Protein Family IF08484
Metagenome
Isolate
135
Members
42
Samples
128
Scaffolds
233.04
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_018556|Ga0466729_018556_1575_2327
- Length
- 250 aa
- Sequence
- MGKNKTTDWDGIVKALEKWRTSAQADEALKDNGAXXXXEPSADSGDPSVTTVAEQYHSDPWAVLASTILSLRTKDEVTLVRSQALLEKAPTAEALLALPVEEIEKLIYPVGFYHTKAQNLKKIAAIIMENYQGEVPADMDLLLAMPGVGRKTANLVLTEAFDMDGICVDVHVHRITNRLGVLRTGNRSVQSKNPEETEMILREILPKKYWKRINMLLVLYGQRVCRPISPFCSRCVMPEHCRRIGVERER
Sample Types
Isolate
5.2%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
34.1%
Termitidae
29.3%
Unclassified
19.5%
Rhinotermitidae
9.8%
Termopsidae
7.3%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 8 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 9 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 10 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_072943 | 3300042612 | Bacteria | 8986 |
| 2 | Ga0466705_222658 | 3300042612 | Bacteria | 3390 |
| 3 | Ga0466718_107280 | 3300042617 | Bacteria | 15107 |
| 4 | Ga0466728_026223 | 3300042620 | Bacteria | 12962 |
| 5 | Ga0456237_0001006 | 3300041968 | Bacteria | 4458 |
| 6 | Ga0466690_049610 | 3300042590 | Bacteria | 4496 |
| 7 | Ga0466691_109431 | 3300042593 | Bacteria | 17630 |
| 8 | Ga0466696_083225 | 3300042596 | Bacteria | 10013 |
| 9 | Ga0466696_166344 | 3300042596 | Bacteria | 3999 |
| 10 | Ga0466696_443889 | 3300042596 | Bacteria | 2865 |
| 11 | Ga0466716_170108 | 3300042605 | Bacteria | 2832 |
| 12 | Ga0466719_030150 | 3300042606 | Bacteria | 3047 |
| 13 | Ga0466722_251941 | 3300042609 | Bacteria | 6504 |
| 14 | Ga0466731_099313 | 3300042622 | Bacteria | 10230 |
| 15 | Ga0466703_124706 | 3300042636 | Bacteria | 13270 |
| 16 | Ga0466703_302657 | 3300042636 | Bacteria | 56159 |
| 17 | Ga0466704_006566 | 3300042643 | Bacteria | 13097 |
| 18 | Ga0466704_116109 | 3300042643 | Bacteria | 1683 |
| 19 | Ga0466709_169124 | 3300042648 | Bacteria | 5825 |
| 20 | Ga0466708_369214 | 3300042652 | Bacteria | 1246 |
| 21 | JGI24700J35501_10924911 | 3300002508 | Bacteria | 5628 |
| 22 | Ga0466715_033756 | 3300042616 | Bacteria | 2007 |
| 23 | Ga0466715_308927 | 3300042616 | Bacteria | 17155 |
| 24 | Ga0466723_008545 | 3300042618 | Bacteria | 11827 |
| 25 | Ga0466728_400389 | 3300042620 | Bacteria | 2093 |
| 26 | Ga0466692_118346 | 3300042591 | Bacteria | 2544 |
| 27 | Ga0466691_026553 | 3300042593 | Bacteria | 2852 |
| 28 | Ga0466696_204621 | 3300042596 | Bacteria | 5248 |
| 29 | Ga0466707_165919 | 3300042601 | Bacteria | 1156 |
| 30 | Ga0466719_188827 | 3300042606 | Bacteria | 2461 |
| 31 | Ga0466722_131298 | 3300042609 | Bacteria | 2792 |
