Protein Family IF08524

Metagenome Isolate
179 Members
62 Samples
163 Scaffolds
166.37 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_154498|Ga0466729_154498_929_1435
Length
160 aa
Sequence
MKAMVSIIMGSTSDLPIMEKAAKVFDEFEIPFEMHALSAHRTPAEVEAFAKNAQARGIEVIIAAAGMAAHLPGVIASMTPLPVIGVPINASLDVQMPPGIPVATVGINGAMNAAILAAQILAVKDTDLQVKLVEYKENLKAKIVKANAELADVKYAFKTN

πŸ“Š Sample Types

Isolate 8.9%
Metagenome 91.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 30.0%
Blattidae 26.7%
Kalotermitidae 21.7%
Termopsidae 6.7%
Rhinotermitidae 5.0%
Unclassified 5.0%
Passalidae 5.0%

🌳 Taxonomy

Archaea 0
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
14 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
15 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
25 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
26 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
42 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
43 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
44 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
51 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
52 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
58 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
59 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
60 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
61 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
62 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_050950 3300042612 Bacteria 13509
2 Ga0466707_308611 3300042601 Bacteria 7588
3 Ga0466719_475599 3300042606 Bacteria 5361
4 Ga0466722_159681 3300042609 Bacteria 66135
5 Ga0466698_387585 3300042610 Bacteria 1770
6 Ga0466690_009326 3300042590 Bacteria 10804
7 Ga0466692_067935 3300042591 Bacteria 92005
8 Ga0466691_027663 3300042593 Bacteria 17035
9 Ga0466696_346905 3300042596 Bacteria 5494
10 Ga0466711_424279 3300042615 Bacteria 19107
11 Ga0466723_025239 3300042618 Bacteria 67003
12 Ga0466726_111774 3300042619 Bacteria 6340
13 Ga0466702_132736 3300042635 Bacteria 1383
14 Ga0466703_188507 3300042636 Bacteria 1923
15 Ga0466704_104269 3300042643 Bacteria 3321
16 Ga0466727_094069 3300042655 Bacteria 10635
17 2227038711 2225789003 Bacteria 4298
18 Ga0466705_246247 3300042612 Bacteria 13962
19 Ga0466705_346414 3300042612 Bacteria 5714
20 Ga0466733_179319 3300042659 Bacteria 39888
21 Ga0466720_040942 3300042607 Bacteria 1533
22 Ga0466690_042308 3300042590 Bacteria 10596
23 Ga0466690_073807 3300042590 Bacteria 6196
24 Ga0466691_096844 3300042593 Bacteria 17647
25 Ga0466696_181340 3300042596 Bacteria 1549
26 Ga0466711_231558 3300042615 Bacteria 14810
27 Ga0466711_433577 3300042615 Bacteria 4133
28 Ga0466703_121300 3300042636 Bacteria 23338
29 Ga0466703_197310 3300042636 Bacteria 1355
30 Ga0466704_020905 3300042643 Bacteria 8748
31 Ga0466704_603857 3300042643 Bacteria 6421
32 Ga0466727_285270 3300042655 Bacteria 2333
33 2227550478 2225789004 Bacteria 2857
34 Ga0068305_10001818 3300005083 Bacteria 2635
35 Ga0068305_10041193 3300005083 Bacteria 4854
36 Ga0466705_173968 3300042612 Bacteria 9238
37 Ga0466707_065313 3300042601 Bacteria 19443
38 Ga0466713_118128 3300042602 Bacteria 7447
39 Ga0466714_017798 3300042603 Bacteria 1163
40 Ga0466714_045336 3300042603 Bacteria 1344
41 Ga0466716_177182 3300042605 Bacteria 2384
42 Ga0466719_496020 3300042606 Bacteria 7373
