Protein Family IF08544

Metagenome Isolate
152 Members
55 Samples
135 Scaffolds
446.98 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_220081|Ga0466729_220081_5928_7364
Length
478 aa
Sequence
VSLKNYAYICGTIHKNYTLGLNIIYLYIKIYIMKRRDFLTSTALIGASMGIAPLGLASCSSKEKAKTLTPEELGMYSFVDIAPDGKPLKAALVGCGDRGTGAATQFLKAGPNVSIIALVDIFQDRMDSCRNVLKEKYNNEVPDANCFLGFDAYKKVLEMPDIDVVLLCTPTHFRPEQFRAAVEAGKHVFMEKPCAVDPTGIRTVIAAAKIATTKGLTVITGNQRRHSKAYWEAYVQVRNGAIGDIISGSAHWDQGAWWNKKKRPEWSDMEYCIRNWFNIKWLSGDHILDQAIHNIDVVTWFMGMRPINAAGFGGRARRLTGDIFDFFSVDYYYENNRKMLTTARQIDGCEGNVSEQVYGTKGMFTTKDGVHLEDYNGNIIWKYDYENQPEKNHYDQEHIHLVESIRLDKKINQAEDLAYSTLVAIQGREAAYTGKSVSWDEIMASDLRYGPETYALGPLPDYHEGQAPVPGKDPGAPM

📊 Sample Types

Isolate 10.5%
Metagenome 89.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 27.3%
Termitidae 27.3%
Kalotermitidae 25.5%
Termopsidae 7.3%
Rhinotermitidae 5.5%
Unclassified 3.6%
Hodotermitidae 1.8%
Passalidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
15 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
16 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
26 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
27 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
28 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
40 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
44 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
45 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
46 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
49 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
50 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_089499 3300042611 Bacteria 34083
2 Ga0466705_123086 3300042612 Unclassified 1411
3 Ga0123356_10114782 3300010049 Bacteria 2608
4 Ga0123354_10106831 3300010882 Bacteria 3732
5 Ga0466657_014755 3300042582 Bacteria 7108
6 Ga0466711_295610 3300042615 Bacteria 14335
7 Ga0466715_324241 3300042616 Bacteria 9669
8 Ga0466727_176346 3300042655 Bacteria 17609
9 JGI24705J35276_12230105 3300002504 Bacteria 3544
10 Ga0123357_10000304 3300009784 Bacteria 46843
11 Ga0466707_025436 3300042601 Bacteria 2068
12 Ga0466713_149587 3300042602 Bacteria 21967
13 Ga0466716_167105 3300042605 Bacteria 9305
14 Ga0466716_241110 3300042605 Bacteria 12441
15 Ga0466716_283200 3300042605 Bacteria 4150
16 Ga0466716_541825 3300042605 Bacteria 4446
17 Ga0466722_056415 3300042609 Bacteria 9721
18 Ga0123354_10013877 3300010882 Bacteria 12526
19 Ga0123354_10051443 3300010882 Bacteria 6221
20 Ga0466692_000981 3300042591 Bacteria 14625
21 Ga0466710_141064 3300042613 Bacteria 7195
22 Ga0466711_021246 3300042615 Bacteria 12591
23 Ga0466726_039363 3300042619 Unclassified 5206
24 Ga0466728_065619 3300042620 Bacteria 98744
25 Ga0466729_300952 3300042621 Bacteria 4663
26 Ga0466704_187063 3300042643 Bacteria 10842
27 Ga0466704_497222 3300042643 Bacteria 26011
28 Ga0466709_415626 3300042648 Bacteria 10591
29 JGI24702J35022_10000192 3300002462 Bacteria 32902
