Protein Family IF08484

Metagenome Isolate
135 Members
42 Samples
128 Scaffolds
233.04 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_018556|Ga0466729_018556_1575_2327
Length
250 aa
Sequence
MGKNKTTDWDGIVKALEKWRTSAQADEALKDNGAXXXXEPSADSGDPSVTTVAEQYHSDPWAVLASTILSLRTKDEVTLVRSQALLEKAPTAEALLALPVEEIEKLIYPVGFYHTKAQNLKKIAAIIMENYQGEVPADMDLLLAMPGVGRKTANLVLTEAFDMDGICVDVHVHRITNRLGVLRTGNRSVQSKNPEETEMILREILPKKYWKRINMLLVLYGQRVCRPISPFCSRCVMPEHCRRIGVERER

πŸ“Š Sample Types

Isolate 5.2%
Metagenome 94.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 34.1%
Termitidae 29.3%
Unclassified 19.5%
Rhinotermitidae 9.8%
Termopsidae 7.3%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 1

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
8 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
9 650716102 Treponema primitia ZAS-2 Isolate Unclassified
10 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
31 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_072943 3300042612 Bacteria 8986
2 Ga0466705_222658 3300042612 Bacteria 3390
3 Ga0466718_107280 3300042617 Bacteria 15107
4 Ga0466728_026223 3300042620 Bacteria 12962
5 Ga0456237_0001006 3300041968 Bacteria 4458
6 Ga0466690_049610 3300042590 Bacteria 4496
7 Ga0466691_109431 3300042593 Bacteria 17630
8 Ga0466696_083225 3300042596 Bacteria 10013
9 Ga0466696_166344 3300042596 Bacteria 3999
10 Ga0466696_443889 3300042596 Bacteria 2865
11 Ga0466716_170108 3300042605 Bacteria 2832
12 Ga0466719_030150 3300042606 Bacteria 3047
13 Ga0466722_251941 3300042609 Bacteria 6504
14 Ga0466731_099313 3300042622 Bacteria 10230
15 Ga0466703_124706 3300042636 Bacteria 13270
16 Ga0466703_302657 3300042636 Bacteria 56159
17 Ga0466704_006566 3300042643 Bacteria 13097
18 Ga0466704_116109 3300042643 Bacteria 1683
19 Ga0466709_169124 3300042648 Bacteria 5825
20 Ga0466708_369214 3300042652 Bacteria 1246
21 JGI24700J35501_10924911 3300002508 Bacteria 5628
22 Ga0466715_033756 3300042616 Bacteria 2007
23 Ga0466715_308927 3300042616 Bacteria 17155
24 Ga0466723_008545 3300042618 Bacteria 11827
25 Ga0466728_400389 3300042620 Bacteria 2093
26 Ga0466692_118346 3300042591 Bacteria 2544
27 Ga0466691_026553 3300042593 Bacteria 2852
28 Ga0466696_204621 3300042596 Bacteria 5248
29 Ga0466707_165919 3300042601 Bacteria 1156
30 Ga0466719_188827 3300042606 Bacteria 2461
31 Ga0466722_131298 3300042609 Bacteria 2792
32 Ga0466708_280552 3300042652 Bacteria 3762
33 Ga0466727_224870 3300042655 Bacteria 27964
34 AustNasuHG_c1031228 3300000089 Bacteria 1510
35 Ga0466715_084650 3300042616 Bacteria 17076
36 Ga0466715_337443 3300042616 Bacteria 1738
37 Ga0466723_146217 3300042618 Bacteria 2182
38 Ga0466726_072713 3300042619 Bacteria 32187
39 Ga0466728_074870 3300042620 Bacteria 1681
40 Ga0466690_175541 3300042590 Bacteria 3691
41 Ga0466691_017457 3300042593 Bacteria 5398
42 Ga0466691_031329 3300042593 Bacteria 3140
43 Ga0466691_075838 3300042593 Bacteria 3820
44 Ga0466691_130220 3300042593 Bacteria 2592
45 Ga0466695_356367 3300042595 Bacteria 3825
46 Ga0466701_081165 3300042598 Bacteria 1521
47 Ga0466716_279455 3300042605 Bacteria 1941
