Protein Family IF08503
Metagenome
Isolate
140
Members
83
Samples
95
Scaffolds
390.09
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_112099|Ga0466729_112099_16192_17367
- Length
- 383 aa
- Sequence
- MYLCEQTWRWYGPNDPVSLCDIRQAGATGVVTALHHIPNGVAWSKEEIQKRINLVESAGLRWSVVESVPVHEHIKTHTGNFLQYIENYKESIRNLGACGIKVLTYNFMPVLDWTRTDLAYTLPDGSKALRFERAAFMAFDLYILKRPAAETEYAERFDEMSEADKHLLTRNMIAGLPGSEESFTIEQFRHELERYKDIDAEKLRSNLIFFLREIAPVADEAGVRLVIHPDDPPYPILGLPRILSTENDFQALIDAVPNQSNGLCLCTGSFGVRADNDLAGMMERYGDRIDFVHLRSTQRDEEGNFYEANHLEGNVDMYGVMKALLELQQRRGCSIAMRPDHGHQMIDDLKKKTNPGYSCIGRLRGLAELRGLEMGIVKSIINE
Sample Types
Isolate
32.1%
Metagenome
67.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
37.3%
Kalotermitidae
16.9%
Termitidae
10.8%
Unclassified
9.6%
Rhinotermitidae
7.2%
Passalidae
3.6%
Termopsidae
3.6%
Hydrophilidae
2.4%
Elmidae
2.4%
Hodotermitidae
1.2%
Formicidae
1.2%
Apidae
1.2%
Armadillidiidae
1.2%
Culicidae
1.2%
Taxonomy
Archaea
0
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 3 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 4 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 5 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 6 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 16 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 17 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 18 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 19 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 20 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 21 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 22 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 23 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 26 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 31 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 32 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 33 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 34 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 45 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 46 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 47 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 50 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 54 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 55 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 56 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 57 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 58 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 64 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 65 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 68 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 69 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 70 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 71 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 72 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 73 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 74 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 75 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 76 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 77 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 78 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 79 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 80 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 81 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 82 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 83 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_019354 | 3300042612 | Bacteria | 6601 |
