Protein Family IF08477

Metagenome Isolate
127 Members
29 Samples
126 Scaffolds
392.54 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_480762|Ga0466728_480762_1220_2503
Length
427 aa
Sequence
MSIKCFLILYNRRFSLVKRQRGFKYMMDIGPIHRKEYELDADRSEPVVIAEAPGRIHYLGEHGEPKAGLYLSSAIDRYIRVAVSMRKDNSLRFFAADLGERKRTTLVNLKYKREDRWANHIKVAIHIFAELGYPVKGLNFTMAGDIPQQVGLASSSALETAAAVALKGFFKAPVSEKELLNRLAASKTLFFGKNFSPVDYLVILQAKKNQFLLVDEATLEVKRIKSPLSKYKLLIMDSRVPRMGAEEELNQRLEDIKKGLELLSRKKQGASFRDYVTADLVESMGNLSEEIRRRSMHVIQEIRRVNDAEDALKKEDFPSLSKIIYHSHESLRDLYEVSCPEIDWLVKRAQELEGALGSRMTGQGFGGCTYTFIKESAISDYKKKLEDYERIFGFHPVIYEIRLATGARIVPEDQKLVRAKGKAGNSG

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 50.0%
Termitidae 21.4%
Termopsidae 10.7%
Rhinotermitidae 10.7%
Unclassified 7.1%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
2 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
3 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
4 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
5 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 650716102 Treponema primitia ZAS-2 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_218655 3300042612 Bacteria 5811
2 Ga0466732_125342 3300042656 Bacteria 4223
3 Ga0466703_135800 3300042636 Bacteria 2698
4 Ga0466704_318355 3300042643 Bacteria 8379
5 Ga0466704_566362 3300042643 Bacteria 3983
6 Ga0466708_090544 3300042652 Bacteria 36740
7 Ga0466708_101976 3300042652 Bacteria 9047
8 Ga0466727_290729 3300042655 Bacteria 2954
9 Ga0466690_098390 3300042590 Bacteria 19097
10 Ga0466690_123461 3300042590 Bacteria 11477
11 Ga0466694_014929 3300042594 Bacteria 1974
12 Ga0466719_033879 3300042606 Bacteria 18159
13 Ga0466719_116137 3300042606 Bacteria 7752
14 Ga0466722_191746 3300042609 Bacteria 17517
15 Ga0466715_159039 3300042616 Bacteria 24553
16 Ga0466718_077162 3300042617 Bacteria 1494
17 Ga0466708_062527 3300042652 Bacteria 36730
18 Ga0466696_185771 3300042596 Bacteria 2940
19 Ga0466696_236256 3300042596 Bacteria 9193
20 Ga0466716_234589 3300042605 Bacteria 18743
21 Ga0466715_038471 3300042616 Bacteria 14523
22 Ga0466715_120957 3300042616 Bacteria 3508
23 Ga0466715_161310 3300042616 Bacteria 19000
24 Ga0466715_552892 3300042616 Bacteria 8190
25 Ga0466726_155921 3300042619 Bacteria 16976
26 Ga0466728_344395 3300042620 Bacteria 1689
27 Ga0072941_1002755 3300005201 Bacteria 5549
28 Ga0072941_1013540 3300005201 Bacteria 9254
29 Ga0466704_123193 3300042643 Bacteria 9664
30 Ga0466709_029034 3300042648 Bacteria 17943
31 Ga0466709_170909 3300042648 Bacteria 9131
32 Ga0466709_400325 3300042648 Bacteria 4654
33 Ga0466708_127770 3300042652 Bacteria 5044
34 Ga0466691_210489 3300042593 Bacteria 6638
35 Ga0466699_012876 3300042597 Bacteria 1748
36 Ga0466716_052216 3300042605 Bacteria 6322
37 Ga0466719_146973 3300042606 Bacteria 6526
38 Ga0466722_170982 3300042609 Bacteria 10335
39 Ga0466722_234306 3300042609 Bacteria 2459
40 Ga0466711_236060 3300042615 Bacteria 9441
41 Ga0466715_017458 3300042616 Bacteria 2899
42 Ga0466715_071147 3300042616 Bacteria 1808
