Protein Family IF08532

Metagenome Isolate
120 Members
40 Samples
116 Scaffolds
367.36 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_182717|Ga0466729_182717_206_1339
Length
377 aa
Sequence
MKSFKNSQIYQLTITQVLETIREPEVLFWGILFPVLISIGLGFAFTQTAESKFHVILVETQHTELDSLLKVYAQPNQIKGKSLLTWKITDKTLGNTEFNFEHSDWKSAIIALKRGEADVIVTDSLGKAAYHFDPHNSQAQLVYMKLSALMQNPTSGDVETPNLGVSTTTANIQPLTLKGVRYIDFLVPGLISMGVMSSIMWGLSYTIIERRSQKLLRRMVATPMKKSNFLIAMMFVRTVMNIVEALILFLAMWLLFGIQIQGNIGALAVLFLAGNIAFTGIAVLVSCRTSKTEVGTGWINAVQMPMMILSGIFFSYHNFPEWSIGIIRLLPLTALTDGIRSIFNEGAGWMEIITPSIALSAFGLLCFVVGAKWFKWY

📊 Sample Types

Isolate 3.3%
Metagenome 96.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.0%
Termitidae 27.5%
Unclassified 15.0%
Termopsidae 10.0%
Rhinotermitidae 7.5%
Blattidae 2.5%
Passalidae 2.5%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
20 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
21 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_374284 3300042615 Bacteria 8076
2 Ga0466723_095121 3300042618 Bacteria 177949
3 Ga0466726_355971 3300042619 Bacteria 2761
4 Ga0466728_472553 3300042620 Bacteria 1811
5 Ga0466735_225831 3300042624 Bacteria 2432
6 Ga0466703_339301 3300042636 Bacteria 24167
7 Ga0466704_121170 3300042643 Bacteria 11346
8 Ga0466725_379192 3300042654 Bacteria 6549
9 Ga0466727_152017 3300042655 Bacteria 6086
10 Ga0466727_238405 3300042655 Bacteria 4213
11 Ga0466701_022679 3300042598 Bacteria 29742
12 Ga0466701_074447 3300042598 Bacteria 2988
13 Ga0466716_309564 3300042605 Bacteria 24840
14 Ga0466722_255236 3300042609 Bacteria 60597
15 Ga0068305_10042016 3300005083 Bacteria 3573
16 Ga0068305_10173742 3300005083 Bacteria 9267
17 Ga0123357_10152378 3300009784 Unclassified 2800
18 Ga0466711_090944 3300042615 Bacteria 9574
19 Ga0466711_256566 3300042615 Bacteria 4242
20 Ga0466715_208973 3300042616 Bacteria 4735
21 Ga0466715_455852 3300042616 Bacteria 4665
22 Ga0466726_132397 3300042619 Bacteria 2025
23 Ga0466726_160426 3300042619 Bacteria 3664
24 Ga0466703_402764 3300042636 Bacteria 9092
25 Ga0466704_494108 3300042643 Bacteria 2654
26 Ga0466709_133004 3300042648 Bacteria 188114
27 Ga0466692_190403 3300042591 Bacteria 7652
28 Ga0466692_194959 3300042591 Bacteria 3727
29 Ga0466707_303412 3300042601 Bacteria 16171
30 Ga0466713_010763 3300042602 Bacteria 24879
31 Ga0466713_021849 3300042602 Bacteria 33152
32 Ga0466713_075755 3300042602 Bacteria 6362
33 Ga0466713_134989 3300042602 Bacteria 147812
34 Ga0466719_263126 3300042606 Bacteria 10431
35 Ga0123357_10247021 3300009784 Unclassified 1919
36 Ga0466711_115683 3300042615 Bacteria 2650
37 Ga0466711_283506 3300042615 Bacteria 5158
38 Ga0466729_221665 3300042621 Bacteria 2691
39 Ga0466735_147538 3300042624 Bacteria 1167
40 Ga0466725_093239 3300042654 Bacteria 2043
41 Ga0466693_052554 3300042592 Bacteria 1327
42 Ga0466707_236564 3300042601 Bacteria 1784
43 Ga0466713_011249 3300042602 Bacteria 73032
44 Ga0466713_033492 3300042602 Bacteria 93098
45 Ga0466719_392710 3300042606 Bacteria 3731
46 Ga0466722_184321 3300042609 Bacteria 3738
47 JGI24699J35502_11134110 3300002509 Bacteria 31696
48 Ga0466715_076703 3300042616 Unclassified 3439
49 Ga0466726_287212 3300042619 Bacteria 3127
50 Ga0466735_031090 3300042624 Bacteria 2845
51 Ga0466703_146730 3300042636 Bacteria 5079
52 Ga0466703_194794 3300042636 Bacteria 11339
53 Ga0466704_360200 3300042643 Bacteria 9391
54 Ga0466708_016107 3300042652 Bacteria 19240
55 Ga0466727_031320 3300042655 Unclassified 4170