| 2 | Ga0466711_273705 | 3300042615 | Bacteria | 6835 |
| 3 | Ga0466715_011112 | 3300042616 | Bacteria | 16804 |
| 4 | Ga0466715_195525 | 3300042616 | Bacteria | 4268 |
| 5 | Ga0466728_311604 | 3300042620 | Bacteria | 10551 |
| 6 | Ga0466729_122540 | 3300042621 | Bacteria | 3502 |
| 7 | 2227535727 | 2225789004 | Bacteria | 57737 |
| 8 | IMNBL1DRAFT_c0001954 | 3300000062 | Bacteria | 14850 |
| 9 | Ga0466716_379845 | 3300042605 | Bacteria | 3799 |
| 10 | Ga0466703_092323 | 3300042636 | Bacteria | 10874 |
| 11 | Ga0123354_10060408 | 3300010882 | Bacteria | 5608 |
| 12 | Ga0466726_238359 | 3300042619 | Bacteria | 5831 |
| 13 | IMNBL1DRAFT_c0003068 | 3300000062 | Bacteria | 11029 |
| 14 | Ga0466707_383864 | 3300042601 | Bacteria | 6861 |
| 15 | Ga0466729_272043 | 3300042621 | Bacteria | 3232 |
| 16 | Ga0466735_118349 | 3300042624 | Bacteria | 3834 |
| 17 | Ga0466703_007602 | 3300042636 | Bacteria | 8500 |
| 18 | Ga0466704_191027 | 3300042643 | Bacteria | 94994 |
| 19 | Ga0466708_367530 | 3300042652 | Bacteria | 33206 |
| 20 | Ga0466727_081347 | 3300042655 | Bacteria | 65648 |
| 21 | Ga0466705_014678 | 3300042612 | Bacteria | 3988 |
| 22 | Ga0466705_236024 | 3300042612 | Bacteria | 10832 |
| 23 | Ga0466732_024843 | 3300042656 | Unclassified | 1348 |
| 24 | Ga0466733_051945 | 3300042659 | Bacteria | 7849 |
| 25 | Ga0466733_158305 | 3300042659 | Unclassified | 2723 |
| 26 | Ga0123354_10000013 | 3300010882 | Bacteria | 155838 |
| 27 | Ga0466711_295458 | 3300042615 | Bacteria | 2298 |
| 28 | IMNBL1DRAFT_c0001033 | 3300000062 | Bacteria | 21555 |
| 29 | Ga0068305_10029960 | 3300005083 | Bacteria | 32183 |
| 30 | Ga0466706_268510 | 3300042599 | Bacteria | 14987 |
| 31 | Ga0466713_020921 | 3300042602 | Bacteria | 109196 |
| 32 | Ga0160457_1000005 | 3300012858 | Bacteria | 622134 |
| 33 | Ga0466735_075614 | 3300042624 | Bacteria | 16269 |
| 34 | Ga0466704_115477 | 3300042643 | Bacteria | 5925 |
| 35 | Ga0466708_020567 | 3300042652 | Bacteria | 16277 |
| 36 | Ga0123354_10208585 | 3300010882 | Bacteria | 2120 |
| 37 | Ga0466712_108853 | 3300042614 | Bacteria | 2901 |
| 38 | Ga0466715_256229 | 3300042616 | Bacteria | 16623 |
| 39 | Ga0466715_592687 | 3300042616 | Bacteria | 16089 |
| 40 | Ga0466723_114888 | 3300042618 | Bacteria | 8393 |
| 41 | Ga0466706_186023 | 3300042599 | Bacteria | 49026 |
| 42 | Ga0466713_102313 | 3300042602 | Bacteria | 97036 |
| 43 | Ga0466713_131061 | 3300042602 | Bacteria | 40781 |
| 44 | Ga0466722_141672 | 3300042609 | Bacteria | 12678 |
| 45 | Ga0160460_100018 | 3300012845 | Bacteria | 384310 |
| 46 | Ga0466692_060077 | 3300042591 | Bacteria | 30360 |
| 47 | Ga0466691_029086 | 3300042593 | Bacteria | 16177 |