30 Ga0068302_10432603 3300005071 Bacteria 2920
31 Ga0466719_428416 3300042606 Bacteria 4206
32 Ga0466722_015255 3300042609 Bacteria 47931
33 Ga0466722_255236 3300042609 Bacteria 60597
34 Ga0466697_240337 3300042611 Bacteria 2379
35 Ga0123357_10012864 3300009784 Bacteria 10812
36 Ga0123357_10080501 3300009784 Bacteria 4284
37 Ga0466694_270645 3300042594 Bacteria 4212
38 Ga0466710_178724 3300042613 Unclassified 3835
39 Ga0466711_330054 3300042615 Bacteria 3565
40 Ga0466723_196111 3300042618 Bacteria 3923
41 Ga0466728_082257 3300042620 Bacteria 106309
42 Ga0466729_211175 3300042621 Bacteria 9657
43 Ga0466729_220081 3300042621 Bacteria 7392
44 Ga0466708_231274 3300042652 Bacteria 4319
45 Ga0466727_027772 3300042655 Bacteria 2769
46 Ga0466706_012025 3300042599 Bacteria 30310
47 Ga0466707_192236 3300042601 Bacteria 7294
48 Ga0466722_107993 3300042609 Bacteria 3326
49 Ga0466722_111316 3300042609 Bacteria 9551
50 Ga0466722_157163 3300042609 Bacteria 2985
51 Ga0466733_012433 3300042659 Bacteria 6020
52 Ga0466657_194935 3300042582 Bacteria 4712
53 Ga0466691_032657 3300042593 Bacteria 10386
54 Ga0466715_171111 3300042616 Bacteria 30080
55 Ga0466723_201512 3300042618 Bacteria 8547
56 Ga0466735_161651 3300042624 Bacteria 1814
57 Ga0466703_096833 3300042636 Bacteria 9387
58 Ga0466703_117684 3300042636 Bacteria 9036
59 Ga0466703_159636 3300042636 Bacteria 4430
60 Ga0466703_356651 3300042636 Bacteria 10091
61 Ga0466704_093311 3300042643 Bacteria 21533
62 Ga0466704_131118 3300042643 Bacteria 4485
63 Ga0466727_141604 3300042655 Bacteria 15570
64 Ga0466713_143451 3300042602 Bacteria 3601
65 Ga0466719_064990 3300042606 Bacteria 5999
66 Ga0123354_10000099 3300010882 Bacteria 64622
67 Ga0466690_022508 3300042590 Bacteria 6990
68 Ga0466690_071877 3300042590 Bacteria 20164
69 Ga0466690_299302 3300042590 Bacteria 6785
70 Ga0466692_011399 3300042591 Bacteria 2125
71 Ga0466696_001915 3300042596 Bacteria 4752
72 Ga0466696_123089 3300042596 Bacteria 9345
73 Ga0466715_098533 3300042616 Bacteria 22041
74 Ga0466726_214269 3300042619 Bacteria 12075
75 Ga0466728_101376 3300042620 Bacteria 11229
76 Ga0466729_009735 3300042621 Bacteria 22167
77 Ga0466704_093764 3300042643 Bacteria 18620
78 Ga0466709_221215 3300042648 Bacteria 16956
79 Ga0466708_055652 3300042652 Bacteria 46153
80 Ga0466725_075963 3300042654 Bacteria 10999
81 Ga0466727_168576 3300042655 Bacteria 50187
82 Ga0466727_334319 3300042655 Unclassified 2815
83 Ga0466700_079445 3300042600 Bacteria 32199
84 Ga0466714_087201 3300042603 Bacteria 3275
85 Ga0466716_158904 3300042605 Bacteria 11394
86 Ga0466705_052595 3300042612 Unclassified 5291
87 Ga0466690_005599 3300042590 Bacteria 9569
88 Ga0466690_017210 3300042590 Bacteria 26050
89 Ga0466690_319326 3300042590 Bacteria 13239
90 Ga0466696_395311 3300042596 Bacteria 10238
91 Ga0466723_311502 3300042618 Bacteria 27850
92 Ga0466703_025453 3300042636 Bacteria 3126