48 Ga0466719_038097 3300042606 Bacteria 8338
49 Ga0466719_048456 3300042606 Bacteria 2103
50 Ga0466719_404328 3300042606 Bacteria 11399
51 Ga0466735_173814 3300042624 Bacteria 1553
52 Ga0466704_103151 3300042643 Bacteria 25700
53 Ga0466704_174326 3300042643 Bacteria 4112
54 Ga0466704_189047 3300042643 Bacteria 2726
55 Ga0466704_611227 3300042643 Bacteria 9194
56 Ga0466709_042099 3300042648 Bacteria 15630
57 Ga0466708_115921 3300042652 Bacteria 45804
58 Ga0466727_164158 3300042655 Bacteria 5530
59 JGI24698J34947_10004681 3300002449 Bacteria 7467
60 Ga0072941_1038753 3300005201 Bacteria 4603
61 Ga0466711_295583 3300042615 Bacteria 5805
62 Ga0466726_124254 3300042619 Bacteria 1411
63 Ga0466690_114316 3300042590 Bacteria 8030
64 Ga0466691_026489 3300042593 Bacteria 23896
65 Ga0466696_007483 3300042596 Bacteria 8956
66 Ga0466707_244065 3300042601 Bacteria 8993
67 Ga0123355_10070502 3300009826 Bacteria 5613
68 Ga0123356_10580998 3300010049 Bacteria 1284
69 Ga0466709_322714 3300042648 Unclassified 10642
70 Ga0466727_025235 3300042655 Bacteria 1527
71 Ga0466727_346411 3300042655 Bacteria 2230
72 Ga0466705_109985 3300042612 Bacteria 5917
73 Ga0466705_526240 3300042612 Bacteria 5410
74 Ga0466712_208733 3300042614 Bacteria 3195
75 Ga0466715_059755 3300042616 Bacteria 8416
76 Ga0466715_183042 3300042616 Bacteria 13421
77 Ga0466718_010753 3300042617 Bacteria 6684
78 Ga0466723_009491 3300042618 Bacteria 8123
79 Ga0466723_313586 3300042618 Bacteria 1503
80 Ga0466723_345919 3300042618 Bacteria 8337
81 Ga0466707_199102 3300042601 Bacteria 2743
82 Ga0466716_371466 3300042605 Bacteria 1037
83 Ga0466722_151371 3300042609 Bacteria 28601
84 Ga0466704_024150 3300042643 Bacteria 16258
85 Ga0466708_161805 3300042652 Bacteria 2163
86 Ga0466705_175745 3300042612 Bacteria 27252
87 Ga0466715_141497 3300042616 Bacteria 16537
88 Ga0466692_191935 3300042591 Bacteria 1868
89 Ga0466694_385277 3300042594 Bacteria 1168
90 Ga0466719_043341 3300042606 Bacteria 16280
91 Ga0466719_379062 3300042606 Bacteria 2957
92 Ga0466722_019162 3300042609 Bacteria 2208
93 Ga0466722_031350 3300042609 Bacteria 16198
94 Ga0466704_034428 3300042643 Bacteria 1472
95 Ga0466704_612581 3300042643 Bacteria 1099
96 Ga0466709_123577 3300042648 Bacteria 4864
97 Ga0466727_078113 3300042655 Bacteria 1155
98 Ga0466715_130088 3300042616 Bacteria 6053
99 Ga0466718_107072 3300042617 Bacteria 14401
100 Ga0466723_127240 3300042618 Bacteria 8487
101 Ga0466726_030058 3300042619 Bacteria 22211
102 Ga0466726_494320 3300042619 Bacteria 2610
103 Ga0466728_292612 3300042620 Bacteria 14434
104 Ga0456237_0000054 3300041968 Bacteria 16526
105 Ga0456237_0011973 3300041968 Bacteria 1260
106 Ga0466692_007897 3300042591 Bacteria 32184
107 Ga0466691_171670 3300042593 Bacteria 41136
108 Ga0466696_138249 3300042596 Bacteria 9688
109 Ga0466719_015507 3300042606 Bacteria 4605
110 Ga0466722_076941 3300042609 Bacteria 36712
111 Ga0123356_10132059 3300010049 Bacteria 2448
112 Ga0466704_407979 3300042643 Bacteria 1488
113 Ga0466708_135722 3300042652 Bacteria 19458
114 Ga0466708_321500 3300042652 Bacteria 8689