43 Ga0466690_130601 3300042590 Bacteria 9968
44 Ga0466691_055967 3300042593 Bacteria 15249
45 Ga0466696_039222 3300042596 Bacteria 17731
46 Ga0466696_135131 3300042596 Bacteria 1533
47 Ga0466696_281483 3300042596 Bacteria 4550
48 Ga0466699_327669 3300042597 Bacteria 1244
49 Ga0466711_220493 3300042615 Bacteria 8885
50 Ga0466715_376227 3300042616 Bacteria 52075
51 Ga0466715_538212 3300042616 Bacteria 5401
52 Ga0466723_059005 3300042618 Bacteria 62633
53 Ga0466723_251372 3300042618 Bacteria 8326
54 Ga0123357_10050576 3300009784 Bacteria 5625
55 Ga0466703_303955 3300042636 Bacteria 5955
56 Ga0466704_372245 3300042643 Bacteria 13926
57 Ga0466704_416964 3300042643 Bacteria 11529
58 Ga0466709_265168 3300042648 Bacteria 8445
59 JGI24702J35022_10002926 3300002462 Bacteria 10336
60 JGI24702J35022_10049765 3300002462 Bacteria 2232
61 Ga0068302_10202762 3300005071 Bacteria 7390
62 Ga0466697_203974 3300042611 Bacteria 1496
63 Ga0466707_368698 3300042601 Bacteria 2249
64 Ga0466713_066012 3300042602 Bacteria 3740
65 Ga0466716_065216 3300042605 Bacteria 17320
66 Ga0466716_185862 3300042605 Bacteria 10030
67 Ga0466722_160383 3300042609 Bacteria 27402
68 Ga0466693_068224 3300042592 Bacteria 1333
69 Ga0466696_014961 3300042596 Bacteria 77550
70 Ga0466696_177482 3300042596 Bacteria 10285
71 Ga0466711_009001 3300042615 Bacteria 22653
72 Ga0466729_154498 3300042621 Bacteria 4048
73 Ga0466729_294315 3300042621 Bacteria 2062
74 Ga0466729_299014 3300042621 Unclassified 1157
75 Ga0466735_091666 3300042624 Bacteria 4215
76 Ga0466735_203587 3300042624 Bacteria 2751
77 Ga0466735_212233 3300042624 Bacteria 1710
78 Ga0466703_192377 3300042636 Bacteria 11854
79 Ga0466704_099577 3300042643 Bacteria 9180
80 2227108597 2225789004 Bacteria 9475
81 2227303000 2225789004 Bacteria 29649
82 JGI24702J35022_10051114 3300002462 Bacteria 2203
83 JGI24699J35502_11016682 3300002509 Bacteria 1428
84 Ga0466705_111062 3300042612 Bacteria 3120
85 Ga0466733_094725 3300042659 Bacteria 1736
86 Ga0466713_140716 3300042602 Bacteria 27446
87 Ga0466722_171023 3300042609 Bacteria 1114
88 Ga0466690_018670 3300042590 Bacteria 64858
89 Ga0466690_026402 3300042590 Bacteria 15626
90 Ga0466690_252597 3300042590 Bacteria 23645
91 Ga0466696_229623 3300042596 Bacteria 13286
92 Ga0466701_013027 3300042598 Bacteria 25926
93 Ga0466711_221983 3300042615 Bacteria 1789
94 Ga0466711_242355 3300042615 Bacteria 12439
95 Ga0466711_310276 3300042615 Bacteria 7852
96 Ga0466715_130883 3300042616 Bacteria 15037
97 Ga0466715_211123 3300042616 Bacteria 56208
98 Ga0466723_176674 3300042618 Bacteria 1258
99 Ga0466729_009851 3300042621 Bacteria 13606
100 Ga0466734_156464 3300042623 Bacteria 1086
101 Ga0466735_101114 3300042624 Unclassified 1790
102 Ga0466703_001188 3300042636 Bacteria 16315
103 Ga0466704_298676 3300042643 Unclassified 9398
104 Ga0466704_347428 3300042643 Bacteria 8993
105 Ga0466704_347546 3300042643 Bacteria 9629
106 Ga0466709_376955 3300042648 Bacteria 1817
107 Ga0466727_074662 3300042655 Bacteria 12893
108 Ga0466727_091831 3300042655 Bacteria 19270
109 IMNBL1DRAFT_c0016182 3300000062 Bacteria 3205
110 JGI24702J35022_10009320 3300002462 Bacteria 5511
111 JGI24702J35022_10142218 3300002462 Bacteria 1339
112 JGI24702J35022_10198094 3300002462 Bacteria 1148
113 Ga0068302_10017471 3300005071 Bacteria 10014
114 Ga0466705_020625 3300042612 Bacteria 6839