43 Ga0466728_480762 3300042620 Bacteria 2868
44 Ga0466729_012519 3300042621 Bacteria 1917
45 Ga0466735_049275 3300042624 Bacteria 1408
46 Ga0466704_134527 3300042643 Unclassified 4233
47 Ga0466709_185307 3300042648 Bacteria 1436
48 Ga0466708_027385 3300042652 Bacteria 4814
49 Ga0466708_113182 3300042652 Bacteria 1563
50 Ga0466708_140935 3300042652 Bacteria 12492
51 Ga0466708_459830 3300042652 Bacteria 3332
52 Ga0466691_080916 3300042593 Bacteria 2203
53 Ga0466716_176770 3300042605 Bacteria 23050
54 Ga0466719_005301 3300042606 Bacteria 2435
55 Ga0466719_132596 3300042606 Unclassified 13183
56 Ga0466719_547707 3300042606 Bacteria 2405
57 Ga0466715_119279 3300042616 Bacteria 6013
58 Ga0466715_196890 3300042616 Bacteria 23985
59 Ga0466723_147070 3300042618 Bacteria 16221
60 Ga0466726_138450 3300042619 Bacteria 2536
61 Ga0466726_240290 3300042619 Bacteria 1997
62 Ga0466728_156223 3300042620 Bacteria 2161
63 Ga0072941_1003788 3300005201 Bacteria 18720
64 Ga0466705_162890 3300042612 Bacteria 2964
65 Ga0466705_385985 3300042612 Bacteria 13657
66 Ga0466703_382867 3300042636 Bacteria 1650
67 Ga0466704_343782 3300042643 Bacteria 17755
68 Ga0466709_172900 3300042648 Bacteria 6290
69 Ga0466709_188703 3300042648 Bacteria 9107
70 Ga0466727_176950 3300042655 Bacteria 21135
71 Ga0466692_097561 3300042591 Bacteria 53967
72 Ga0466696_396944 3300042596 Bacteria 3234
73 Ga0466719_369214 3300042606 Unclassified 3217
74 Ga0466728_390489 3300042620 Unclassified 5009
75 Ga0072940_1020326 3300005200 Bacteria 2113
76 Ga0466705_207521 3300042612 Bacteria 3465
77 Ga0466704_035569 3300042643 Bacteria 21995
78 Ga0466704_220620 3300042643 Bacteria 18406
79 Ga0466709_082284 3300042648 Bacteria 24819
80 Ga0466708_351296 3300042652 Bacteria 2743
81 Ga0466727_080128 3300042655 Bacteria 3084
82 Ga0466727_281079 3300042655 Bacteria 2994
83 Ga0466690_284777 3300042590 Bacteria 2972
84 Ga0466691_055171 3300042593 Bacteria 14611
85 Ga0466696_287416 3300042596 Bacteria 3271
86 Ga0466707_335159 3300042601 Bacteria 2388
87 Ga0466719_089881 3300042606 Bacteria 12285
88 Ga0466711_427949 3300042615 Bacteria 2867
89 Ga0466715_429031 3300042616 Bacteria 2592
90 Ga0466715_526925 3300042616 Bacteria 3109
91 Ga0466718_107985 3300042617 Bacteria 9726
92 Ga0466723_345702 3300042618 Bacteria 6529
93 Ga0466726_189176 3300042619 Bacteria 6098
94 Ga0466728_036121 3300042620 Bacteria 12465
95 Ga0466705_095695 3300042612 Bacteria 9175
96 Ga0466703_038424 3300042636 Bacteria 14630
97 Ga0466703_060769 3300042636 Bacteria 7073
98 Ga0466691_088497 3300042593 Unclassified 2921
99 Ga0466691_176051 3300042593 Bacteria 11368
100 Ga0466691_180552 3300042593 Bacteria 23586
101 Ga0466696_328391 3300042596 Bacteria 16310
102 Ga0466716_054694 3300042605 Bacteria 6604
103 Ga0466719_088550 3300042606 Bacteria 22253
104 Ga0466719_457871 3300042606 Bacteria 1828
105 Ga0466711_044510 3300042615 Bacteria 12780
106 Ga0466711_135544 3300042615 Bacteria 26216
107 Ga0466715_030833 3300042616 Bacteria 7984
108 Ga0466723_317332 3300042618 Bacteria 7111