93 Ga0466703_067070 3300042636 Bacteria 12812
94 Ga0466703_107951 3300042636 Bacteria 23826
95 Ga0466709_046697 3300042648 Bacteria 4384
96 Ga0466727_093047 3300042655 Bacteria 16544
97 Ga0466707_192130 3300042601 Bacteria 24568
98 Ga0466707_408118 3300042601 Bacteria 11640
99 Ga0466716_126384 3300042605 Bacteria 4442
100 Ga0466716_547088 3300042605 Bacteria 12747
101 Ga0466722_006350 3300042609 Bacteria 11807
102 Ga0466722_080397 3300042609 Bacteria 11708
103 Ga0466705_140041 3300042612 Bacteria 12807
104 Ga0466692_063390 3300042591 Bacteria 95171
105 Ga0466696_443700 3300042596 Bacteria 8241
106 Ga0466711_092050 3300042615 Bacteria 33984
107 Ga0466715_568567 3300042616 Bacteria 17436
108 Ga0466723_022002 3300042618 Bacteria 2614
109 Ga0466726_436398 3300042619 Bacteria 10913
110 Ga0466735_032708 3300042624 Bacteria 5895
111 Ga0466704_078169 3300042643 Bacteria 9700
112 Ga0466724_66342 3300042649 Bacteria 3404
113 Ga0466707_154400 3300042601 Bacteria 4552
114 Ga0466707_195411 3300042601 Bacteria 1391
115 Ga0466714_065230 3300042603 Bacteria 2904
116 Ga0466722_028231 3300042609 Bacteria 8437
117 Ga0466722_233569 3300042609 Bacteria 2870
118 Ga0123356_10013505 3300010049 Bacteria 7878
119 Ga0466692_045772 3300042591 Bacteria 23073
120 Ga0466691_095546 3300042593 Bacteria 10378
121 Ga0466696_180858 3300042596 Bacteria 1958
122 Ga0466711_402421 3300042615 Bacteria 13902
123 Ga0466715_212915 3300042616 Bacteria 24334
124 Ga0466728_093166 3300042620 Bacteria 80427
125 Ga0466728_399272 3300042620 Bacteria 209367
126 Ga0466703_134508 3300042636 Bacteria 9884
127 Ga0466708_302603 3300042652 Bacteria 21583
128 Ga0466727_087033 3300042655 Bacteria 10438
129 IMNBL1DRAFT_c0001855 3300000062 Bacteria 15383
130 Ga0068302_10018937 3300005071 Bacteria 4946
131 Ga0466701_048516 3300042598 Bacteria 12662
132 Ga0466707_111695 3300042601 Bacteria 37145
133 Ga0466713_084299 3300042602 Bacteria 4046
134 Ga0466714_043113 3300042603 Bacteria 38005
135 Ga0466716_509429 3300042605 Bacteria 19588

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_195411 Ga0466707_195411_178_1380 400
2 3300042636 Ga0466703_134508 Ga0466703_134508_6891_8099 402
3 3300042606 Ga0466719_064990 Ga0466719_064990_1509_2720 403
4 3300042616 Ga0466715_171111 Ga0466715_171111_28141_29352 403
5 3300042616 Ga0466715_212915 Ga0466715_212915_7156_8367 403
6 3300042618 Ga0466723_196111 Ga0466723_196111_848_2059 403
7 3300042601 Ga0466707_111695 Ga0466707_111695_25253_26467 404
8 3300042655 Ga0466727_093047 Ga0466727_093047_15234_16448 404
9 3300042615 Ga0466711_402421 Ga0466711_402421_7849_9066 405
10 3300042590 Ga0466690_022508 Ga0466690_022508_2692_3912 406
11 3300042606 Ga0466719_428416 Ga0466719_428416_2950_4170 406
12 3300042643 Ga0466704_187063 Ga0466704_187063_5996_7216 406
13 3300042612 Ga0466705_123086 Ga0466705_123086_44_1267 407
14 3300042636 Ga0466703_107951 Ga0466703_107951_19436_20659 407