115 Ga0466705_059065 3300042612 Bacteria 3436
116 Ga0466705_238035 3300042612 Bacteria 7385
117 Ga0466705_256313 3300042612 Bacteria 5041
118 Ga0466705_273579 3300042612 Bacteria 7149
119 Ga0466733_061651 3300042659 Bacteria 5014
120 Ga0466691_108296 3300042593 Bacteria 56200
121 Ga0466710_108162 3300042613 Bacteria 1021
122 Ga0466710_275422 3300042613 Bacteria 1748
123 Ga0466715_280463 3300042616 Bacteria 6722
124 Ga0466715_608206 3300042616 Bacteria 31747
125 Ga0466718_115831 3300042617 Unclassified 3450
126 Ga0466723_199992 3300042618 Bacteria 37648
127 Ga0466735_213730 3300042624 Bacteria 5249
128 Ga0466703_402029 3300042636 Bacteria 8278
129 Ga0466709_260373 3300042648 Bacteria 3715
130 Ga0466727_041042 3300042655 Bacteria 9323
131 Ga0072941_1332165 3300005201 Bacteria 1332
132 Ga0466707_396626 3300042601 Bacteria 7136
133 Ga0466713_029733 3300042602 Bacteria 5628
134 Ga0466693_304236 3300042592 Unclassified 1408
135 Ga0466696_256297 3300042596 Bacteria 1666
136 Ga0466696_391983 3300042596 Bacteria 3095
137 Ga0466711_156618 3300042615 Bacteria 3366
138 Ga0466715_117780 3300042616 Bacteria 16481
139 Ga0466726_049576 3300042619 Bacteria 4489
140 Ga0466729_138007 3300042621 Bacteria 2253
141 Ga0123356_10043170 3300010049 Bacteria 4198
142 Ga0466735_034971 3300042624 Bacteria 4166
143 Ga0466703_195103 3300042636 Bacteria 3170
144 Ga0466704_077861 3300042643 Bacteria 29104
145 Ga0466704_264183 3300042643 Bacteria 11866
146 JGI24702J35022_10101258 3300002462 Bacteria 1577
147 Ga0068305_10044632 3300005083 Bacteria 1875
148 Ga0466705_300863 3300042612 Bacteria 4767
149 Ga0466707_214848 3300042601 Bacteria 1585
150 Ga0466713_127493 3300042602 Bacteria 2671
151 Ga0466713_137742 3300042602 Bacteria 54116
152 Ga0466716_104532 3300042605 Bacteria 5986
153 Ga0466716_230694 3300042605 Bacteria 14957
154 Ga0466719_206285 3300042606 Bacteria 2482
155 Ga0265387_1007702 3300024582 Bacteria 1447
156 Ga0466692_183726 3300042591 Bacteria 3527
157 Ga0466728_166110 3300042620 Bacteria 6055
158 Ga0466728_278597 3300042620 Bacteria 2661
159 Ga0123354_10000501 3300010882 Bacteria 39365
160 Ga0466735_122610 3300042624 Bacteria 2171
161 Ga0466727_325777 3300042655 Bacteria 11757
162 2226988711 2225789003 Unclassified 7584
163 JGI24696J40584_12934218 3300002834 Bacteria 1535

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10002926 JGI24702J35022_100029266 155
2 3300002462 JGI24702J35022_10051114 JGI24702J35022_100511142 155
3 3300042609 Ga0466722_171023 Ga0466722_171023_507_1016 155
4 3300042643 Ga0466704_416964 Ga0466704_416964_5698_6204 155
5 3300042612 Ga0466705_246247 Ga0466705_246247_10848_11360 156
6 2225789004 2227303000 2227752904 157
7 3300002462 JGI24702J35022_10049765 JGI24702J35022_100497652 157
8 3300005201 Ga0072941_1332165 Ga0072941_13321652 158
9 3300010049 Ga0123356_10043170 Ga0123356_100431702 158
10 3300042593 Ga0466691_108296 Ga0466691_108296_23512_24021 158
11 3300042602 Ga0466713_127493 Ga0466713_127493_2107_2628 158
12 3300002462 JGI24702J35022_10198094 JGI24702J35022_101980942 159
13 3300009784 Ga0123357_10050576 Ga0123357_100505766 159
14 3300042612 Ga0466705_173968 Ga0466705_173968_7809_8315 159
15 3300042592 Ga0466693_068224 Ga0466693_068224_662_1144 160
16 3300042593 Ga0466691_055967 Ga0466691_055967_11166_11648 160
17 3300042596 Ga0466696_391983 Ga0466696_391983_1806_2288 160