56 Ga0466690_067892 3300042590 Bacteria 24202
57 Ga0466691_016200 3300042593 Bacteria 5108
58 Ga0466700_193127 3300042600 Bacteria 4826
59 Ga0466707_313455 3300042601 Bacteria 1509
60 Ga0466713_024278 3300042602 Bacteria 4814
61 2227128020 2225789004 Bacteria 9048
62 Ga0068302_10099050 3300005071 Bacteria 4739
63 Ga0123357_10289652 3300009784 Bacteria 1675
64 Ga0123356_10072359 3300010049 Bacteria 3239
65 Ga0123356_10103558 3300010049 Bacteria 2734
66 Ga0466726_083270 3300042619 Bacteria 8732
67 Ga0466735_041751 3300042624 Bacteria 10920
68 Ga0466704_560027 3300042643 Bacteria 32253
69 Ga0466727_065742 3300042655 Bacteria 1918
70 Ga0466707_271826 3300042601 Bacteria 4095
71 Ga0466707_422975 3300042601 Bacteria 2964
72 Ga0466716_200126 3300042605 Bacteria 7938
73 2227521291 2225789004 Bacteria 3337
74 Ga0068302_10065512 3300005071 Unclassified 4486
75 Ga0466697_261516 3300042611 Bacteria 1952
76 Ga0466705_266272 3300042612 Bacteria 4872
77 Ga0123357_10047410 3300009784 Bacteria 5824
78 Ga0123354_10000231 3300010882 Bacteria 49858
79 Ga0123354_10229702 3300010882 Bacteria 1944
80 Ga0466703_432703 3300042636 Bacteria 3925
81 Ga0466708_424277 3300042652 Bacteria 5494
82 Ga0466727_029090 3300042655 Bacteria 4318
83 Ga0466727_077095 3300042655 Bacteria 8053
84 Ga0466727_097138 3300042655 Unclassified 3025
85 Ga0466727_190390 3300042655 Bacteria 7860
86 Ga0466707_285562 3300042601 Bacteria 8700
87 Ga0466716_143423 3300042605 Bacteria 3742
88 Ga0466698_485512 3300042610 Bacteria 2490
89 Ga0123357_10001254 3300009784 Bacteria 26697
90 Ga0466705_356162 3300042612 Bacteria 11092
91 Ga0123354_10212641 3300010882 Bacteria 2084
92 Ga0466726_354589 3300042619 Bacteria 2146
93 Ga0466728_378452 3300042620 Bacteria 2879
94 Ga0466729_118038 3300042621 Unclassified 3894
95 Ga0466729_182717 3300042621 Bacteria 2076
96 Ga0466729_273974 3300042621 Bacteria 6059
97 Ga0466703_292262 3300042636 Bacteria 2033
98 Ga0466704_085998 3300042643 Bacteria 25452
99 Ga0466704_558088 3300042643 Unclassified 7097
100 Ga0466724_32435 3300042649 Bacteria 1779
101 Ga0466700_040163 3300042600 Bacteria 3184
102 Ga0466707_150366 3300042601 Bacteria 4868
103 Ga0466707_306634 3300042601 Bacteria 1970
104 Ga0466707_388357 3300042601 Bacteria 2920
105 Ga0466713_048680 3300042602 Bacteria 9581
106 Ga0466716_296888 3300042605 Bacteria 12415
107 Ga0466719_378735 3300042606 Bacteria 28336
108 Ga0466722_000434 3300042609 Bacteria 3185
109 Ga0068305_10072459 3300005083 Unclassified 1801
110 Ga0068305_10083417 3300005083 Bacteria 20277
111 Ga0466715_223934 3300042616 Bacteria 10658
112 Ga0466723_038855 3300042618 Bacteria 1466
113 Ga0466728_477928 3300042620 Bacteria 2156
114 Ga0466703_102327 3300042636 Bacteria 38440
115 Ga0466690_243211 3300042590 Bacteria 30186
116 Ga0466696_185735 3300042596 Bacteria 7006

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_052554 Ga0466693_052554_361_1305 314
2 3300042618 Ga0466723_038855 Ga0466723_038855_467_1411 314
3 3300042624 Ga0466735_147538 Ga0466735_147538_13_1005 330
4 3300042602 Ga0466713_024278 Ga0466713_024278_1472_2479 335
5 3300042610 Ga0466698_485512 Ga0466698_485512_725_1822 352
6 3300042621 Ga0466729_118038 Ga0466729_118038_2612_3718 352
7 3300042612 Ga0466705_356162 Ga0466705_356162_7359_8468 360
8 3300042615 Ga0466711_256566 Ga0466711_256566_799_1881 360
9 3300042643 Ga0466704_558088 Ga0466704_558088_907_2016 360
10 3300042593 Ga0466691_016200 Ga0466691_016200_3100_4209 362