109 Ga0466728_022815 3300042620 Bacteria 13977
110 Ga0466728_068052 3300042620 Bacteria 10664
111 Ga0466728_231062 3300042620 Bacteria 10677
112 Ga0466703_190431 3300042636 Bacteria 5571
113 Ga0466708_081131 3300042652 Bacteria 20083
114 Ga0466708_460396 3300042652 Bacteria 3704
115 Ga0466694_123542 3300042594 Bacteria 2948
116 Ga0466719_292138 3300042606 Bacteria 2885
117 Ga0466719_297647 3300042606 Bacteria 41658
118 Ga0466722_059803 3300042609 Bacteria 24916
119 Ga0466705_432179 3300042612 Unclassified 11376
120 Ga0466705_489561 3300042612 Bacteria 2179
121 Ga0466712_005457 3300042614 Bacteria 4188
122 Ga0466711_409816 3300042615 Bacteria 4055
123 Ga0466715_071701 3300042616 Bacteria 16717
124 Ga0466715_557463 3300042616 Bacteria 12317
125 Ga0466723_043646 3300042618 Bacteria 2111
126 Ga0466726_043758 3300042619 Bacteria 3902

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_071147 Ga0466715_071147_142_1173 343
2 3300042616 Ga0466715_552892 Ga0466715_552892_5355_6389 344
3 3300042655 Ga0466727_176950 Ga0466727_176950_9800_10966 360
4 3300042606 Ga0466719_457871 Ga0466719_457871_717_1817 366
5 3300042606 Ga0466719_547707 Ga0466719_547707_21_1121 366
6 3300042615 Ga0466711_409816 Ga0466711_409816_49_1239 376
7 3300042612 Ga0466705_095695 Ga0466705_095695_594_1751 385
8 3300042643 Ga0466704_343782 Ga0466704_343782_10644_11801 385
9 3300042606 Ga0466719_146973 Ga0466719_146973_4244_5404 386
10 3300042616 Ga0466715_030833 Ga0466715_030833_5494_6705 386
11 3300042594 Ga0466694_014929 Ga0466694_014929_28_1191 387
12 3300042605 Ga0466716_054694 Ga0466716_054694_5004_6167 387
13 3300042606 Ga0466719_088550 Ga0466719_088550_541_1704 387
14 3300042606 Ga0466719_297647 Ga0466719_297647_14960_16123 387
15 3300042612 Ga0466705_218655 Ga0466705_218655_389_1552 387
16 3300042614 Ga0466712_005457 Ga0466712_005457_1715_2878 387
17 3300042615 Ga0466711_236060 Ga0466711_236060_2464_3627 387
18 3300042616 Ga0466715_017458 Ga0466715_017458_202_1365 387
19 3300042616 Ga0466715_038471 Ga0466715_038471_7828_9006 387
20 3300042616 Ga0466715_119279 Ga0466715_119279_837_2000 387
21 3300042616 Ga0466715_161310 Ga0466715_161310_1678_2841 387
22 3300042618 Ga0466723_317332 Ga0466723_317332_1840_3003 387
23 3300042636 Ga0466703_060769 Ga0466703_060769_1631_2794 387
24 3300042643 Ga0466704_220620 Ga0466704_220620_348_1511 387
25 3300042648 Ga0466709_082284 Ga0466709_082284_14423_15586 387
26 3300042648 Ga0466709_172900 Ga0466709_172900_4892_6055 387
27 3300042652 Ga0466708_062527 Ga0466708_062527_18204_19367 387
28 3300042652 Ga0466708_127770 Ga0466708_127770_2657_3820 387
29 3300042655 Ga0466727_080128 Ga0466727_080128_634_1797 387
30 3300005201 Ga0072941_1002755 Ga0072941_10027553 388
31 3300005201 Ga0072941_1013540 Ga0072941_101354010 388
32 3300042591 Ga0466692_097561 Ga0466692_097561_16759_17925 388
33 3300042593 Ga0466691_176051 Ga0466691_176051_5043_6209 388
34 3300042593 Ga0466691_180552 Ga0466691_180552_18540_19706 388