| 32 | Ga0466708_280552 | 3300042652 | Bacteria | 3762 |
| 33 | Ga0466727_224870 | 3300042655 | Bacteria | 27964 |
| 34 | AustNasuHG_c1031228 | 3300000089 | Bacteria | 1510 |
| 35 | Ga0466715_084650 | 3300042616 | Bacteria | 17076 |
| 36 | Ga0466715_337443 | 3300042616 | Bacteria | 1738 |
| 37 | Ga0466723_146217 | 3300042618 | Bacteria | 2182 |
| 38 | Ga0466726_072713 | 3300042619 | Bacteria | 32187 |
| 39 | Ga0466728_074870 | 3300042620 | Bacteria | 1681 |
| 40 | Ga0466690_175541 | 3300042590 | Bacteria | 3691 |
| 41 | Ga0466691_017457 | 3300042593 | Bacteria | 5398 |
| 42 | Ga0466691_031329 | 3300042593 | Bacteria | 3140 |
| 43 | Ga0466691_075838 | 3300042593 | Bacteria | 3820 |
| 44 | Ga0466691_130220 | 3300042593 | Bacteria | 2592 |
| 45 | Ga0466695_356367 | 3300042595 | Bacteria | 3825 |
| 46 | Ga0466701_081165 | 3300042598 | Bacteria | 1521 |
| 47 | Ga0466716_279455 | 3300042605 | Bacteria | 1941 |
| 48 | Ga0466719_038097 | 3300042606 | Bacteria | 8338 |
| 49 | Ga0466719_048456 | 3300042606 | Bacteria | 2103 |
| 50 | Ga0466719_404328 | 3300042606 | Bacteria | 11399 |
| 51 | Ga0466735_173814 | 3300042624 | Bacteria | 1553 |
| 52 | Ga0466704_103151 | 3300042643 | Bacteria | 25700 |
| 53 | Ga0466704_174326 | 3300042643 | Bacteria | 4112 |
| 54 | Ga0466704_189047 | 3300042643 | Bacteria | 2726 |
| 55 | Ga0466704_611227 | 3300042643 | Bacteria | 9194 |
| 56 | Ga0466709_042099 | 3300042648 | Bacteria | 15630 |
| 57 | Ga0466708_115921 | 3300042652 | Bacteria | 45804 |
| 58 | Ga0466727_164158 | 3300042655 | Bacteria | 5530 |
| 59 | JGI24698J34947_10004681 | 3300002449 | Bacteria | 7467 |
| 60 | Ga0072941_1038753 | 3300005201 | Bacteria | 4603 |
| 61 | Ga0466711_295583 | 3300042615 | Bacteria | 5805 |
| 62 | Ga0466726_124254 | 3300042619 | Bacteria | 1411 |
| 63 | Ga0466690_114316 | 3300042590 | Bacteria | 8030 |
| 64 | Ga0466691_026489 | 3300042593 | Bacteria | 23896 |
| 65 | Ga0466696_007483 | 3300042596 | Bacteria | 8956 |
| 66 | Ga0466707_244065 | 3300042601 | Bacteria | 8993 |
| 67 | Ga0123355_10070502 | 3300009826 | Bacteria | 5613 |
| 68 | Ga0123356_10580998 | 3300010049 | Bacteria | 1284 |
| 69 | Ga0466709_322714 | 3300042648 | Unclassified | 10642 |
| 70 | Ga0466727_025235 | 3300042655 | Bacteria | 1527 |
| 71 | Ga0466727_346411 | 3300042655 | Bacteria | 2230 |
| 72 | Ga0466705_109985 | 3300042612 | Bacteria | 5917 |
| 73 | Ga0466705_526240 | 3300042612 | Bacteria | 5410 |
| 74 | Ga0466712_208733 | 3300042614 | Bacteria | 3195 |
| 75 | Ga0466715_059755 | 3300042616 | Bacteria | 8416 |
| 76 | Ga0466715_183042 | 3300042616 | Bacteria | 13421 |
| 77 | Ga0466718_010753 | 3300042617 | Bacteria | 6684 |