15 3300042605 Ga0466716_241110 Ga0466716_241110_8384_9715 417
16 3300042605 Ga0466716_283200 Ga0466716_283200_858_2153 417
17 3300042655 Ga0466727_087033 Ga0466727_087033_1678_3042 424
18 3300010882 Ga0123354_10000099 Ga0123354_100000994 430
19 3300042601 Ga0466707_025436 Ga0466707_025436_228_1529 433
20 3300042636 Ga0466703_117684 Ga0466703_117684_6939_8240 433
21 3300042636 Ga0466703_159636 Ga0466703_159636_1490_2791 433
22 3300042605 Ga0466716_126384 Ga0466716_126384_1560_2939 434
23 3300042609 Ga0466722_111316 Ga0466722_111316_735_2096 434
24 3300042655 Ga0466727_141604 Ga0466727_141604_845_2149 434
25 3300042590 Ga0466690_005599 Ga0466690_005599_4534_5877 436
26 3300042616 Ga0466715_568567 Ga0466715_568567_6489_7850 439
27 3300042602 Ga0466713_143451 Ga0466713_143451_1477_2799 440
28 3300042609 Ga0466722_107993 Ga0466722_107993_24_1379 440
29 3300042609 Ga0466722_080397 Ga0466722_080397_363_1724 442
30 3300042619 Ga0466726_039363 Ga0466726_039363_3761_5119 442
31 3300042615 Ga0466711_295610 Ga0466711_295610_11740_13104 443
32 3300042616 Ga0466715_324241 Ga0466715_324241_849_2216 444
33 3300042619 Ga0466726_214269 Ga0466726_214269_2083_3438 444
34 3300042655 Ga0466727_334319 Ga0466727_334319_1105_2460 444
35 3300005071 Ga0068302_10018937 Ga0068302_100189375 445
36 3300042590 Ga0466690_299302 Ga0466690_299302_666_2039 445
37 3300042602 Ga0466713_149587 Ga0466713_149587_7726_9063 445
38 3300042615 Ga0466711_021246 Ga0466711_021246_10267_11625 445
39 3300042591 Ga0466692_011399 Ga0466692_011399_758_2098 446
40 3300042602 Ga0466713_084299 Ga0466713_084299_1191_2567 446
41 3300042609 Ga0466722_157163 Ga0466722_157163_465_1805 446
42 3300042593 Ga0466691_032657 Ga0466691_032657_5666_7045 447
43 3300042601 Ga0466707_154400 Ga0466707_154400_833_2191 447
44 3300042609 Ga0466722_006350 Ga0466722_006350_4495_5838 447
45 3300042620 Ga0466728_093166 Ga0466728_093166_54308_55651 447
46 3300042591 Ga0466692_000981 Ga0466692_000981_5034_6383 449
47 3300042596 Ga0466696_123089 Ga0466696_123089_6394_7758 449
48 3300042596 Ga0466696_180858 Ga0466696_180858_409_1758 449
49 3300042648 Ga0466709_046697 Ga0466709_046697_778_2160 449
50 3300042601 Ga0466707_408118 Ga0466707_408118_8439_9791 450
51 3300042619 Ga0466726_436398 Ga0466726_436398_725_2077 450
52 3300042643 Ga0466704_093311 Ga0466704_093311_468_1820 450
53 3300042654 Ga0466725_075963 Ga0466725_075963_3552_4904 450
54 3300005071 Ga0068302_10432603 Ga0068302_104326032 451
55 3300010049 Ga0123356_10013505 Ga0123356_100135056 451
56 3300042596 Ga0466696_395311 Ga0466696_395311_5022_6398 451
57 3300042601 Ga0466707_192130 Ga0466707_192130_22921_24276 451
58 3300042601 Ga0466707_192236 Ga0466707_192236_5130_6506 451
59 3300042612 Ga0466705_052595 Ga0466705_052595_2395_3750 451
60 3300042615 Ga0466711_092050 Ga0466711_092050_16796_18151 451
61 3300042620 Ga0466728_065619 Ga0466728_065619_72712_74067 451