115 Ga0072941_1425573 3300005201 Bacteria 841
116 Ga0466705_447438 3300042612 Bacteria 8334
117 Ga0466711_069551 3300042615 Bacteria 17057
118 Ga0466715_165783 3300042616 Bacteria 28128
119 Ga0466718_018230 3300042617 Bacteria 6502
120 Ga0466723_298779 3300042618 Bacteria 58508
121 Ga0466726_194816 3300042619 Bacteria 1019
122 Ga0466729_018556 3300042621 Bacteria 4373
123 Ga0466691_036237 3300042593 Bacteria 2156
124 Ga0466707_015042 3300042601 Bacteria 1499
125 Ga0466704_372397 3300042643 Bacteria 34643
126 Ga0466704_396270 3300042643 Bacteria 41737
127 Ga0466708_139043 3300042652 Bacteria 1209
128 JGI24702J35022_10074598 3300002462 Bacteria 1831

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_049610 Ga0466690_049610_464_1138 224
2 3300042590 Ga0466690_175541 Ga0466690_175541_688_1362 224
3 3300042593 Ga0466691_109431 Ga0466691_109431_14875_15549 224
4 3300042593 Ga0466691_171670 Ga0466691_171670_31172_31846 224
5 3300042596 Ga0466696_138249 Ga0466696_138249_1718_2392 224
6 3300042606 Ga0466719_030150 Ga0466719_030150_2256_2930 224
7 3300042606 Ga0466719_188827 Ga0466719_188827_1178_1852 224
8 3300042615 Ga0466711_295583 Ga0466711_295583_4775_5449 224
9 3300042616 Ga0466715_337443 Ga0466715_337443_1049_1723 224
10 3300042620 Ga0466728_400389 Ga0466728_400389_622_1296 224
11 3300042643 Ga0466704_116109 Ga0466704_116109_63_737 224
12 3300042648 Ga0466709_322714 Ga0466709_322714_3674_4348 224
13 3300000089 AustNasuHG_c1031228 AustNasuHG_10312282 225
14 3300042593 Ga0466691_017457 Ga0466691_017457_3522_4199 225
15 3300042596 Ga0466696_083225 Ga0466696_083225_5240_5917 225
16 3300042596 Ga0466696_204621 Ga0466696_204621_65_742 225
17 3300042596 Ga0466696_443889 Ga0466696_443889_1642_2319 225
18 3300042605 Ga0466716_279455 Ga0466716_279455_28_705 225
19 3300042606 Ga0466719_048456 Ga0466719_048456_1268_1945 225
20 3300042612 Ga0466705_109985 Ga0466705_109985_4377_5054 225
21 3300042612 Ga0466705_175745 Ga0466705_175745_8131_8808 225
22 3300042616 Ga0466715_033756 Ga0466715_033756_820_1497 225
23 3300042619 Ga0466726_494320 Ga0466726_494320_1289_1993 225
24 3300042620 Ga0466728_292612 Ga0466728_292612_839_1516 225
25 3300042643 Ga0466704_006566 Ga0466704_006566_6266_6943 225
26 3300042643 Ga0466704_024150 Ga0466704_024150_8173_8850 225
27 3300042643 Ga0466704_034428 Ga0466704_034428_116_793 225
28 3300042652 Ga0466708_280552 Ga0466708_280552_180_857 225
29 iso_pr_bacteria 2781125692 2781430826 225
30 iso_pr_bacteria 2819994798 2819995361 225
31 3300002508 JGI24700J35501_10924911 JGI24700J35501_109249115 226
32 3300041968 Ga0456237_0000054 Ga0456237_0000054_4850_5530 226
33 3300042593 Ga0466691_026553 Ga0466691_026553_2021_2701 226
34 3300042617 Ga0466718_010753 Ga0466718_010753_52_732 226
35 3300042617 Ga0466718_018230 Ga0466718_018230_4416_5096 226
36 3300042618 Ga0466723_298779 Ga0466723_298779_10746_11426 226
37 3300042655 Ga0466727_025235 Ga0466727_025235_94_774 226
38 3300042655 Ga0466727_078113 Ga0466727_078113_77_757 226
39 3300042655 Ga0466727_164158 Ga0466727_164158_2805_3485 226
40 3300002462 JGI24702J35022_10074598 JGI24702J35022_100745982 227