| 78 | Ga0466723_009491 | 3300042618 | Bacteria | 8123 |
| 79 | Ga0466723_313586 | 3300042618 | Bacteria | 1503 |
| 80 | Ga0466723_345919 | 3300042618 | Bacteria | 8337 |
| 81 | Ga0466707_199102 | 3300042601 | Bacteria | 2743 |
| 82 | Ga0466716_371466 | 3300042605 | Bacteria | 1037 |
| 83 | Ga0466722_151371 | 3300042609 | Bacteria | 28601 |
| 84 | Ga0466704_024150 | 3300042643 | Bacteria | 16258 |
| 85 | Ga0466708_161805 | 3300042652 | Bacteria | 2163 |
| 86 | Ga0466705_175745 | 3300042612 | Bacteria | 27252 |
| 87 | Ga0466715_141497 | 3300042616 | Bacteria | 16537 |
| 88 | Ga0466692_191935 | 3300042591 | Bacteria | 1868 |
| 89 | Ga0466694_385277 | 3300042594 | Bacteria | 1168 |
| 90 | Ga0466719_043341 | 3300042606 | Bacteria | 16280 |
| 91 | Ga0466719_379062 | 3300042606 | Bacteria | 2957 |
| 92 | Ga0466722_019162 | 3300042609 | Bacteria | 2208 |
| 93 | Ga0466722_031350 | 3300042609 | Bacteria | 16198 |
| 94 | Ga0466704_034428 | 3300042643 | Bacteria | 1472 |
| 95 | Ga0466704_612581 | 3300042643 | Bacteria | 1099 |
| 96 | Ga0466709_123577 | 3300042648 | Bacteria | 4864 |
| 97 | Ga0466727_078113 | 3300042655 | Bacteria | 1155 |
| 98 | Ga0466715_130088 | 3300042616 | Bacteria | 6053 |
| 99 | Ga0466718_107072 | 3300042617 | Bacteria | 14401 |
| 100 | Ga0466723_127240 | 3300042618 | Bacteria | 8487 |
| 101 | Ga0466726_030058 | 3300042619 | Bacteria | 22211 |
| 102 | Ga0466726_494320 | 3300042619 | Bacteria | 2610 |
| 103 | Ga0466728_292612 | 3300042620 | Bacteria | 14434 |
| 104 | Ga0456237_0000054 | 3300041968 | Bacteria | 16526 |
| 105 | Ga0456237_0011973 | 3300041968 | Bacteria | 1260 |
| 106 | Ga0466692_007897 | 3300042591 | Bacteria | 32184 |
| 107 | Ga0466691_171670 | 3300042593 | Bacteria | 41136 |
| 108 | Ga0466696_138249 | 3300042596 | Bacteria | 9688 |
| 109 | Ga0466719_015507 | 3300042606 | Bacteria | 4605 |
| 110 | Ga0466722_076941 | 3300042609 | Bacteria | 36712 |
| 111 | Ga0123356_10132059 | 3300010049 | Bacteria | 2448 |
| 112 | Ga0466704_407979 | 3300042643 | Bacteria | 1488 |
| 113 | Ga0466708_135722 | 3300042652 | Bacteria | 19458 |
| 114 | Ga0466708_321500 | 3300042652 | Bacteria | 8689 |
| 115 | Ga0072941_1425573 | 3300005201 | Bacteria | 841 |
| 116 | Ga0466705_447438 | 3300042612 | Bacteria | 8334 |
| 117 | Ga0466711_069551 | 3300042615 | Bacteria | 17057 |
| 118 | Ga0466715_165783 | 3300042616 | Bacteria | 28128 |
| 119 | Ga0466718_018230 | 3300042617 | Bacteria | 6502 |
| 120 | Ga0466723_298779 | 3300042618 | Bacteria | 58508 |
| 121 | Ga0466726_194816 | 3300042619 | Bacteria | 1019 |
| 122 | Ga0466729_018556 | 3300042621 | Bacteria | 4373 |