62 3300042620 Ga0466728_082257 Ga0466728_082257_52184_53539 451
63 3300042620 Ga0466728_399272 Ga0466728_399272_139130_140485 451
64 3300042636 Ga0466703_096833 Ga0466703_096833_2564_3940 451
65 3300042643 Ga0466704_078169 Ga0466704_078169_4247_5602 451
66 3300042643 Ga0466704_131118 Ga0466704_131118_2631_3986 451
67 3300042655 Ga0466727_027772 Ga0466727_027772_424_1779 451
68 3300042655 Ga0466727_168576 Ga0466727_168576_38710_40065 451
69 3300042590 Ga0466690_319326 Ga0466690_319326_11243_12622 452
70 3300042591 Ga0466692_063390 Ga0466692_063390_13569_14927 452
71 3300042596 Ga0466696_443700 Ga0466696_443700_2573_3931 452
72 3300042598 Ga0466701_048516 Ga0466701_048516_6765_8123 452
73 3300042603 Ga0466714_087201 Ga0466714_087201_1070_2428 452
74 3300042605 Ga0466716_158904 Ga0466716_158904_7853_9211 452
75 3300042648 Ga0466709_221215 Ga0466709_221215_5868_7226 452
76 3300042590 Ga0466690_071877 Ga0466690_071877_2378_3739 453
77 3300042593 Ga0466691_095546 Ga0466691_095546_2951_4312 453
78 3300042596 Ga0466696_001915 Ga0466696_001915_3221_4582 453
79 3300042605 Ga0466716_509429 Ga0466716_509429_12639_14000 453
80 3300042605 Ga0466716_547088 Ga0466716_547088_853_2214 453
81 3300042609 Ga0466722_028231 Ga0466722_028231_6740_8101 453
82 3300042615 Ga0466711_330054 Ga0466711_330054_1854_3215 453
83 3300042620 Ga0466728_101376 Ga0466728_101376_1161_2522 453
84 3300042621 Ga0466729_211175 Ga0466729_211175_5740_7101 453
85 3300042643 Ga0466704_093764 Ga0466704_093764_10054_11415 453
86 iso_pr_bacteria 2940205530 2940209176 453
87 iso_pr_bacteria 2940212447 2940216090 453
88 iso_pr_bacteria 2940298504 2940302159 453
89 iso_pr_bacteria 2940302308 2940306007 453
90 iso_pr_bacteria 2940306115 2940309820 453
91 iso_pr_bacteria 2940309933 2940313625 453
92 iso_pr_bacteria 2940313741 2940317445 453
93 iso_pr_bacteria 2940317558 2940321273 453
94 iso_pr_bacteria 2940321370 2940325071 453
95 iso_pr_bacteria 2940325180 2940328861 453
96 iso_pr_bacteria 2940328985 2940332671 453
97 iso_pr_bacteria 2940332795 2940336496 453
98 3300000062 IMNBL1DRAFT_c0001855 IMNBL1DRAFT_00018559 454
99 3300042599 Ga0466706_012025 Ga0466706_012025_975_2339 454
100 3300042605 Ga0466716_167105 Ga0466716_167105_5723_7087 454
101 3300042609 Ga0466722_056415 Ga0466722_056415_7441_8805 454
102 3300042609 Ga0466722_111316 Ga0466722_111316_2321_3685 454
103 3300042611 Ga0466697_240337 Ga0466697_240337_463_1827 454
104 3300042621 Ga0466729_009735 Ga0466729_009735_5799_7163 454
105 3300042621 Ga0466729_300952 Ga0466729_300952_3041_4405 454
106 3300042624 Ga0466735_032708 Ga0466735_032708_3054_4418 454
107 3300042624 Ga0466735_161651 Ga0466735_161651_122_1486 454
108 3300042652 Ga0466708_055652 Ga0466708_055652_19032_20396 454
109 iso_pr_bacteria 2940209341 2940210078 454
110 3300042594 Ga0466694_270645 Ga0466694_270645_2056_3423 455
111 3300042600 Ga0466700_079445 Ga0466700_079445_29093_30460 455