41 3300005201 Ga0072941_1425573 Ga0072941_14255731 227
42 3300042593 Ga0466691_130220 Ga0466691_130220_612_1295 227
43 3300042601 Ga0466707_165919 Ga0466707_165919_108_791 227
44 3300042601 Ga0466707_244065 Ga0466707_244065_6430_7113 227
45 3300042612 Ga0466705_526240 Ga0466705_526240_3722_4405 227
46 3300042618 Ga0466723_009491 Ga0466723_009491_5495_6178 227
47 3300042652 Ga0466708_161805 Ga0466708_161805_631_1314 227
48 3300042593 Ga0466691_026489 Ga0466691_026489_3642_4328 228
49 3300042609 Ga0466722_251941 Ga0466722_251941_5135_5821 228
50 3300042609 Ga0466722_076941 Ga0466722_076941_32685_33374 229
51 3300042616 Ga0466715_308927 Ga0466715_308927_1094_1783 229
52 3300042618 Ga0466723_146217 Ga0466723_146217_586_1275 229
53 3300042643 Ga0466704_396270 Ga0466704_396270_36346_37035 229
54 3300041968 Ga0456237_0001006 Ga0456237_0001006_577_1269 230
55 3300042594 Ga0466694_385277 Ga0466694_385277_70_762 230
56 3300042617 Ga0466718_107072 Ga0466718_107072_2223_2915 230
57 3300042617 Ga0466718_107280 Ga0466718_107280_2219_2911 230
58 3300042618 Ga0466723_313586 Ga0466723_313586_599_1291 230
59 3300042624 Ga0466735_173814 Ga0466735_173814_578_1270 230
60 3300042655 Ga0466727_346411 Ga0466727_346411_124_816 230
61 3300002449 JGI24698J34947_10004681 JGI24698J34947_100046817 231
62 3300005201 Ga0072941_1038753 Ga0072941_10387533 231
63 3300042606 Ga0466719_015507 Ga0466719_015507_3321_4016 231
64 3300042609 Ga0466722_031350 Ga0466722_031350_3820_4515 231
65 3300042612 Ga0466705_447438 Ga0466705_447438_4215_4910 231
66 3300042616 Ga0466715_130088 Ga0466715_130088_3969_4664 231
67 3300042616 Ga0466715_183042 Ga0466715_183042_12544_13239 231
68 3300042643 Ga0466704_611227 Ga0466704_611227_3720_4415 231
69 3300042652 Ga0466708_139043 Ga0466708_139043_418_1113 231
70 3300042652 Ga0466708_321500 Ga0466708_321500_3487_4182 231
71 3300042652 Ga0466708_369214 Ga0466708_369214_367_1062 231
72 iso_pr_bacteria 2781125656 2781321332 231
73 3300009826 Ga0123355_10070502 Ga0123355_100705023 232
74 3300042605 Ga0466716_371466 Ga0466716_371466_102_800 232
75 3300042609 Ga0466722_019162 Ga0466722_019162_314_1012 232
76 3300042616 Ga0466715_165783 Ga0466715_165783_13507_14205 232
77 3300042620 Ga0466728_074870 Ga0466728_074870_571_1269 232
78 3300042591 Ga0466692_007897 Ga0466692_007897_30233_30934 233
79 3300042596 Ga0466696_166344 Ga0466696_166344_1644_2345 233
80 3300042616 Ga0466715_059755 Ga0466715_059755_727_1428 233
81 3300042619 Ga0466726_072713 Ga0466726_072713_10542_11243 233
82 3300042620 Ga0466728_026223 Ga0466728_026223_7538_8239 233
83 3300042601 Ga0466707_199102 Ga0466707_199102_324_1028 234
84 3300042619 Ga0466726_030058 Ga0466726_030058_15873_16577 234
85 3300042655 Ga0466727_224870 Ga0466727_224870_22064_22768 234
86 3300010049 Ga0123356_10580998 Ga0123356_105809982 235
87 3300042595 Ga0466695_356367 Ga0466695_356367_988_1695 235
88 3300042598 Ga0466701_081165 Ga0466701_081165_182_889 235
89 3300042606 Ga0466719_043341 Ga0466719_043341_6673_7380 235
90 3300042612 Ga0466705_072943 Ga0466705_072943_7017_7724 235