18 3300042601 Ga0466707_308611 Ga0466707_308611_3810_4292 160
19 3300042601 Ga0466707_368698 Ga0466707_368698_753_1235 160
20 3300042602 Ga0466713_066012 Ga0466713_066012_925_1407 160
21 3300042602 Ga0466713_140716 Ga0466713_140716_11949_12431 160
22 3300042612 Ga0466705_059065 Ga0466705_059065_948_1430 160
23 3300042612 Ga0466705_111062 Ga0466705_111062_1565_2047 160
24 3300042612 Ga0466705_256313 Ga0466705_256313_1902_2384 160
25 3300042615 Ga0466711_242355 Ga0466711_242355_1492_1974 160
26 3300042615 Ga0466711_310276 Ga0466711_310276_3196_3678 160
27 3300042615 Ga0466711_433577 Ga0466711_433577_339_821 160
28 3300042617 Ga0466718_115831 Ga0466718_115831_924_1406 160
29 3300042618 Ga0466723_251372 Ga0466723_251372_4250_4732 160
30 3300042621 Ga0466729_154498 Ga0466729_154498_929_1435 160
31 3300042624 Ga0466735_034971 Ga0466735_034971_172_654 160
32 3300042636 Ga0466703_188507 Ga0466703_188507_660_1142 160
33 3300042636 Ga0466703_197310 Ga0466703_197310_678_1160 160
34 3300042643 Ga0466704_347428 Ga0466704_347428_3144_3626 160
35 3300042655 Ga0466727_041042 Ga0466727_041042_3798_4280 160
36 3300042655 Ga0466727_074662 Ga0466727_074662_3258_3740 160
37 3300042655 Ga0466727_325777 Ga0466727_325777_5182_5664 160
38 3300042659 Ga0466733_061651 Ga0466733_061651_2517_2999 160
39 3300042659 Ga0466733_094725 Ga0466733_094725_1014_1496 160
40 3300005071 Ga0068302_10202762 Ga0068302_102027624 161
41 3300042618 Ga0466723_199992 Ga0466723_199992_16798_17304 161
42 3300005083 Ga0068305_10044632 Ga0068305_100446322 162
43 3300042621 Ga0466729_138007 Ga0466729_138007_1330_1839 162
44 3300042624 Ga0466735_213730 Ga0466735_213730_4202_4705 167
45 3300042636 Ga0466703_303955 Ga0466703_303955_2678_3181 167
46 2225789003 2226988711 2227337671 168
47 2225789003 2227038711 2227398968 168
48 2225789004 2227108597 2227496350 168
49 2225789004 2227550478 2228079603 168
50 3300024582 Ga0265387_1007702 Ga0265387_10077022 168
51 3300042590 Ga0466690_009326 Ga0466690_009326_2754_3260 168
52 3300042590 Ga0466690_018670 Ga0466690_018670_31937_32443 168
53 3300042590 Ga0466690_026402 Ga0466690_026402_8408_8914 168
54 3300042590 Ga0466690_042308 Ga0466690_042308_2487_2993 168
55 3300042590 Ga0466690_073807 Ga0466690_073807_2309_2815 168
56 3300042590 Ga0466690_252597 Ga0466690_252597_21372_21878 168
57 3300042591 Ga0466692_067935 Ga0466692_067935_11762_12268 168
58 3300042591 Ga0466692_183726 Ga0466692_183726_681_1187 168
59 3300042593 Ga0466691_027663 Ga0466691_027663_13696_14202 168
60 3300042593 Ga0466691_096844 Ga0466691_096844_5683_6189 168
61 3300042596 Ga0466696_135131 Ga0466696_135131_480_986 168
62 3300042596 Ga0466696_177482 Ga0466696_177482_2968_3474 168
63 3300042596 Ga0466696_256297 Ga0466696_256297_144_650 168
64 3300042596 Ga0466696_281483 Ga0466696_281483_1164_1670 168
65 3300042597 Ga0466699_327669 Ga0466699_327669_79_585 168
66 3300042598 Ga0466701_013027 Ga0466701_013027_3487_3993 168
67 3300042601 Ga0466707_065313 Ga0466707_065313_4296_4802 168
68 3300042601 Ga0466707_214848 Ga0466707_214848_1062_1568 168
69 3300042601 Ga0466707_396626 Ga0466707_396626_635_1141 168
70 3300042602 Ga0466713_029733 Ga0466713_029733_4993_5499 168
71 3300042602 Ga0466713_118128 Ga0466713_118128_1899_2405 168
72 3300042602 Ga0466713_137742 Ga0466713_137742_38343_38849 168