112 3300042603 Ga0466714_065230 Ga0466714_065230_1415_2782 455
113 3300042612 Ga0466705_140041 Ga0466705_140041_1533_2900 455
114 3300042613 Ga0466710_141064 Ga0466710_141064_5603_6970 455
115 3300042613 Ga0466710_178724 Ga0466710_178724_2336_3703 455
116 3300042618 Ga0466723_311502 Ga0466723_311502_19864_21231 455
117 3300042643 Ga0466704_497222 Ga0466704_497222_21328_22695 455
118 iso_pr_bacteria 2940199050 2940200006 455
119 iso_pr_bacteria 2940346213 2940346685 455
120 3300009784 Ga0123357_10012864 Ga0123357_100128645 456
121 3300010049 Ga0123356_10114782 Ga0123356_101147822 456
122 3300010882 Ga0123354_10106831 Ga0123354_101068313 456
123 3300042582 Ga0466657_014755 Ga0466657_014755_5163_6533 456
124 3300042603 Ga0466714_043113 Ga0466714_043113_23170_24540 456
125 3300042636 Ga0466703_025453 Ga0466703_025453_986_2356 456
126 3300042648 Ga0466709_415626 Ga0466709_415626_7656_9026 456
127 3300042659 Ga0466733_012433 Ga0466733_012433_4603_5973 456
128 iso_pr_bacteria 2940302308 2940302673 456
129 3300002462 JGI24702J35022_10000192 JGI24702J35022_1000019212 457
130 3300009784 Ga0123357_10000304 Ga0123357_1000030434 457
131 3300010882 Ga0123354_10051443 Ga0123354_100514435 457
132 3300042605 Ga0466716_541825 Ga0466716_541825_2179_3552 457
133 3300042616 Ga0466715_098533 Ga0466715_098533_8575_9948 457
134 3300042636 Ga0466703_356651 Ga0466703_356651_3427_4800 457
135 3300002504 JGI24705J35276_12230105 JGI24705J35276_122301052 458
136 3300010882 Ga0123354_10013877 Ga0123354_100138773 458
137 3300042591 Ga0466692_045772 Ga0466692_045772_5101_6477 458
138 3300042609 Ga0466722_015255 Ga0466722_015255_25361_26737 458
139 3300042609 Ga0466722_233569 Ga0466722_233569_372_1748 458
140 3300042609 Ga0466722_255236 Ga0466722_255236_56295_57671 458
141 3300042655 Ga0466727_176346 Ga0466727_176346_15925_17301 458
142 3300042590 Ga0466690_017210 Ga0466690_017210_19171_20550 459
143 3300042649 Ga0466724_66342 Ga0466724_66342_1618_2997 459
144 3300042652 Ga0466708_302603 Ga0466708_302603_11466_12845 459
145 3300009784 Ga0123357_10080501 Ga0123357_100805014 461
146 3300042636 Ga0466703_067070 Ga0466703_067070_9147_10532 461
147 3300042652 Ga0466708_231274 Ga0466708_231274_655_2040 461
148 3300042611 Ga0466697_089499 Ga0466697_089499_16349_17743 464
149 3300042582 Ga0466657_194935 Ga0466657_194935_1153_2580 475
150 3300042618 Ga0466723_201512 Ga0466723_201512_455_1909 477
151 3300042618 Ga0466723_022002 Ga0466723_022002_889_2325 478
152 3300042621 Ga0466729_220081 Ga0466729_220081_5928_7364 478

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22725 GFO_IDH_MocA_C3 GFO/IDH/MocA C-terminal domain 236 364 0.9
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 89 209 0.87
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 236 424 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01408 GO:0000166 nucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.