11 3300042606 Ga0466719_392710 Ga0466719_392710_1031_2158 362
12 3300005083 Ga0068305_10173742 Ga0068305_101737421 365
13 3300042591 Ga0466692_194959 Ga0466692_194959_673_1770 365
14 3300042602 Ga0466713_010763 Ga0466713_010763_11221_12318 365
15 3300042602 Ga0466713_075755 Ga0466713_075755_1453_2550 365
16 3300042619 Ga0466726_132397 Ga0466726_132397_175_1272 365
17 3300042619 Ga0466726_160426 Ga0466726_160426_484_1581 365
18 3300005083 Ga0068305_10083417 Ga0068305_1008341710 366
19 3300042602 Ga0466713_048680 Ga0466713_048680_3900_5000 366
20 3300042619 Ga0466726_287212 Ga0466726_287212_320_1420 366
21 3300042624 Ga0466735_041751 Ga0466735_041751_6103_7203 366
22 3300042643 Ga0466704_560027 Ga0466704_560027_6474_7574 366
23 3300002509 JGI24699J35502_11134110 JGI24699J35502_111341106 367
24 3300005083 Ga0068305_10042016 Ga0068305_100420162 367
25 3300042605 Ga0466716_309564 Ga0466716_309564_4017_5120 367
26 3300042618 Ga0466723_095121 Ga0466723_095121_162845_163948 367
27 3300042636 Ga0466703_339301 Ga0466703_339301_17656_18759 367
28 3300042643 Ga0466704_494108 Ga0466704_494108_306_1409 367
29 3300042652 Ga0466708_424277 Ga0466708_424277_2226_3329 367
30 3300042655 Ga0466727_031320 Ga0466727_031320_319_1422 367
31 3300042655 Ga0466727_065742 Ga0466727_065742_358_1461 367
32 3300005071 Ga0068302_10099050 Ga0068302_100990502 368
33 3300042619 Ga0466726_083270 Ga0466726_083270_3475_4581 368
34 3300042620 Ga0466728_477928 Ga0466728_477928_938_2044 368
35 3300042655 Ga0466727_238405 Ga0466727_238405_924_2030 368
36 2225789004 2227128020 2227523778 369
37 2225789004 2227521291 2228024772 369
38 3300005071 Ga0068302_10065512 Ga0068302_100655124 369
39 3300042590 Ga0466690_243211 Ga0466690_243211_15339_16448 369
40 3300042591 Ga0466692_190403 Ga0466692_190403_1216_2325 369
41 3300042596 Ga0466696_185735 Ga0466696_185735_1163_2272 369
42 3300042598 Ga0466701_022679 Ga0466701_022679_7650_8759 369
43 3300042598 Ga0466701_074447 Ga0466701_074447_73_1182 369
44 3300042600 Ga0466700_040163 Ga0466700_040163_1300_2409 369
45 3300042600 Ga0466700_193127 Ga0466700_193127_3413_4522 369
46 3300042601 Ga0466707_150366 Ga0466707_150366_1168_2277 369
47 3300042601 Ga0466707_236564 Ga0466707_236564_219_1328 369
48 3300042601 Ga0466707_303412 Ga0466707_303412_3465_4574 369
49 3300042601 Ga0466707_306634 Ga0466707_306634_93_1202 369
50 3300042601 Ga0466707_313455 Ga0466707_313455_181_1290 369
51 3300042602 Ga0466713_021849 Ga0466713_021849_25464_26573 369
52 3300042602 Ga0466713_033492 Ga0466713_033492_86510_87619 369
53 3300042602 Ga0466713_134989 Ga0466713_134989_113052_114161 369
54 3300042605 Ga0466716_296888 Ga0466716_296888_2394_3503 369
55 3300042609 Ga0466722_184321 Ga0466722_184321_2204_3313 369
56 3300042612 Ga0466705_266272 Ga0466705_266272_709_1818 369
57 3300042615 Ga0466711_283506 Ga0466711_283506_2869_3978 369
58 3300042616 Ga0466715_076703 Ga0466715_076703_1533_2642 369
59 3300042616 Ga0466715_208973 Ga0466715_208973_971_2080 369
60 3300042616 Ga0466715_455852 Ga0466715_455852_1425_2534 369
61 3300042619 Ga0466726_354589 Ga0466726_354589_672_1781 369
62 3300042620 Ga0466728_378452 Ga0466728_378452_621_1730 369
63 3300042620 Ga0466728_472553 Ga0466728_472553_262_1371 369
64 3300042621 Ga0466729_221665 Ga0466729_221665_1404_2513 369
65 3300042624 Ga0466735_031090 Ga0466735_031090_1710_2819 369
66 3300042624 Ga0466735_225831 Ga0466735_225831_1125_2234 369