| 48 | Ga0466702_032531 | 3300042635 | Bacteria | 1449 |
| 49 | Ga0466708_020098 | 3300042652 | Unclassified | 3183 |
| 50 | Ga0466708_128147 | 3300042652 | Bacteria | 3445 |
| 51 | Ga0466727_239904 | 3300042655 | Bacteria | 5255 |
| 52 | Ga0466733_065312 | 3300042659 | Bacteria | 101833 |
| 53 | Ga0466711_135365 | 3300042615 | Bacteria | 14177 |
| 54 | Ga0466711_225552 | 3300042615 | Bacteria | 18887 |
| 55 | Ga0466729_112099 | 3300042621 | Bacteria | 18792 |
| 56 | Ga0466695_027528 | 3300042595 | Bacteria | 2513 |
| 57 | Ga0466709_065036 | 3300042648 | Bacteria | 14993 |
| 58 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 59 | Ga0466733_106990 | 3300042659 | Bacteria | 5723 |
| 60 | Ga0466715_468542 | 3300042616 | Bacteria | 12107 |
| 61 | Ga0466715_580374 | 3300042616 | Bacteria | 5200 |
| 62 | Ga0466715_621995 | 3300042616 | Bacteria | 20259 |
| 63 | Ga0466723_332822 | 3300042618 | Bacteria | 1359 |
| 64 | 2227671835 | 2225789004 | Bacteria | 10136 |
| 65 | IMNBL1DRAFT_c0001477 | 3300000062 | Bacteria | 17564 |
| 66 | Ga0466707_270689 | 3300042601 | Bacteria | 5663 |
| 67 | Ga0466719_567314 | 3300042606 | Bacteria | 4255 |
| 68 | Ga0466703_155535 | 3300042636 | Bacteria | 15135 |
| 69 | Ga0466704_040843 | 3300042643 | Bacteria | 12472 |
| 70 | Ga0466733_015572 | 3300042659 | Bacteria | 8017 |
| 71 | Ga0466733_021293 | 3300042659 | Bacteria | 16993 |
| 72 | Ga0466733_099852 | 3300042659 | Bacteria | 3128 |
| 73 | Ga0466705_434366 | 3300042612 | Bacteria | 8564 |
| 74 | Ga0466728_260864 | 3300042620 | Bacteria | 23871 |
| 75 | Ga0466706_252393 | 3300042599 | Bacteria | 20742 |
| 76 | Ga0466713_005635 | 3300042602 | Bacteria | 57913 |
| 77 | Ga0466690_391289 | 3300042590 | Bacteria | 25345 |
| 78 | Ga0466696_105777 | 3300042596 | Bacteria | 41166 |
| 79 | Ga0466708_074788 | 3300042652 | Bacteria | 9645 |
| 80 | Ga0466708_330615 | 3300042652 | Bacteria | 4018 |
| 81 | Ga0466727_326175 | 3300042655 | Bacteria | 3297 |
| 82 | Ga0466705_192618 | 3300042612 | Bacteria | 21414 |
| 83 | Ga0123353_10109370 | 3300010167 | Bacteria | 4453 |
| 84 | Ga0123354_10177103 | 3300010882 | Bacteria | 2452 |
| 85 | Ga0466710_412082 | 3300042613 | Bacteria | 5635 |
| 86 | Ga0466728_446704 | 3300042620 | Bacteria | 5248 |
| 87 | 2227008131 | 2225789003 | Bacteria | 28853 |
| 88 | Ga0466706_173354 | 3300042599 | Bacteria | 2238 |
| 89 | Ga0466700_221114 | 3300042600 | Bacteria | 50828 |
| 90 | Ga0466707_274399 | 3300042601 | Bacteria | 2686 |
| 91 | Ga0466691_146559 | 3300042593 | Bacteria | 21127 |
| 92 | Ga0466696_416178 | 3300042596 | Bacteria | 4286 |
| 93 | Ga0466703_211551 | 3300042636 | Bacteria | 10631 |
| 94 | Ga0466704_075969 | 3300042643 | Bacteria | 12341 |
| 95 | Ga0466704_303542 | 3300042643 | Bacteria | 5711 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042659 | Ga0466733_021293 | Ga0466733_021293_15935_16981 | 340 |
| 2 | 3300042652 | Ga0466708_020098 | Ga0466708_020098_2095_3147 | 350 |
| 3 | 3300042599 | Ga0466706_173354 | Ga0466706_173354_241_1338 | 365 |
| 4 | 3300042613 | Ga0466710_412082 | Ga0466710_412082_188_1303 | 371 |