| 123 | Ga0466691_036237 | 3300042593 | Bacteria | 2156 |
| 124 | Ga0466707_015042 | 3300042601 | Bacteria | 1499 |
| 125 | Ga0466704_372397 | 3300042643 | Bacteria | 34643 |
| 126 | Ga0466704_396270 | 3300042643 | Bacteria | 41737 |
| 127 | Ga0466708_139043 | 3300042652 | Bacteria | 1209 |
| 128 | JGI24702J35022_10074598 | 3300002462 | Bacteria | 1831 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042590 | Ga0466690_049610 | Ga0466690_049610_464_1138 | 224 |
| 2 | 3300042590 | Ga0466690_175541 | Ga0466690_175541_688_1362 | 224 |
| 3 | 3300042593 | Ga0466691_109431 | Ga0466691_109431_14875_15549 | 224 |
| 4 | 3300042593 | Ga0466691_171670 | Ga0466691_171670_31172_31846 | 224 |
| 5 | 3300042596 | Ga0466696_138249 | Ga0466696_138249_1718_2392 | 224 |
| 6 | 3300042606 | Ga0466719_030150 | Ga0466719_030150_2256_2930 | 224 |
| 7 | 3300042606 | Ga0466719_188827 | Ga0466719_188827_1178_1852 | 224 |
| 8 | 3300042615 | Ga0466711_295583 | Ga0466711_295583_4775_5449 | 224 |
| 9 | 3300042616 | Ga0466715_337443 | Ga0466715_337443_1049_1723 | 224 |
| 10 | 3300042620 | Ga0466728_400389 | Ga0466728_400389_622_1296 | 224 |
| 11 | 3300042643 | Ga0466704_116109 | Ga0466704_116109_63_737 | 224 |
| 12 | 3300042648 | Ga0466709_322714 | Ga0466709_322714_3674_4348 | 224 |
| 13 | 3300000089 | AustNasuHG_c1031228 | AustNasuHG_10312282 | 225 |
| 14 | 3300042593 | Ga0466691_017457 | Ga0466691_017457_3522_4199 | 225 |
| 15 | 3300042596 | Ga0466696_083225 | Ga0466696_083225_5240_5917 | 225 |
| 16 | 3300042596 | Ga0466696_204621 | Ga0466696_204621_65_742 | 225 |
| 17 | 3300042596 | Ga0466696_443889 | Ga0466696_443889_1642_2319 | 225 |
| 18 | 3300042605 | Ga0466716_279455 | Ga0466716_279455_28_705 | 225 |
| 19 | 3300042606 | Ga0466719_048456 | Ga0466719_048456_1268_1945 | 225 |
| 20 | 3300042612 | Ga0466705_109985 | Ga0466705_109985_4377_5054 | 225 |
| 21 | 3300042612 | Ga0466705_175745 | Ga0466705_175745_8131_8808 | 225 |
| 22 | 3300042616 | Ga0466715_033756 | Ga0466715_033756_820_1497 | 225 |
| 23 | 3300042619 | Ga0466726_494320 | Ga0466726_494320_1289_1993 | 225 |
| 24 | 3300042620 | Ga0466728_292612 | Ga0466728_292612_839_1516 | 225 |
| 25 | 3300042643 | Ga0466704_006566 | Ga0466704_006566_6266_6943 | 225 |
| 26 | 3300042643 | Ga0466704_024150 | Ga0466704_024150_8173_8850 | 225 |
| 27 | 3300042643 | Ga0466704_034428 | Ga0466704_034428_116_793 | 225 |
| 28 | 3300042652 | Ga0466708_280552 | Ga0466708_280552_180_857 | 225 |
| 29 | iso_pr_bacteria | 2781125692 | 2781430826 | 225 |
| 30 | iso_pr_bacteria | 2819994798 | 2819995361 | 225 |
| 31 | 3300002508 | JGI24700J35501_10924911 | JGI24700J35501_109249115 | 226 |
