr_bacteria | 2820765201 | 2820765961 | 216 |
| 99 | 3300002462 | JGI24702J35022_10008713 | JGI24702J35022_100087133 | 217 |
| 100 | 3300002462 | JGI24702J35022_10017937 | JGI24702J35022_100179372 | 217 |
| 101 | 3300002462 | JGI24702J35022_10043304 | JGI24702J35022_100433042 | 217 |
| 102 | 3300002834 | JGI24696J40584_12956469 | JGI24696J40584_129564692 | 217 |
| 103 | 3300010167 | Ga0123353_10222724 | Ga0123353_102227242 | 217 |
| 104 | 3300010882 | Ga0123354_10136811 | Ga0123354_101368112 | 217 |
| 105 | 3300012846 | Ga0160433_100003 | Ga0160433_100003367 | 217 |
| 106 | 3300042590 | Ga0466690_144454 | Ga0466690_144454_238_891 | 217 |
| 107 | 3300042602 | Ga0466713_148569 | Ga0466713_148569_2069_2722 | 217 |
| 108 | 3300042616 | Ga0466715_251968 | Ga0466715_251968_9397_10050 | 217 |
| 109 | 3300010167 | Ga0123353_10043201 | Ga0123353_100432013 | 218 |
| 110 | 3300042596 | Ga0466696_163586 | Ga0466696_163586_17449_18105 | 218 |
| 111 | 3300042624 | Ga0466735_180755 | Ga0466735_180755_1228_1884 | 218 |
| 112 | 3300042636 | Ga0466703_084735 | Ga0466703_084735_141_797 | 218 |
| 113 | 3300042590 | Ga0466690_419055 | Ga0466690_419055_1991_2650 | 219 |
| 114 | 3300042596 | Ga0466696_395311 | Ga0466696_395311_190_849 | 219 |
| 115 | 3300042612 | Ga0466705_140041 | Ga0466705_140041_5249_5908 | 219 |
| 116 | 3300042597 | Ga0466699_406504 | Ga0466699_406504_602_1264 | 220 |
| 117 | 3300042635 | Ga0466702_157842 | Ga0466702_157842_2149_2820 | 223 |
| 118 | 3300042621 | Ga0466729_229961 | Ga0466729_229961_422_1186 | 254 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01596 | GO:0008171 | O-methyltransferase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.77 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.