| 5 | 3300042615 | Ga0466711_135365 | Ga0466711_135365_9654_10826 | 381 |
| 6 | 3300042635 | Ga0466702_032531 | Ga0466702_032531_93_1262 | 381 |
| 7 | 3300042602 | Ga0466713_020921 | Ga0466713_020921_81968_83143 | 382 |
| 8 | 3300042612 | Ga0466705_434366 | Ga0466705_434366_6382_7554 | 382 |
| 9 | 3300042616 | Ga0466715_592687 | Ga0466715_592687_10194_11369 | 382 |
| 10 | 3300042648 | Ga0466709_169723 | Ga0466709_169723_175471_176646 | 382 |
| 11 | 3300042659 | Ga0466733_158305 | Ga0466733_158305_26_1201 | 382 |
| 12 | 3300042621 | Ga0466729_112099 | Ga0466729_112099_16192_17367 | 383 |
| 13 | 3300042659 | Ga0466733_015572 | Ga0466733_015572_6122_7297 | 383 |
| 14 | 3300042602 | Ga0466713_102313 | Ga0466713_102313_102_1286 | 384 |
| 15 | 3300012858 | Ga0160457_1000005 | Ga0160457_1000005451 | 388 |
| 16 | 3300042601 | Ga0466707_270689 | Ga0466707_270689_4342_5508 | 388 |
| 17 | 3300042606 | Ga0466719_567314 | Ga0466719_567314_1253_2419 | 388 |
| 18 | 3300042616 | Ga0466715_468542 | Ga0466715_468542_3950_5116 | 388 |
| 19 | 3300042624 | Ga0466735_118349 | Ga0466735_118349_1731_2897 | 388 |
| 20 | 3300042616 | Ga0466715_195525 | Ga0466715_195525_1531_2700 | 389 |
| 21 | 3300042619 | Ga0466726_238359 | Ga0466726_238359_4086_5255 | 389 |
| 22 | 3300042620 | Ga0466728_311604 | Ga0466728_311604_8965_10134 | 389 |
| 23 | 3300042621 | Ga0466729_122540 | Ga0466729_122540_553_1722 | 389 |
| 24 | 3300042621 | Ga0466729_272043 | Ga0466729_272043_1806_2975 | 389 |
| 25 | 3300042655 | Ga0466727_081347 | Ga0466727_081347_58125_59294 | 389 |
| 26 | 3300042655 | Ga0466727_326175 | Ga0466727_326175_1325_2494 | 389 |
| 27 | 3300042659 | Ga0466733_065312 | Ga0466733_065312_17749_18918 | 389 |
| 28 | iso_pr_bacteria | 2609459943 | 2610744600 | 389 |
| 29 | iso_pr_bacteria | 2830041218 | 2830042699 | 389 |
| 30 | iso_pr_bacteria | 2940202316 | 2940202544 | 389 |
| 31 | 2225789003 | 2227008131 | 2227364917 | 390 |
| 32 | 2225789004 | 2227535727 | 2228052261 | 390 |
| 33 | 3300012845 | Ga0160460_100018 | Ga0160460_10001841 | 390 |
| 34 | 3300042595 | Ga0466695_027528 | Ga0466695_027528_638_1810 | 390 |
| 35 | 3300042596 | Ga0466696_416178 | Ga0466696_416178_2283_3455 | 390 |
| 36 | 3300042599 | Ga0466706_252393 | Ga0466706_252393_2106_3278 | 390 |
| 37 | 3300042599 | Ga0466706_268510 | Ga0466706_268510_6368_7540 | 390 |
| 38 | 3300042602 | Ga0466713_131061 | Ga0466713_131061_1629_2801 | 390 |
| 39 | 3300042612 | Ga0466705_014678 | Ga0466705_014678_1242_2414 | 390 |
| 40 | 3300042616 | Ga0466715_580374 | Ga0466715_580374_2544_3716 | 390 |
| 41 | 3300042618 | Ga0466723_332822 | Ga0466723_332822_115_1287 | 390 |
| 42 | 3300042624 | Ga0466735_075614 | Ga0466735_075614_9845_11017 | 390 |
| 43 | 3300042636 | Ga0466703_155535 | Ga0466703_155535_2144_3316 | 390 |
| 44 | 3300042643 | Ga0466704_040843 | Ga0466704_040843_5488_6660 | 390 |
| 45 | 3300042643 | Ga0466704_115477 | Ga0466704_115477_1526_2698 | 390 |
| 46 | 3300042652 | Ga0466708_074788 | Ga0466708_074788_7201_8373 | 390 |
| 47 | 3300042652 | Ga0466708_128147 | Ga0466708_128147_1879_3051 | 390 |
| 48 | 3300042652 | Ga0466708_367530 | Ga0466708_367530_24443_25615 | 390 |