35 3300042593 Ga0466691_210489 Ga0466691_210489_4900_6066 388
36 3300042594 Ga0466694_123542 Ga0466694_123542_1297_2463 388
37 3300042596 Ga0466696_185771 Ga0466696_185771_596_1762 388
38 3300042605 Ga0466716_176770 Ga0466716_176770_14963_16129 388
39 3300042606 Ga0466719_005301 Ga0466719_005301_307_1473 388
40 3300042606 Ga0466719_369214 Ga0466719_369214_1288_2454 388
41 3300042609 Ga0466722_059803 Ga0466722_059803_4248_5414 388
42 3300042616 Ga0466715_196890 Ga0466715_196890_7035_8201 388
43 3300042617 Ga0466718_077162 Ga0466718_077162_291_1457 388
44 3300042617 Ga0466718_107985 Ga0466718_107985_5889_7055 388
45 3300042619 Ga0466726_155921 Ga0466726_155921_10303_11469 388
46 3300042619 Ga0466726_189176 Ga0466726_189176_4273_5439 388
47 3300042620 Ga0466728_156223 Ga0466728_156223_18_1184 388
48 3300042620 Ga0466728_231062 Ga0466728_231062_389_1555 388
49 3300042636 Ga0466703_135800 Ga0466703_135800_910_2076 388
50 3300042648 Ga0466709_188703 Ga0466709_188703_1350_2516 388
51 3300042652 Ga0466708_113182 Ga0466708_113182_270_1436 388
52 3300042652 Ga0466708_140935 Ga0466708_140935_1555_2721 388
53 3300042652 Ga0466708_351296 Ga0466708_351296_508_1674 388
54 3300042655 Ga0466727_290729 Ga0466727_290729_1768_2934 388
55 iso_pr_bacteria 650716102 650881996 388
56 3300005200 Ga0072940_1020326 Ga0072940_10203261 389
57 3300042596 Ga0466696_236256 Ga0466696_236256_4195_5364 389
58 3300042605 Ga0466716_234589 Ga0466716_234589_7243_8412 389
59 3300042612 Ga0466705_207521 Ga0466705_207521_692_1861 389
60 3300042616 Ga0466715_526925 Ga0466715_526925_1867_3036 389
61 3300042618 Ga0466723_345702 Ga0466723_345702_5091_6260 389
62 3300042619 Ga0466726_043758 Ga0466726_043758_1749_2918 389
63 3300042619 Ga0466726_138450 Ga0466726_138450_1038_2207 389
64 3300042620 Ga0466728_022815 Ga0466728_022815_5555_6724 389
65 3300042620 Ga0466728_344395 Ga0466728_344395_464_1633 389
66 3300042620 Ga0466728_390489 Ga0466728_390489_905_2074 389
67 3300042612 Ga0466705_162890 Ga0466705_162890_745_1917 390
68 3300042615 Ga0466711_427949 Ga0466711_427949_1285_2457 390
69 3300042621 Ga0466729_012519 Ga0466729_012519_477_1649 390
70 3300042636 Ga0466703_038424 Ga0466703_038424_6941_8113 390
71 3300042643 Ga0466704_035569 Ga0466704_035569_5658_6830 390
72 3300042643 Ga0466704_318355 Ga0466704_318355_6018_7190 390
73 3300042648 Ga0466709_170909 Ga0466709_170909_4376_5548 390
74 3300042648 Ga0466709_185307 Ga0466709_185307_249_1421 390
75 3300042593 Ga0466691_088497 Ga0466691_088497_1448_2623 391
76 3300042606 Ga0466719_033879 Ga0466719_033879_16825_18000 391
77 3300042606 Ga0466719_116137 Ga0466719_116137_1344_2519 391
78 3300042616 Ga0466715_120957 Ga0466715_120957_892_2067 391
79 3300042616 Ga0466715_557463 Ga0466715_557463_3648_4823 391
80 3300042618 Ga0466723_147070 Ga0466723_147070_9963_11138 391
81 3300042620 Ga0466728_036121 Ga0466728_036121_509_1684 391
82 3300042590 Ga0466690_123461 Ga0466690_123461_6062_7240 392
83 3300042601 Ga0466707_335159 Ga0466707_335159_872_2050 392
84 3300042618 Ga0466723_043646 Ga0466723_043646_144_1322 392