73 3300042603 Ga0466714_017798 Ga0466714_017798_591_1097 168
74 3300042603 Ga0466714_045336 Ga0466714_045336_106_612 168
75 3300042605 Ga0466716_065216 Ga0466716_065216_13559_14065 168
76 3300042605 Ga0466716_104532 Ga0466716_104532_1567_2073 168
77 3300042605 Ga0466716_177182 Ga0466716_177182_1113_1619 168
78 3300042605 Ga0466716_230694 Ga0466716_230694_11736_12242 168
79 3300042606 Ga0466719_475599 Ga0466719_475599_3314_3820 168
80 3300042606 Ga0466719_496020 Ga0466719_496020_6664_7170 168
81 3300042607 Ga0466720_040942 Ga0466720_040942_121_627 168
82 3300042609 Ga0466722_160383 Ga0466722_160383_22964_23470 168
83 3300042610 Ga0466698_387585 Ga0466698_387585_800_1306 168
84 3300042611 Ga0466697_203974 Ga0466697_203974_856_1362 168
85 3300042612 Ga0466705_020625 Ga0466705_020625_4893_5399 168
86 3300042612 Ga0466705_050950 Ga0466705_050950_3189_3695 168
87 3300042612 Ga0466705_238035 Ga0466705_238035_4990_5496 168
88 3300042612 Ga0466705_300863 Ga0466705_300863_605_1111 168
89 3300042612 Ga0466705_346414 Ga0466705_346414_3445_3951 168
90 3300042613 Ga0466710_108162 Ga0466710_108162_51_557 168
91 3300042613 Ga0466710_275422 Ga0466710_275422_427_933 168
92 3300042615 Ga0466711_009001 Ga0466711_009001_4269_4775 168
93 3300042615 Ga0466711_156618 Ga0466711_156618_1293_1799 168
94 3300042615 Ga0466711_220493 Ga0466711_220493_6960_7466 168
95 3300042615 Ga0466711_221983 Ga0466711_221983_226_732 168
96 3300042615 Ga0466711_231558 Ga0466711_231558_8418_8924 168
97 3300042615 Ga0466711_424279 Ga0466711_424279_2742_3248 168
98 3300042616 Ga0466715_117780 Ga0466715_117780_775_1281 168
99 3300042616 Ga0466715_130883 Ga0466715_130883_4958_5464 168
100 3300042616 Ga0466715_211123 Ga0466715_211123_16679_17185 168
101 3300042616 Ga0466715_280463 Ga0466715_280463_3215_3721 168
102 3300042616 Ga0466715_376227 Ga0466715_376227_11545_12051 168
103 3300042616 Ga0466715_538212 Ga0466715_538212_2297_2803 168
104 3300042616 Ga0466715_608206 Ga0466715_608206_17717_18223 168
105 3300042618 Ga0466723_025239 Ga0466723_025239_47507_48013 168
106 3300042618 Ga0466723_059005 Ga0466723_059005_58149_58655 168
107 3300042618 Ga0466723_176674 Ga0466723_176674_388_894 168
108 3300042619 Ga0466726_049576 Ga0466726_049576_682_1188 168
109 3300042619 Ga0466726_111774 Ga0466726_111774_2455_2961 168
110 3300042620 Ga0466728_278597 Ga0466728_278597_11_517 168
111 3300042621 Ga0466729_009851 Ga0466729_009851_4695_5201 168
112 3300042621 Ga0466729_294315 Ga0466729_294315_935_1441 168
113 3300042621 Ga0466729_299014 Ga0466729_299014_435_941 168
114 3300042623 Ga0466734_156464 Ga0466734_156464_212_718 168
115 3300042624 Ga0466735_091666 Ga0466735_091666_3279_3785 168
116 3300042624 Ga0466735_101114 Ga0466735_101114_775_1281 168
117 3300042624 Ga0466735_122610 Ga0466735_122610_1504_2010 168
118 3300042624 Ga0466735_203587 Ga0466735_203587_1790_2296 168
119 3300042624 Ga0466735_212233 Ga0466735_212233_207_713 168
120 3300042635 Ga0466702_132736 Ga0466702_132736_180_686 168
121 3300042636 Ga0466703_001188 Ga0466703_001188_2017_2523 168
122 3300042636 Ga0466703_121300 Ga0466703_121300_11298_11804 168
123 3300042636 Ga0466703_195103 Ga0466703_195103_1163_1669 168
124 3300042636 Ga0466703_402029 Ga0466703_402029_2954_3460 168
125 3300042643 Ga0466704_020905 Ga0466704_020905_2433_2939 168
126 3300042643 Ga0466704_077861 Ga0466704_077861_23149_23655 168