| 32 | 3300041968 | Ga0456237_0000054 | Ga0456237_0000054_4850_5530 | 226 |
| 33 | 3300042593 | Ga0466691_026553 | Ga0466691_026553_2021_2701 | 226 |
| 34 | 3300042617 | Ga0466718_010753 | Ga0466718_010753_52_732 | 226 |
| 35 | 3300042617 | Ga0466718_018230 | Ga0466718_018230_4416_5096 | 226 |
| 36 | 3300042618 | Ga0466723_298779 | Ga0466723_298779_10746_11426 | 226 |
| 37 | 3300042655 | Ga0466727_025235 | Ga0466727_025235_94_774 | 226 |
| 38 | 3300042655 | Ga0466727_078113 | Ga0466727_078113_77_757 | 226 |
| 39 | 3300042655 | Ga0466727_164158 | Ga0466727_164158_2805_3485 | 226 |
| 40 | 3300002462 | JGI24702J35022_10074598 | JGI24702J35022_100745982 | 227 |
| 41 | 3300005201 | Ga0072941_1425573 | Ga0072941_14255731 | 227 |
| 42 | 3300042593 | Ga0466691_130220 | Ga0466691_130220_612_1295 | 227 |
| 43 | 3300042601 | Ga0466707_165919 | Ga0466707_165919_108_791 | 227 |
| 44 | 3300042601 | Ga0466707_244065 | Ga0466707_244065_6430_7113 | 227 |
| 45 | 3300042612 | Ga0466705_526240 | Ga0466705_526240_3722_4405 | 227 |
| 46 | 3300042618 | Ga0466723_009491 | Ga0466723_009491_5495_6178 | 227 |
| 47 | 3300042652 | Ga0466708_161805 | Ga0466708_161805_631_1314 | 227 |
| 48 | 3300042593 | Ga0466691_026489 | Ga0466691_026489_3642_4328 | 228 |
| 49 | 3300042609 | Ga0466722_251941 | Ga0466722_251941_5135_5821 | 228 |
| 50 | 3300042609 | Ga0466722_076941 | Ga0466722_076941_32685_33374 | 229 |
| 51 | 3300042616 | Ga0466715_308927 | Ga0466715_308927_1094_1783 | 229 |
| 52 | 3300042618 | Ga0466723_146217 | Ga0466723_146217_586_1275 | 229 |
| 53 | 3300042643 | Ga0466704_396270 | Ga0466704_396270_36346_37035 | 229 |
| 54 | 3300041968 | Ga0456237_0001006 | Ga0456237_0001006_577_1269 | 230 |
| 55 | 3300042594 | Ga0466694_385277 | Ga0466694_385277_70_762 | 230 |
| 56 | 3300042617 | Ga0466718_107072 | Ga0466718_107072_2223_2915 | 230 |
| 57 | 3300042617 | Ga0466718_107280 | Ga0466718_107280_2219_2911 | 230 |
| 58 | 3300042618 | Ga0466723_313586 | Ga0466723_313586_599_1291 | 230 |
| 59 | 3300042624 | Ga0466735_173814 | Ga0466735_173814_578_1270 | 230 |
| 60 | 3300042655 | Ga0466727_346411 | Ga0466727_346411_124_816 | 230 |
| 61 | 3300002449 | JGI24698J34947_10004681 | JGI24698J34947_100046817 | 231 |
| 62 | 3300005201 | Ga0072941_1038753 | Ga0072941_10387533 | 231 |
| 63 | 3300042606 | Ga0466719_015507 | Ga0466719_015507_3321_4016 | 231 |
| 64 | 3300042609 | Ga0466722_031350 | Ga0466722_031350_3820_4515 | 231 |
| 65 | 3300042612 | Ga0466705_447438 | Ga0466705_447438_4215_4910 | 231 |
| 66 | 3300042616 | Ga0466715_130088 | Ga0466715_130088_3969_4664 | 231 |