67 3300042636 Ga0466703_102327 Ga0466703_102327_1482_2591 369
68 3300042636 Ga0466703_146730 Ga0466703_146730_539_1648 369
69 3300042636 Ga0466703_194794 Ga0466703_194794_4538_5647 369
70 3300042636 Ga0466703_292262 Ga0466703_292262_903_2012 369
71 3300042636 Ga0466703_402764 Ga0466703_402764_3415_4524 369
72 3300042643 Ga0466704_085998 Ga0466704_085998_6073_7182 369
73 3300042643 Ga0466704_121170 Ga0466704_121170_7900_9009 369
74 3300042643 Ga0466704_360200 Ga0466704_360200_6380_7489 369
75 3300042648 Ga0466709_133004 Ga0466709_133004_50970_52079 369
76 3300042649 Ga0466724_32435 Ga0466724_32435_218_1327 369
77 3300042652 Ga0466708_016107 Ga0466708_016107_272_1381 369
78 3300042654 Ga0466725_379192 Ga0466725_379192_1938_3047 369
79 3300042655 Ga0466727_077095 Ga0466727_077095_4842_5951 369
80 iso_pr_bacteria 2695420931 2698110622 369
81 iso_pr_bacteria 2820762746 2820764036 369
82 iso_pr_bacteria 2820778767 2820779793 369
83 iso_pr_bacteria 2910942425 2910945851 369
84 3300005083 Ga0068305_10072459 Ga0068305_100724592 370
85 3300009784 Ga0123357_10001254 Ga0123357_1000125415 370
86 3300009784 Ga0123357_10152378 Ga0123357_101523784 370
87 3300009784 Ga0123357_10247021 Ga0123357_102470212 370
88 3300009784 Ga0123357_10289652 Ga0123357_102896522 370
89 3300010049 Ga0123356_10072359 Ga0123356_100723593 370
90 3300010049 Ga0123356_10103558 Ga0123356_101035582 370
91 3300010882 Ga0123354_10000231 Ga0123354_1000023119 370
92 3300042609 Ga0466722_255236 Ga0466722_255236_47085_48197 370
93 3300042611 Ga0466697_261516 Ga0466697_261516_114_1226 370
94 3300042615 Ga0466711_090944 Ga0466711_090944_7290_8402 370
95 3300042616 Ga0466715_223934 Ga0466715_223934_2328_3440 370
96 3300042621 Ga0466729_273974 Ga0466729_273974_389_1501 370
97 3300042654 Ga0466725_093239 Ga0466725_093239_106_1218 370
98 3300042655 Ga0466727_152017 Ga0466727_152017_2200_3312 370
99 3300010882 Ga0123354_10212641 Ga0123354_102126412 371
100 3300010882 Ga0123354_10229702 Ga0123354_102297021 371
101 3300042601 Ga0466707_388357 Ga0466707_388357_1390_2505 371
102 3300042655 Ga0466727_190390 Ga0466727_190390_4093_5208 371
103 3300042590 Ga0466690_067892 Ga0466690_067892_16241_17359 372
104 3300042605 Ga0466716_143423 Ga0466716_143423_979_2097 372
105 3300042609 Ga0466722_000434 Ga0466722_000434_687_1805 372
106 3300042615 Ga0466711_374284 Ga0466711_374284_6137_7273 372
107 3300009784 Ga0123357_10047410 Ga0123357_100474105 373
108 3300042601 Ga0466707_285562 Ga0466707_285562_4095_5216 373
109 3300042601 Ga0466707_422975 Ga0466707_422975_1021_2142 373
110 3300042602 Ga0466713_011249 Ga0466713_011249_68449_69570 373
111 3300042615 Ga0466711_115683 Ga0466711_115683_360_1481 373
112 3300042605 Ga0466716_200126 Ga0466716_200126_4235_5359 374
113 3300042619 Ga0466726_355971 Ga0466726_355971_1367_2491 374
114 3300042636 Ga0466703_432703 Ga0466703_432703_1357_2481 374
115 3300042655 Ga0466727_097138 Ga0466727_097138_892_2016 374
116 3300042655 Ga0466727_029090 Ga0466727_029090_893_2023 376
117 3300042621 Ga0466729_182717 Ga0466729_182717_206_1339 377
118 3300042601 Ga0466707_271826 Ga0466707_271826_1490_2626 378
119 3300042606 Ga0466719_263126 Ga0466719_263126_2110_3249 379
120 3300042606 Ga0466719_378735 Ga0466719_378735_3627_4775 382

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01061 ABC2_membrane ABC-2 type transporter 182 343 0.86
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 26 371 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.