| 49 | iso_pr_bacteria | 2695420931 | 2698111710 | 390 |
| 50 | iso_pr_bacteria | 2910930387 | 2910932794 | 390 |
| 51 | iso_pr_bacteria | 2910942425 | 2910945377 | 390 |
| 52 | iso_pr_bacteria | 2910949487 | 2910950094 | 390 |
| 53 | iso_pr_bacteria | 2922326829 | 2922329478 | 390 |
| 54 | iso_pr_bacteria | 2940205530 | 2940205809 | 390 |
| 55 | iso_pr_bacteria | 2940212447 | 2940212726 | 390 |
| 56 | iso_pr_bacteria | 2940298504 | 2940298783 | 390 |
| 57 | iso_pr_bacteria | 2940302308 | 2940302587 | 390 |
| 58 | iso_pr_bacteria | 2940306115 | 2940306716 | 390 |
| 59 | iso_pr_bacteria | 2940309933 | 2940310302 | 390 |
| 60 | iso_pr_bacteria | 2940313741 | 2940314113 | 390 |
| 61 | iso_pr_bacteria | 2940317558 | 2940317927 | 390 |
| 62 | iso_pr_bacteria | 2940321370 | 2940321970 | 390 |
| 63 | iso_pr_bacteria | 2940325180 | 2940325297 | 390 |
| 64 | iso_pr_bacteria | 2940328985 | 2940329103 | 390 |
| 65 | iso_pr_bacteria | 2940332795 | 2940333396 | 390 |
| 66 | iso_pr_bacteria | 2967483437 | 2967486816 | 390 |
| 67 | 2225789004 | 2227671835 | 2228277622 | 391 |
| 68 | 3300042590 | Ga0466690_391289 | Ga0466690_391289_15680_16855 | 391 |
| 69 | 3300042591 | Ga0466692_060077 | Ga0466692_060077_15788_16963 | 391 |
| 70 | 3300042599 | Ga0466706_186023 | Ga0466706_186023_42970_44145 | 391 |
| 71 | 3300042601 | Ga0466707_274399 | Ga0466707_274399_738_1913 | 391 |
| 72 | 3300042601 | Ga0466707_383864 | Ga0466707_383864_5544_6719 | 391 |
| 73 | 3300042605 | Ga0466716_379845 | Ga0466716_379845_726_1901 | 391 |
| 74 | 3300042616 | Ga0466715_621995 | Ga0466715_621995_18531_19706 | 391 |
| 75 | 3300042618 | Ga0466723_114888 | Ga0466723_114888_4147_5322 | 391 |
| 76 | 3300042620 | Ga0466728_260864 | Ga0466728_260864_5777_6952 | 391 |
| 77 | 3300042620 | Ga0466728_446704 | Ga0466728_446704_3664_4839 | 391 |
| 78 | 3300042636 | Ga0466703_007602 | Ga0466703_007602_5938_7113 | 391 |
| 79 | 3300042636 | Ga0466703_092323 | Ga0466703_092323_3208_4383 | 391 |
| 80 | 3300042636 | Ga0466703_211551 | Ga0466703_211551_6932_8107 | 391 |
| 81 | 3300042643 | Ga0466704_303542 | Ga0466704_303542_741_1916 | 391 |
| 82 | 3300042652 | Ga0466708_020567 | Ga0466708_020567_14626_15801 | 391 |
| 83 | 3300042655 | Ga0466727_239904 | Ga0466727_239904_275_1450 | 391 |
| 84 | 3300042656 | Ga0466732_024843 | Ga0466732_024843_14_1189 | 391 |
| 85 | 3300042659 | Ga0466733_051945 | Ga0466733_051945_6563_7738 | 391 |
| 86 | iso_pr_bacteria | 2695420314 | 2695471333 | 391 |
| 87 | iso_pr_bacteria | 2695420317 | 2695486710 | 391 |
| 88 | iso_pr_bacteria | 2873600114 | 2873603177 | 391 |
| 89 | iso_pr_bacteria | 2873610414 | 2873613560 | 391 |
| 90 | iso_pr_bacteria | 2910926975 | 2910927541 | 391 |
| 91 | iso_pr_bacteria | 2910959314 | 2910962448 | 391 |
| 92 | iso_pr_bacteria | 2940244548 | 2940247044 | 391 |
| 93 | iso_pr_bacteria | 2940248789 | 2940250938 | 391 |
| 94 | iso_pr_bacteria | 2940253009 | 2940255156 | 391 |
| 95 | iso_pr_bacteria | 2940257232 | 2940259153 | 391 |
| 96 | iso_pr_bacteria | 3004672520 | 3004673990 | 391 |
| 97 | iso_pr_bacteria | 8100157865 | 8100159577 | 391 |