| 67 | 3300042616 | Ga0466715_183042 | Ga0466715_183042_12544_13239 | 231 |
| 68 | 3300042643 | Ga0466704_611227 | Ga0466704_611227_3720_4415 | 231 |
| 69 | 3300042652 | Ga0466708_139043 | Ga0466708_139043_418_1113 | 231 |
| 70 | 3300042652 | Ga0466708_321500 | Ga0466708_321500_3487_4182 | 231 |
| 71 | 3300042652 | Ga0466708_369214 | Ga0466708_369214_367_1062 | 231 |
| 72 | iso_pr_bacteria | 2781125656 | 2781321332 | 231 |
| 73 | 3300009826 | Ga0123355_10070502 | Ga0123355_100705023 | 232 |
| 74 | 3300042605 | Ga0466716_371466 | Ga0466716_371466_102_800 | 232 |
| 75 | 3300042609 | Ga0466722_019162 | Ga0466722_019162_314_1012 | 232 |
| 76 | 3300042616 | Ga0466715_165783 | Ga0466715_165783_13507_14205 | 232 |
| 77 | 3300042620 | Ga0466728_074870 | Ga0466728_074870_571_1269 | 232 |
| 78 | 3300042591 | Ga0466692_007897 | Ga0466692_007897_30233_30934 | 233 |
| 79 | 3300042596 | Ga0466696_166344 | Ga0466696_166344_1644_2345 | 233 |
| 80 | 3300042616 | Ga0466715_059755 | Ga0466715_059755_727_1428 | 233 |
| 81 | 3300042619 | Ga0466726_072713 | Ga0466726_072713_10542_11243 | 233 |
| 82 | 3300042620 | Ga0466728_026223 | Ga0466728_026223_7538_8239 | 233 |
| 83 | 3300042601 | Ga0466707_199102 | Ga0466707_199102_324_1028 | 234 |
| 84 | 3300042619 | Ga0466726_030058 | Ga0466726_030058_15873_16577 | 234 |
| 85 | 3300042655 | Ga0466727_224870 | Ga0466727_224870_22064_22768 | 234 |
| 86 | 3300010049 | Ga0123356_10580998 | Ga0123356_105809982 | 235 |
| 87 | 3300042595 | Ga0466695_356367 | Ga0466695_356367_988_1695 | 235 |
| 88 | 3300042598 | Ga0466701_081165 | Ga0466701_081165_182_889 | 235 |
| 89 | 3300042606 | Ga0466719_043341 | Ga0466719_043341_6673_7380 | 235 |
| 90 | 3300042612 | Ga0466705_072943 | Ga0466705_072943_7017_7724 | 235 |
| 91 | 3300042615 | Ga0466711_069551 | Ga0466711_069551_9009_9803 | 235 |
| 92 | 3300042636 | Ga0466703_124706 | Ga0466703_124706_3160_3867 | 235 |
| 93 | 3300042643 | Ga0466704_372397 | Ga0466704_372397_14865_15572 | 235 |
| 94 | 3300042591 | Ga0466692_191935 | Ga0466692_191935_151_861 | 236 |
| 95 | 3300042648 | Ga0466709_169124 | Ga0466709_169124_1816_2541 | 236 |
| 96 | 3300010049 | Ga0123356_10132059 | Ga0123356_101320593 | 237 |
| 97 | 3300042609 | Ga0466722_131298 | Ga0466722_131298_2046_2759 | 237 |
| 98 | 3300042643 | Ga0466704_407979 | Ga0466704_407979_707_1471 | 237 |
| 99 | 3300042590 | Ga0466690_114316 | Ga0466690_114316_2424_3140 | 238 |
| 100 | 3300042616 | Ga0466715_141497 | Ga0466715_141497_11061_11777 | 238 |
| 101 | 3300042648 | Ga0466709_042099 | Ga0466709_042099_6633_7349 | 238 |
| 102 | iso_pr_bacteria | 2781125629 | 2781264907 | 238 |
| 103 | iso_pr_bacteria | 2781125630 | 2781267078 | 238 |