85 3300042652 Ga0466708_027385 Ga0466708_027385_2060_3238 392
86 3300042655 Ga0466727_281079 Ga0466727_281079_1524_2702 392
87 3300042615 Ga0466711_044510 Ga0466711_044510_5331_6512 393
88 3300042616 Ga0466715_071701 Ga0466715_071701_14541_15722 393
89 3300042609 Ga0466722_170982 Ga0466722_170982_8540_9724 394
90 3300042619 Ga0466726_240290 Ga0466726_240290_781_1965 394
91 3300042652 Ga0466708_081131 Ga0466708_081131_7789_8979 396
92 3300042652 Ga0466708_459830 Ga0466708_459830_13_1206 397
93 3300042652 Ga0466708_460396 Ga0466708_460396_13_1206 397
94 3300005201 Ga0072941_1003788 Ga0072941_100378813 398
95 3300042624 Ga0466735_049275 Ga0466735_049275_160_1356 398
96 3300042656 Ga0466732_125342 Ga0466732_125342_1016_2212 398
97 3300042609 Ga0466722_191746 Ga0466722_191746_6627_8738 400
98 3300042612 Ga0466705_432179 Ga0466705_432179_5776_6981 401
99 3300042612 Ga0466705_489561 Ga0466705_489561_390_1595 401
100 3300042636 Ga0466703_382867 Ga0466703_382867_363_1568 401
101 3300042643 Ga0466704_134527 Ga0466704_134527_600_1805 401
102 3300042616 Ga0466715_429031 Ga0466715_429031_251_1459 402
103 3300042643 Ga0466704_123193 Ga0466704_123193_2264_3472 402
104 3300042648 Ga0466709_029034 Ga0466709_029034_517_1725 402
105 3300042609 Ga0466722_234306 Ga0466722_234306_136_1347 403
106 3300042596 Ga0466696_287416 Ga0466696_287416_912_2135 407
107 3300042596 Ga0466696_328391 Ga0466696_328391_7174_8397 407
108 3300042636 Ga0466703_190431 Ga0466703_190431_1652_2875 407
109 3300042590 Ga0466690_098390 Ga0466690_098390_7908_9134 408
110 3300042596 Ga0466696_396944 Ga0466696_396944_1493_2719 408
111 3300042605 Ga0466716_052216 Ga0466716_052216_4767_5993 408
112 3300042643 Ga0466704_566362 Ga0466704_566362_2367_3593 408
113 3300042652 Ga0466708_101976 Ga0466708_101976_463_1689 408
114 3300042590 Ga0466690_284777 Ga0466690_284777_265_1494 409
115 3300042593 Ga0466691_055171 Ga0466691_055171_996_2225 409
116 3300042606 Ga0466719_132596 Ga0466719_132596_10497_11726 409
117 3300042615 Ga0466711_135544 Ga0466711_135544_3174_4403 409
118 3300042616 Ga0466715_159039 Ga0466715_159039_12491_13720 409
119 3300042620 Ga0466728_068052 Ga0466728_068052_5079_6308 409
120 3300042648 Ga0466709_400325 Ga0466709_400325_3273_4502 409
121 3300042652 Ga0466708_090544 Ga0466708_090544_24003_25232 409
122 3300042593 Ga0466691_080916 Ga0466691_080916_667_1908 413
123 3300042597 Ga0466699_012876 Ga0466699_012876_452_1696 414
124 3300042606 Ga0466719_089881 Ga0466719_089881_1090_2343 417
125 3300042612 Ga0466705_385985 Ga0466705_385985_1353_2612 419
126 3300042606 Ga0466719_292138 Ga0466719_292138_155_1429 424
127 3300042620 Ga0466728_480762 Ga0466728_480762_1220_2503 427

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature 44 84 0.9
PF08544 GHMP_kinases_C GHMP kinases C terminal 309 377 0.86
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 120 202 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00288 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.