| 98 | iso_pr_bacteria | 8100166142 | 8100169100 | 391 |
| 99 | 3300000062 | IMNBL1DRAFT_c0001033 | IMNBL1DRAFT_000103310 | 392 |
| 100 | 3300000062 | IMNBL1DRAFT_c0001477 | IMNBL1DRAFT_000147713 | 392 |
| 101 | 3300005083 | Ga0068305_10029960 | Ga0068305_100299609 | 392 |
| 102 | 3300010882 | Ga0123354_10060408 | Ga0123354_100604083 | 392 |
| 103 | 3300010882 | Ga0123354_10177103 | Ga0123354_101771033 | 392 |
| 104 | 3300010882 | Ga0123354_10208585 | Ga0123354_102085852 | 392 |
| 105 | 3300042593 | Ga0466691_146559 | Ga0466691_146559_4401_5579 | 392 |
| 106 | 3300042602 | Ga0466713_005635 | Ga0466713_005635_38220_39398 | 392 |
| 107 | 3300042612 | Ga0466705_192618 | Ga0466705_192618_7440_8618 | 392 |
| 108 | 3300042615 | Ga0466711_225552 | Ga0466711_225552_7584_8762 | 392 |
| 109 | 3300042616 | Ga0466715_011112 | Ga0466715_011112_1945_3123 | 392 |
| 110 | 3300042643 | Ga0466704_191027 | Ga0466704_191027_45530_46708 | 392 |
| 111 | 3300042652 | Ga0466708_330615 | Ga0466708_330615_2167_3345 | 392 |
| 112 | iso_pr_bacteria | 2923982719 | 2923983111 | 392 |
| 113 | iso_pr_bacteria | 2940195863 | 2940198147 | 392 |
| 114 | iso_pr_bacteria | 2940199050 | 2940200979 | 392 |
| 115 | iso_pr_bacteria | 2940209341 | 2940212015 | 392 |
| 116 | iso_pr_bacteria | 2940346213 | 2940347636 | 392 |
| 117 | iso_pr_bacteria | 2940371297 | 2940373293 | 392 |
| 118 | 3300000062 | IMNBL1DRAFT_c0001954 | IMNBL1DRAFT_00019546 | 393 |
| 119 | 3300042609 | Ga0466722_141672 | Ga0466722_141672_11286_12467 | 393 |
| 120 | 3300042643 | Ga0466704_075969 | Ga0466704_075969_10752_11933 | 393 |
| 121 | 3300042648 | Ga0466709_065036 | Ga0466709_065036_5506_6687 | 393 |
| 122 | 3300042659 | Ga0466733_099852 | Ga0466733_099852_709_1890 | 393 |
| 123 | 3300042659 | Ga0466733_106990 | Ga0466733_106990_752_1933 | 393 |
| 124 | iso_pr_bacteria | 3004667792 | 3004671882 | 393 |
| 125 | 3300010882 | Ga0123354_10000013 | Ga0123354_1000001327 | 394 |
| 126 | 3300042612 | Ga0466705_236024 | Ga0466705_236024_5320_6504 | 394 |
| 127 | iso_pr_bacteria | 2864878056 | 2864880427 | 394 |
| 128 | iso_pr_bacteria | 2864886855 | 2864889227 | 394 |
| 129 | 3300000062 | IMNBL1DRAFT_c0003068 | IMNBL1DRAFT_00030684 | 395 |
| 130 | 3300010167 | Ga0123353_10109370 | Ga0123353_101093702 | 395 |
| 131 | 3300042614 | Ga0466712_108853 | Ga0466712_108853_1595_2782 | 395 |
| 132 | iso_pr_bacteria | 8065497608 | 8065501267 | 396 |
| 133 | 3300042596 | Ga0466696_105777 | Ga0466696_105777_12220_13413 | 397 |
| 134 | 3300042593 | Ga0466691_029086 | Ga0466691_029086_4277_5476 | 399 |
| 135 | 3300042615 | Ga0466711_295458 | Ga0466711_295458_820_2025 | 401 |
| 136 | 3300042616 | Ga0466715_256229 | Ga0466715_256229_7052_8260 | 402 |
| 137 | iso_pr_bacteria | 2718217924 | 2719373327 | 406 |
| 138 | 3300042612 | Ga0466705_019354 | Ga0466705_019354_1613_2842 | 409 |
| 139 | 3300042615 | Ga0466711_273705 | Ga0466711_273705_2097_3326 | 409 |
| 140 | 3300042600 | Ga0466700_221114 | Ga0466700_221114_48342_49586 | 414 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.9 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.