| 104 | 3300042593 | Ga0466691_031329 | Ga0466691_031329_1099_1818 | 239 |
| 105 | 3300042596 | Ga0466696_007483 | Ga0466696_007483_4766_5485 | 239 |
| 106 | 3300042612 | Ga0466705_222658 | Ga0466705_222658_2276_2995 | 239 |
| 107 | 3300042618 | Ga0466723_008545 | Ga0466723_008545_3859_4578 | 239 |
| 108 | 3300042618 | Ga0466723_127240 | Ga0466723_127240_5412_6131 | 239 |
| 109 | 3300042619 | Ga0466726_124254 | Ga0466726_124254_145_864 | 239 |
| 110 | 3300042643 | Ga0466704_174326 | Ga0466704_174326_1398_2117 | 239 |
| 111 | 3300041968 | Ga0456237_0011973 | Ga0456237_0011973_472_1194 | 240 |
| 112 | 3300042591 | Ga0466692_118346 | Ga0466692_118346_1598_2320 | 240 |
| 113 | 3300042619 | Ga0466726_194816 | Ga0466726_194816_155_946 | 240 |
| 114 | 3300042609 | Ga0466722_151371 | Ga0466722_151371_9920_10645 | 241 |
| 115 | 3300042636 | Ga0466703_302657 | Ga0466703_302657_23561_24286 | 241 |
| 116 | 3300042605 | Ga0466716_170108 | Ga0466716_170108_102_830 | 242 |
| 117 | 3300042606 | Ga0466719_379062 | Ga0466719_379062_86_814 | 242 |
| 118 | 3300042616 | Ga0466715_084650 | Ga0466715_084650_14668_15396 | 242 |
| 119 | 3300042618 | Ga0466723_345919 | Ga0466723_345919_1858_2586 | 242 |
| 120 | 3300042643 | Ga0466704_189047 | Ga0466704_189047_37_765 | 242 |
| 121 | 3300042648 | Ga0466709_123577 | Ga0466709_123577_564_1292 | 242 |
| 122 | 3300042652 | Ga0466708_115921 | Ga0466708_115921_26898_27626 | 242 |
| 123 | 3300042614 | Ga0466712_208733 | Ga0466712_208733_2043_2774 | 243 |
| 124 | 3300042643 | Ga0466704_103151 | Ga0466704_103151_10482_11213 | 243 |
| 125 | 3300042643 | Ga0466704_612581 | Ga0466704_612581_123_857 | 244 |
| 126 | 3300042593 | Ga0466691_036237 | Ga0466691_036237_400_1137 | 245 |
| 127 | 3300042606 | Ga0466719_038097 | Ga0466719_038097_6055_6885 | 246 |
| 128 | iso_pr_bacteria | 650716099 | 650879933 | 247 |
| 129 | 3300042606 | Ga0466719_404328 | Ga0466719_404328_2652_3398 | 248 |
| 130 | 3300042621 | Ga0466729_018556 | Ga0466729_018556_1575_2327 | 250 |
| 131 | 3300042622 | Ga0466731_099313 | Ga0466731_099313_6488_7273 | 251 |
| 132 | 3300042652 | Ga0466708_135722 | Ga0466708_135722_6821_7588 | 255 |
| 133 | 3300042593 | Ga0466691_075838 | Ga0466691_075838_901_1671 | 256 |
| 134 | iso_pr_bacteria | 650716102 | 650883630 | 263 |
| 135 | 3300042601 | Ga0466707_015042 | Ga0466707_015042_322_1161 | 279 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00633 | GO:0003677 | DNA binding | MF |
| PF00730 | GO:0006284 | base-excision repair | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.8 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.