127 3300042643 Ga0466704_099577 Ga0466704_099577_8109_8615 168
128 3300042643 Ga0466704_104269 Ga0466704_104269_2461_2967 168
129 3300042643 Ga0466704_264183 Ga0466704_264183_9786_10292 168
130 3300042643 Ga0466704_298676 Ga0466704_298676_7383_7889 168
131 3300042643 Ga0466704_347546 Ga0466704_347546_3125_3631 168
132 3300042643 Ga0466704_372245 Ga0466704_372245_5741_6247 168
133 3300042648 Ga0466709_260373 Ga0466709_260373_2227_2733 168
134 3300042648 Ga0466709_265168 Ga0466709_265168_4439_4945 168
135 3300042648 Ga0466709_376955 Ga0466709_376955_447_953 168
136 3300042655 Ga0466727_091831 Ga0466727_091831_16547_17053 168
137 3300042655 Ga0466727_094069 Ga0466727_094069_8812_9318 168
138 3300042655 Ga0466727_285270 Ga0466727_285270_745_1251 168
139 3300042659 Ga0466733_179319 Ga0466733_179319_13367_13873 168
140 iso_pr_bacteria 2940195863 2940198579 168
141 iso_pr_bacteria 2940199050 2940202250 168
142 iso_pr_bacteria 2940202316 2940204640 168
143 iso_pr_bacteria 2940205530 2940206122 168
144 iso_pr_bacteria 2940209341 2940211882 168
145 iso_pr_bacteria 2940212447 2940213037 168
146 iso_pr_bacteria 2940298504 2940299093 168
147 iso_pr_bacteria 2940306115 2940306242 168
148 iso_pr_bacteria 2940309933 2940310124 168
149 iso_pr_bacteria 2940313741 2940313934 168
150 iso_pr_bacteria 2940317558 2940317685 168
151 iso_pr_bacteria 2940321370 2940321562 168
152 iso_pr_bacteria 2940325180 2940325706 168
153 iso_pr_bacteria 2940328985 2940329512 168
154 iso_pr_bacteria 2940332795 2940332922 168
155 iso_pr_bacteria 2940346213 2940348395 168
156 3300000062 IMNBL1DRAFT_c0016182 IMNBL1DRAFT_00161822 169
157 3300002462 JGI24702J35022_10009320 JGI24702J35022_100093201 169
158 3300002462 JGI24702J35022_10101258 JGI24702J35022_101012582 169
159 3300002462 JGI24702J35022_10142218 JGI24702J35022_101422181 169
160 3300002509 JGI24699J35502_11016682 JGI24699J35502_110166822 169
161 3300002834 JGI24696J40584_12934218 JGI24696J40584_129342182 169
162 3300005071 Ga0068302_10017471 Ga0068302_100174716 169
163 3300005083 Ga0068305_10001818 Ga0068305_100018183 169
164 3300005083 Ga0068305_10041193 Ga0068305_100411933 169
165 3300010882 Ga0123354_10000501 Ga0123354_1000050117 169
166 3300042592 Ga0466693_304236 Ga0466693_304236_773_1282 169
167 3300042596 Ga0466696_346905 Ga0466696_346905_2452_2961 169
168 3300042605 Ga0466716_185862 Ga0466716_185862_4086_4595 169
169 3300042606 Ga0466719_206285 Ga0466719_206285_43_552 169
170 3300042612 Ga0466705_273579 Ga0466705_273579_4540_5052 170
171 3300042620 Ga0466728_166110 Ga0466728_166110_2073_2585 170
172 3300042643 Ga0466704_603857 Ga0466704_603857_3570_4082 170
173 3300042609 Ga0466722_159681 Ga0466722_159681_18498_19016 172
174 3300042636 Ga0466703_192377 Ga0466703_192377_5611_6129 172
175 3300042596 Ga0466696_229623 Ga0466696_229623_2553_3077 174
176 3300042596 Ga0466696_014961 Ga0466696_014961_53820_54350 176
177 3300042596 Ga0466696_181340 Ga0466696_181340_833_1369 178
178 3300042596 Ga0466696_039222 Ga0466696_039222_7434_7979 181
179 3300042590 Ga0466690_130601 Ga0466690_130601_4456_5037 193

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00731 AIRC AIR carboxylase 5 141 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00731 GO:0006189 'de novo' IMP biosynthetic process BP

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.