91 3300042615 Ga0466711_069551 Ga0466711_069551_9009_9803 235
92 3300042636 Ga0466703_124706 Ga0466703_124706_3160_3867 235
93 3300042643 Ga0466704_372397 Ga0466704_372397_14865_15572 235
94 3300042591 Ga0466692_191935 Ga0466692_191935_151_861 236
95 3300042648 Ga0466709_169124 Ga0466709_169124_1816_2541 236
96 3300010049 Ga0123356_10132059 Ga0123356_101320593 237
97 3300042609 Ga0466722_131298 Ga0466722_131298_2046_2759 237
98 3300042643 Ga0466704_407979 Ga0466704_407979_707_1471 237
99 3300042590 Ga0466690_114316 Ga0466690_114316_2424_3140 238
100 3300042616 Ga0466715_141497 Ga0466715_141497_11061_11777 238
101 3300042648 Ga0466709_042099 Ga0466709_042099_6633_7349 238
102 iso_pr_bacteria 2781125629 2781264907 238
103 iso_pr_bacteria 2781125630 2781267078 238
104 3300042593 Ga0466691_031329 Ga0466691_031329_1099_1818 239
105 3300042596 Ga0466696_007483 Ga0466696_007483_4766_5485 239
106 3300042612 Ga0466705_222658 Ga0466705_222658_2276_2995 239
107 3300042618 Ga0466723_008545 Ga0466723_008545_3859_4578 239
108 3300042618 Ga0466723_127240 Ga0466723_127240_5412_6131 239
109 3300042619 Ga0466726_124254 Ga0466726_124254_145_864 239
110 3300042643 Ga0466704_174326 Ga0466704_174326_1398_2117 239
111 3300041968 Ga0456237_0011973 Ga0456237_0011973_472_1194 240
112 3300042591 Ga0466692_118346 Ga0466692_118346_1598_2320 240
113 3300042619 Ga0466726_194816 Ga0466726_194816_155_946 240
114 3300042609 Ga0466722_151371 Ga0466722_151371_9920_10645 241
115 3300042636 Ga0466703_302657 Ga0466703_302657_23561_24286 241
116 3300042605 Ga0466716_170108 Ga0466716_170108_102_830 242
117 3300042606 Ga0466719_379062 Ga0466719_379062_86_814 242
118 3300042616 Ga0466715_084650 Ga0466715_084650_14668_15396 242
119 3300042618 Ga0466723_345919 Ga0466723_345919_1858_2586 242
120 3300042643 Ga0466704_189047 Ga0466704_189047_37_765 242
121 3300042648 Ga0466709_123577 Ga0466709_123577_564_1292 242
122 3300042652 Ga0466708_115921 Ga0466708_115921_26898_27626 242
123 3300042614 Ga0466712_208733 Ga0466712_208733_2043_2774 243
124 3300042643 Ga0466704_103151 Ga0466704_103151_10482_11213 243
125 3300042643 Ga0466704_612581 Ga0466704_612581_123_857 244
126 3300042593 Ga0466691_036237 Ga0466691_036237_400_1137 245
127 3300042606 Ga0466719_038097 Ga0466719_038097_6055_6885 246
128 iso_pr_bacteria 650716099 650879933 247
129 3300042606 Ga0466719_404328 Ga0466719_404328_2652_3398 248
130 3300042621 Ga0466729_018556 Ga0466729_018556_1575_2327 250
131 3300042622 Ga0466731_099313 Ga0466731_099313_6488_7273 251
132 3300042652 Ga0466708_135722 Ga0466708_135722_6821_7588 255
133 3300042593 Ga0466691_075838 Ga0466691_075838_901_1671 256
134 iso_pr_bacteria 650716102 650883630 263
135 3300042601 Ga0466707_015042 Ga0466707_015042_322_1161 279

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00633 HHH Helix-hairpin-helix motif 131 157 0.96
PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein 66 206 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00633 GO:0003677 DNA binding MF
PF00730 GO:0006284 base-excision repair BP

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.